Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Zrou_YGOB_EST37.128ON1681688891e-124
ZYRO0C05258gsingletonOFF87864478e-58
YIL009C-A (EST3)7.128ON1811774021e-49
Skud_9.1637.128ON1801763942e-48
Smik_9.1857.128ON1821793917e-48
NCAS0E021507.128ON1851813901e-47
NDAI0E036907.128ON1961933743e-45
TDEL0H029007.128ON1881833501e-41
Suva_9.1957.128ON1891723343e-39
KNAG0L009607.128ON1851653256e-38
Sklu_YGOB_EST37.128ON1961823162e-36
CAGL0C03828g7.128ON1801633049e-35
KAFR0L004807.128ON1801633012e-34
Kpol_1062.557.128ON1821682994e-34
TPHA0C043107.128ON2011972771e-30
ADL016C7.128ON2021822744e-30
Kwal_YGOB_EST37.128ON1921752711e-29
Kthe_YGOB_EST37.128ON1931652195e-22
TBLA0A009607.128ON2151212066e-20
KLLA0D14289g7.128ON1841711794e-16
Sklu_YGOB_Anc_7.128singletonOFF98971352e-10
Kwal_55.20848singletonOFF96941263e-09
KLTH0F12606gsingletonOFF96831063e-06
KLLA0D07304g8.652ON46554662.5
Kpol_1001.214.313ON55660654.1
KLTH0E13420g8.580ON39672636.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Zrou_YGOB_EST3
         (168 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Zrou_YGOB_EST3 Chr3 complement(410153..410401,410403..410660) [5...   347   e-124
ZYRO0C05258g Chr3 complement(410397..410660) [264 bp, 87 aa] {OF...   176   8e-58
YIL009C-A Chr9 complement(335666..335935,335937..336212) [546 bp...   159   1e-49
Skud_9.163 Chr9 complement(305622..305891,305890..306159) [540 b...   156   2e-48
Smik_9.185 Chr9 complement(310275..310544,310543..310818) [546 b...   155   7e-48
NCAS0E02150 Chr5 complement(411717..411992,411994..412275) [558 ...   154   1e-47
NDAI0E03690 Chr5 complement(796355..796663,796665..796946) [591 ...   148   3e-45
TDEL0H02900 Chr8 complement(482608..482892,482894..483175) [567 ...   139   1e-41
Suva_9.195 Chr9 complement(324112..324381,324353..324373,324377....   133   3e-39
KNAG0L00960 Chr12 complement(176345..176620,176622..176903) [558...   129   6e-38
Sklu_YGOB_EST3 Chr6 (413034..413324,413326..413625) [591 bp, 196...   126   2e-36
CAGL0C03828g Chr3 (377164..377430,377432..377707) [543 bp, 180 a...   121   9e-35
KAFR0L00480 Chr12 complement(87343..87603,87605..87886) [543 bp,...   120   2e-34
Kpol_1062.55 s1062 (125085..125366,125368..125634) [549 bp, 182 ...   119   4e-34
TPHA0C04310 Chr3 (931642..931905,931907..932248) [606 bp, 201 aa...   111   1e-30
ADL016C Chr4 complement(680590..680914,680916..681199) [609 bp, ...   110   4e-30
Kwal_YGOB_EST3 s55 complement(581681..581974,581976..582260) [57...   108   1e-29
Kthe_YGOB_EST3 Chr6 complement(1055444..1055740,1055742..1056026...    89   5e-22
TBLA0A00960 Chr1 complement(212858..213151,213153..213506) [648 ...    84   6e-20
KLLA0D14289g Chr4 (1215729..1216283) [555 bp, 184 aa] {ON} simil...    74   4e-16
Sklu_YGOB_Anc_7.128 Chr6 (413034..413330) [297 bp, 98 aa] {OFF} ...    57   2e-10
Kwal_55.20848 s55 complement(581970..582260) [291 bp, 96 aa] {OF...    53   3e-09
KLTH0F12606g Chr6 complement(1055736..1056026) [291 bp, 96 aa] {...    45   3e-06
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    30   2.5  
Kpol_1001.21 s1001 (56472..58142) [1671 bp, 556 aa] {ON} (56472....    30   4.1  
KLTH0E13420g Chr5 complement(1191554..1192744) [1191 bp, 396 aa]...    29   6.3  

>Zrou_YGOB_EST3 Chr3 complement(410153..410401,410403..410660) [507
           bp, 168 aa] {ON} ANNOTATED BY YGOB - Ribosomal
           frameshifting (Farabaugh, J Mol Evol 63:545, 2006)
          Length = 168

 Score =  347 bits (889), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 168/168 (100%), Positives = 168/168 (100%)

Query: 1   MPQAIVSVKPFDSVFLQPWIQTALAEHDPRLGDRLIPPVPTQDLSQPELSSKVLSNIRHF 60
           MPQAIVSVKPFDSVFLQPWIQTALAEHDPRLGDRLIPPVPTQDLSQPELSSKVLSNIRHF
Sbjct: 1   MPQAIVSVKPFDSVFLQPWIQTALAEHDPRLGDRLIPPVPTQDLSQPELSSKVLSNIRHF 60

Query: 61  VKVTRFFDVDHYTVYASIRDSKAQLLVEFTPQCVSDFERRYYTRITAETTNCVFIIADCQ 120
           VKVTRFFDVDHYTVYASIRDSKAQLLVEFTPQCVSDFERRYYTRITAETTNCVFIIADCQ
Sbjct: 61  VKVTRFFDVDHYTVYASIRDSKAQLLVEFTPQCVSDFERRYYTRITAETTNCVFIIADCQ 120

Query: 121 LIYHSPSYIENHYKIVTRGETPVLRVNQTAIFDWDQVESLETYPLVLN 168
           LIYHSPSYIENHYKIVTRGETPVLRVNQTAIFDWDQVESLETYPLVLN
Sbjct: 121 LIYHSPSYIENHYKIVTRGETPVLRVNQTAIFDWDQVESLETYPLVLN 168

>ZYRO0C05258g Chr3 complement(410397..410660) [264 bp, 87 aa]
          {OFF} some similarities with uniprot|Q03096
          Saccharomyces cerevisiae YIL009C-A
          Length = 87

 Score =  176 bits (447), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 86/86 (100%), Positives = 86/86 (100%)

Query: 1  MPQAIVSVKPFDSVFLQPWIQTALAEHDPRLGDRLIPPVPTQDLSQPELSSKVLSNIRHF 60
          MPQAIVSVKPFDSVFLQPWIQTALAEHDPRLGDRLIPPVPTQDLSQPELSSKVLSNIRHF
Sbjct: 1  MPQAIVSVKPFDSVFLQPWIQTALAEHDPRLGDRLIPPVPTQDLSQPELSSKVLSNIRHF 60

Query: 61 VKVTRFFDVDHYTVYASIRDSKAQLL 86
          VKVTRFFDVDHYTVYASIRDSKAQLL
Sbjct: 61 VKVTRFFDVDHYTVYASIRDSKAQLL 86

>YIL009C-A Chr9 complement(335666..335935,335937..336212) [546 bp,
           181 aa] {ON}  EST3Component of the telomerase
           holoenzyme, involved in telomere replication
          Length = 181

 Score =  159 bits (402), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 86/177 (48%), Positives = 115/177 (64%), Gaps = 11/177 (6%)

Query: 1   MPQAIVSV--KPFDSVFLQPWIQTAL---AEHDP-RLGDRLIPPVPTQDLSQPELSSKVL 54
           MP+ I+    KP DSVFLQPWI+  +   +EHD       +IP +  QDL+ P +S  +L
Sbjct: 1   MPKVILESHSKPTDSVFLQPWIKALIEDNSEHDQYHPSGHVIPSLTKQDLALPHMSPTIL 60

Query: 55  SNIRHFVKVTRFFDVDHYTVYASIRDSKAQLLVEFTPQCVSDFERRYYTRITAETTNCVF 114
           +N  HF K+T+F++V  Y VYASIRDS  Q+LVEF+ +CVS+FER +  RIT+ETTNC+ 
Sbjct: 61  TNPCHFAKITKFYNVCDYKVYASIRDSSHQILVEFSQECVSNFERTHNCRITSETTNCLM 120

Query: 115 IIADCQLIYHSPSYIENHYKIV-----TRGETPVLRVNQTAIFDWDQVESLETYPLV 166
           II D  L+Y + S   +H+KI      ++   PVL VNQ  IFD DQV SL T+P V
Sbjct: 121 IIGDADLVYVTNSRAMSHFKICLSNISSKEIVPVLNVNQATIFDIDQVGSLSTFPFV 177

>Skud_9.163 Chr9 complement(305622..305891,305890..306159) [540 bp,
           180 aa] {ON} YIL009C-A (REAL)
          Length = 180

 Score =  156 bits (394), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 86/176 (48%), Positives = 118/176 (67%), Gaps = 10/176 (5%)

Query: 1   MPQAIVSV--KPFDSVFLQPWIQTALAEHDP--RLGDRLIPPVPTQDLSQPELSSKVLSN 56
           MP+ I+    KP DS+FLQPWI+  + ++    R  +R+IP +  QDL  P +S+++L+N
Sbjct: 1   MPRIILESHSKPADSIFLQPWIKALVKDNSDQHRPSERVIPSLTRQDLLVPHMSAQILTN 60

Query: 57  IRHFVKVTRFFDVDHYTVYASIRDSKAQ-LLVEFTPQCVSDFERRYYTRITAETTNCVFI 115
             HF K+TRF+DV +Y V ASIRDS  Q LLVEF+ +CVSDFER +  RIT+ET NC+ I
Sbjct: 61  PCHFTKITRFYDVSNYKVCASIRDSTHQILLVEFSEECVSDFERSHNCRITSETINCLMI 120

Query: 116 IADCQLIYHSPSYIENHYKI----VTRGET-PVLRVNQTAIFDWDQVESLETYPLV 166
           I D  LIY + + +   +KI    ++  E  PVL++NQT IFD DQV SL T+P V
Sbjct: 121 IGDADLIYVTSNQVMARFKIRVSSISPNEILPVLKINQTTIFDIDQVGSLSTFPFV 176

>Smik_9.185 Chr9 complement(310275..310544,310543..310818) [546 bp,
           182 aa] {ON} YIL009C-A (REAL)
          Length = 182

 Score =  155 bits (391), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 87/179 (48%), Positives = 115/179 (64%), Gaps = 14/179 (7%)

Query: 1   MPQAIVSV--KPFDSVFLQPWIQTALAE-----HDPRLGDRLIPPVPTQDLSQPELSSKV 53
           MP+ ++    KP DS+FLQPWI+ AL E     H     D +IP +  QDL  P +S+K+
Sbjct: 1   MPRVVLESHSKPTDSIFLQPWIK-ALVEDNSEHHQYHPSDHVIPVLTEQDLKLPHMSAKI 59

Query: 54  LSNIRHFVKVTRFFDVDHYTVYASIRDSKAQ-LLVEFTPQCVSDFERRYYTRITAETTNC 112
           L+N  HF K+TRF++V  Y V ASIRDS  Q LLVEF+P+CVS+FER +  RITAET NC
Sbjct: 60  LTNPCHFAKITRFYNVCDYKVCASIRDSTHQILLVEFSPECVSNFERIHNCRITAETVNC 119

Query: 113 VFIIADCQLIYHSPSYIENHYK-----IVTRGETPVLRVNQTAIFDWDQVESLETYPLV 166
           + II D  LI  + S +++H+K     I +    PVL++NQ  IFD DQV SL  +P V
Sbjct: 120 LMIIGDASLINATSSRVKSHFKIRLSSISSNDLVPVLQINQVTIFDIDQVGSLSAFPFV 178

>NCAS0E02150 Chr5 complement(411717..411992,411994..412275) [558 bp,
           185 aa] {ON} Anc_7.128 YIL009C-A
          Length = 185

 Score =  154 bits (390), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 117/181 (64%), Gaps = 15/181 (8%)

Query: 1   MPQAIVSVK--PFDSVFLQPWIQTALAE------HDPRLGDRLIPPVPTQDLSQPELSSK 52
           MP+ I+S K    DS+FLQPWI+  L E      + P    R +P +   DL  P+ S K
Sbjct: 1   MPRVILSSKLSQTDSIFLQPWIEGLLRESLQKKTYLPGNQQREVPSLNEADLRAPQCSPK 60

Query: 53  VLSNIRHFVKVTRFFDVDHYTVYASIRDSKAQLLVEFTPQCVSDFERRYYTRITAETTNC 112
           VL+N  HF KVT+FF +++Y + ASIRDS+ QLLVEFTP+CVS+FERR++ R+T+ET NC
Sbjct: 61  VLTNHCHFTKVTKFFKINNYAISASIRDSRFQLLVEFTPKCVSNFERRHHRRLTSETLNC 120

Query: 113 VFIIADCQLIYHSPSYIENHYK----IVTRGET---PVLRVNQTAIFDWDQVESLETYPL 165
           + +I D  +IY S   I   +     I+++  +   P+L++NQ ++FD DQV+ L ++P 
Sbjct: 121 LLVIGDAAIIYKSRDQITTQFGNIDFIISKNVSPLVPILQINQASLFDGDQVQHLRSFPF 180

Query: 166 V 166
           V
Sbjct: 181 V 181

>NDAI0E03690 Chr5 complement(796355..796663,796665..796946) [591 bp,
           196 aa] {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 196

 Score =  148 bits (374), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 82/193 (42%), Positives = 114/193 (59%), Gaps = 28/193 (14%)

Query: 1   MPQAIVSVKPF--DSVFLQPWIQTALAEH---------DPRLGDRLIPPVPTQDLSQPEL 49
           MP+ I+S K    DSVFLQPWI   + +          + RL    I  +  +D+  PE+
Sbjct: 1   MPRVILSSKQTVSDSVFLQPWIANIIRKEIQAKTYLPGNQRLS---IARLSRRDMDAPEI 57

Query: 50  SSKVLSNIRHFVKVTRFFDVDHYTVYASIRDSKAQLLVEFTPQCVSDFERRYYTRITAET 109
           S  +L+N  HF KVT+FF V++Y ++ASIRDS  Q+LVEFTPQCV +FER Y +RIT+ET
Sbjct: 58  SETILNNYSHFAKVTKFFSVNNYKIFASIRDSTYQILVEFTPQCVLEFERVYRSRITSET 117

Query: 110 TNCVFIIADCQLIYHSPSYI--------------ENHYKIVTRGETPVLRVNQTAIFDWD 155
            NC+F+I DC +IY + S I              E +      G  PVL++NQ ++FD D
Sbjct: 118 VNCLFVIGDCTVIYKTRSQIRSSFPKFDLQSLAGEKNSNKNGFGLFPVLQINQASLFDSD 177

Query: 156 QVESLETYPLVLN 168
           QV+ L  +P + N
Sbjct: 178 QVQLLFEFPFIYN 190

>TDEL0H02900 Chr8 complement(482608..482892,482894..483175) [567 bp,
           188 aa] {ON} Anc_7.128 YIL009C-A
          Length = 188

 Score =  139 bits (350), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 78/183 (42%), Positives = 113/183 (61%), Gaps = 19/183 (10%)

Query: 1   MPQAIVSV--KPFDSVFLQPWIQTALA-----EHDPRLGD-RLIPPVPTQDLSQPELSSK 52
           MP+ I+S   K  D+VFL PWI+ ++      E D RL     IP +  +DL +P+LS +
Sbjct: 1   MPKTILSSSSKQKDTVFLLPWIEKSIGPLIADESDIRLPVFNFIPKLQLKDLRKPQLSPR 60

Query: 53  VLSNIRHFVKVTRFFDVDHYTVYASIRDSKAQLLVEFTPQCVSDFERRYYTRITAETTNC 112
           +L N  HFVKV +F  V+ + V+A++RDS  Q+LVEFTPQCVS+FER + +RIT ET + 
Sbjct: 61  ILRNPSHFVKVVKFHSVNRFQVFATVRDSAHQILVEFTPQCVSEFERTHRSRITLETEHS 120

Query: 113 VFIIADCQLIYHSPSYIENHYKIVTRG-----------ETPVLRVNQTAIFDWDQVESLE 161
           +FII+DC+L +   +YI  ++ I  +              PVL VNQ + F+ DQ+ES E
Sbjct: 121 LFIISDCKLYHRDRNYILKNFGIDMKNWQSAANHKRCSTIPVLIVNQASQFEMDQIESFE 180

Query: 162 TYP 164
            +P
Sbjct: 181 HFP 183

>Suva_9.195 Chr9
           complement(324112..324381,324353..324373,324377..324652)
           [567 bp, 189 aa] {ON} YIL009C-A (REAL)
          Length = 189

 Score =  133 bits (334), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 75/172 (43%), Positives = 104/172 (60%), Gaps = 17/172 (9%)

Query: 12  DSVFLQPWIQTAL---AEHDPRLGDRLIPPVPTQDLSQPELSSKVLSNIRHFVKVTRFFD 68
           DS+FLQPWI+  +   +EH     D +IP +  QDL+ P +  ++L+N  HF ++TRF++
Sbjct: 14  DSIFLQPWIKLLIDDNSEHHHIPSDHVIPALAQQDLALPHMCPQILTNPFHFARITRFYN 73

Query: 69  VDHYTVYASIRDSKAQ---------LLVEFTPQCVSDFERRYYTRITAETTNCVFIIADC 119
           V  Y VYAS+RDS  Q         +LVEF+ +CVSDFER    RIT+ETTNC+ II D 
Sbjct: 74  VCDYRVYASVRDSTHQILSVFREMCILVEFSEKCVSDFERINNFRITSETTNCLMIIGDA 133

Query: 120 QLIYHSPSYIENHYKI----VTRGET-PVLRVNQTAIFDWDQVESLETYPLV 166
            L Y + +     + I    ++  ET P+L +NQ  IFD DQV SL  +P V
Sbjct: 134 DLAYVTSTQALARFMIRLSSISTSETVPILIINQATIFDIDQVGSLNNFPFV 185

>KNAG0L00960 Chr12 complement(176345..176620,176622..176903) [558
           bp, 185 aa] {ON} Anc_7.128 YIL009C-A ribosomal
           frameshifting
          Length = 185

 Score =  129 bits (325), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 96/165 (58%), Gaps = 12/165 (7%)

Query: 14  VFLQPWIQTALAEHDPRLG-----DRLIPPVPTQDLSQPELSSKVLSNIRHFVKVTRFFD 68
           +F  PWI+  +      +       ++IP + T DL  P  S +VL N  HF KV +F+ 
Sbjct: 17  IFTHPWIKNLVKLPTEEISLMRPVRQIIPKLTTNDLKNPTRSKRVLKNKTHFAKVMKFYS 76

Query: 69  VDHYTVYASIRDSKAQLLVEFTPQCVSDFERRYYTRITAETTNCVFIIADCQLIYHSPSY 128
           V +Y V+A IRDS+ QLLVEF P+CVS FER ++ RIT+ T NC+F+I +C L Y S + 
Sbjct: 77  VHNYKVFACIRDSECQLLVEFHPECVSYFERFHHCRITSGTVNCLFVIGNCDLEYRSVAR 136

Query: 129 IENHYKI-------VTRGETPVLRVNQTAIFDWDQVESLETYPLV 166
           + + ++I           + PVL +NQ  + DW Q+E+  T+P V
Sbjct: 137 VNDEFRINILPRKQKLMDQIPVLVINQATVADWGQMEAQTTFPFV 181

>Sklu_YGOB_EST3 Chr6 (413034..413324,413326..413625) [591 bp, 196
           aa] {ON} ANNOTATED BY YGOB - Ribosomal frameshifting
           (Farabaugh, J Mol Evol 63:545, 2006)
          Length = 196

 Score =  126 bits (316), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 110/182 (60%), Gaps = 17/182 (9%)

Query: 1   MPQAIVSV--KPFDSVFLQPWIQTALAEHDPR------LGD--RLIPPVPTQDL-SQPEL 49
           MP+  +S   K  DS++L  WI  ++  H         +GD    +P +  +D+ S   L
Sbjct: 1   MPKVALSSRNKESDSIYLHNWIVHSILPHVREKWAIGIIGDVRSFVPSLDDKDITSDVHL 60

Query: 50  SSKVLSNIRHFVKVTRFFDVDHYTVYASIRDSKAQLLVEFTPQCVSDFERRYYTRITAET 109
           S K++ N RHF+K+T+F+ V++Y VYAS RDS   +LVEFT  CVS+FER +++RIT+ET
Sbjct: 61  SRKIILNHRHFIKLTKFYQVNNYQVYASARDSLCSILVEFTACCVSNFERLHHSRITSET 120

Query: 110 TNCVFIIADCQLIYHSPSYIENHYKI-VTR-----GETPVLRVNQTAIFDWDQVESLETY 163
           TN +F+I D +L++   + +   + I +T+        P+LRVNQ  ++D DQVES   +
Sbjct: 121 TNTLFVIGDVKLVFMDKASVSQKFGIDITQFNPQLNLVPILRVNQAFVYDMDQVESNRKF 180

Query: 164 PL 165
           P 
Sbjct: 181 PF 182

>CAGL0C03828g Chr3 (377164..377430,377432..377707) [543 bp, 180 aa]
           {ON} similar to uniprot|Q03096 Saccharomyces cerevisiae
           YIL009ca
          Length = 180

 Score =  121 bits (304), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 65/163 (39%), Positives = 100/163 (61%), Gaps = 8/163 (4%)

Query: 12  DSVFLQPWIQTALAEHDPRLGDRLIPPVPTQDLSQPELSSKVLSNIRHFVKVTRFFDVDH 71
           +SV+L  W++  L E        +IP V   + S P LS ++ +N RHFVK+T+FF V +
Sbjct: 14  ESVYLHGWVRDMLLESKTSQNIAVIPRVDPDEASIPLLSRRIYANRRHFVKITKFFQVHN 73

Query: 72  YTVYASIRDSKAQLLVEFTPQCVSDFERRYYTRITAETTNCVFIIADCQLIYHSPSYIEN 131
           Y+VYAS++DS+ Q+L +FTP+CVS+FE R  +RIT++T N +F+I D +L       + +
Sbjct: 74  YSVYASVKDSQHQILSQFTPKCVSEFESRNRSRITSDTVNTLFMIGDAKLGIMVVDELRH 133

Query: 132 HY--KIVTRGET------PVLRVNQTAIFDWDQVESLETYPLV 166
           ++  KIV+          P L +NQ  I D+DQVE+ +  P V
Sbjct: 134 YFGEKIVSLFNGLDMPYIPYLIINQAFILDYDQVEAFKMTPFV 176

>KAFR0L00480 Chr12 complement(87343..87603,87605..87886) [543 bp,
           180 aa] {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 180

 Score =  120 bits (301), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 95/163 (58%), Gaps = 8/163 (4%)

Query: 12  DSVFLQPWIQTALAEHDPRLGD---RLIPPVPTQDLSQPELSSKVLSNIR---HFVKVTR 65
           DS+F+  WI+  L E+   L     R IPP+   ++  P  S   L   +   HF K+ +
Sbjct: 14  DSIFIHDWIKPLLDENCQGLLRPIYRAIPPINNTNVRNPLSSRPSLLTTKVKCHFTKIVK 73

Query: 66  FFDVDHYTVYASIRDSKAQLLVEFTPQCVSDFERRYYTRITAETTNCVFIIADCQLIYHS 125
           F+ V+++ ++ASIRD++ Q+LVEFTP CVS FER    R+T++TTNC  +I DC + Y S
Sbjct: 74  FYKVENFKIFASIRDTRFQILVEFTPHCVSTFERTNRCRLTSDTTNCTLLIGDCSIEYKS 133

Query: 126 PSYIENHYKIV--TRGETPVLRVNQTAIFDWDQVESLETYPLV 166
              I  +Y++    +   PVL +NQ +I D DQ   LE +P V
Sbjct: 134 SHEISQNYRLNFPNKRLLPVLTINQASILDRDQATLLEQFPFV 176

>Kpol_1062.55 s1062 (125085..125366,125368..125634) [549 bp, 182 aa]
           {ON} (125085..125366,125368..125634) [549 nt, 183 aa]
          Length = 182

 Score =  119 bits (299), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 70/168 (41%), Positives = 96/168 (57%), Gaps = 12/168 (7%)

Query: 12  DSVFLQPWIQTALAEHDPRLGDRLIPPVPTQDL--SQPELSSKVLSNIR---HFVKVTRF 66
           DS +LQ WI   +  +    G+ +IP +       SQ  +SS +   I+   HF KVT F
Sbjct: 15  DSTYLQEWIDLIIDRNYDNTGE-VIPILDEYGFNDSQSYMSSVINLIIKKPYHFAKVTNF 73

Query: 67  FDVDHYTVYASIRDSKAQLLVEFTPQCVSDFERRYYTRITAETTNCVFIIADCQLIYHSP 126
           F+V  Y+VYASIRD K Q+L EFT  CVS FER Y +RIT  T NC+F+I DC+L + + 
Sbjct: 74  FNVVDYSVYASIRDRKFQVLSEFTSNCVSSFERLYNSRITENTINCLFLIGDCKLKFMTY 133

Query: 127 SYIENHYK-----IVTRGET-PVLRVNQTAIFDWDQVESLETYPLVLN 168
             I+  YK     I  +    PVL +NQ  +FDW Q++S E +  + N
Sbjct: 134 WEIKELYKLDLSSICNKNSLYPVLSINQARMFDWSQIKSFEKFDWIYN 181

>TPHA0C04310 Chr3 (931642..931905,931907..932248) [606 bp, 201 aa]
           {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 201

 Score =  111 bits (277), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 101/197 (51%), Gaps = 33/197 (16%)

Query: 1   MPQAI----VSVKPFDSVFLQPWIQTALAEHDPRLGDRLIPPVPTQDLSQPELSSKVLSN 56
           MP+ I    V++ P DS+FL+PWI+  + +       ++       + +  +L   +L  
Sbjct: 1   MPKIILPSKVNLSP-DSIFLKPWIKEFIEDGKKNSIGKIGNLDELLNNTNVKLQL-ILKY 58

Query: 57  IRHFVKVTRFFDVDHYTVYASIRDSKAQLLVEFTPQCVSDFERRYYTRITAETTNCVFII 116
               VK+T  +++ +Y V+ SIRD+K QLLVEFT  CVS+FER Y  RIT +T NC+F+I
Sbjct: 59  PNQLVKLTNIYNILNYCVFGSIRDNKHQLLVEFTSNCVSNFERNYKIRITDQTKNCLFLI 118

Query: 117 ADCQLIYHS-----------PSYIENHYKIVTRGE----------------TPVLRVNQT 149
            DC + Y +           P   +NH  I    +                 P+L+VNQ 
Sbjct: 119 GDCIIKYVTHDELLKNFKIDPLQFDNHIGITEYFDFKKYGYILSERRFNRLYPILQVNQV 178

Query: 150 AIFDWDQVESLETYPLV 166
            IFDWDQV + E YP V
Sbjct: 179 MIFDWDQVVTFENYPFV 195

>ADL016C Chr4 complement(680590..680914,680916..681199) [609 bp, 202
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YIL009C-A (EST3)
          Length = 202

 Score =  110 bits (274), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 103/182 (56%), Gaps = 19/182 (10%)

Query: 1   MPQAIVSVKPF--DSVFLQPWIQTALAEHDPRLG--------DRLIPPVP--TQDLSQPE 48
           MP+ +++ +    DS+FL+ W+  A+     R G        +  IP +P  T  LS   
Sbjct: 1   MPKVVLASRAHKADSIFLREWLVDAVVPALERSGACAPWAGVECFIPALPPATATLS--- 57

Query: 49  LSSKVLSNIRHFVKVTRFFDVDHYTVYASIRDSKAQLLVEFTPQCVSDFERRYYTRITAE 108
           L   V+ N + F+++ RF  V  + V A  RD+   +LVEFTP CVS+FERRY+ RIT+ 
Sbjct: 58  LEPTVIQNPKRFLRIVRFTRVHDFAVCAVARDAGCCILVEFTPHCVSNFERRYHQRITSS 117

Query: 109 TTNCVFIIADCQLIYHSPSYIENHYKI--VTRGET--PVLRVNQTAIFDWDQVESLETYP 164
           T N +F+I +  L++++ S     +++  +  G +  PVLRV   AIFD DQVES   +P
Sbjct: 118 TVNSLFVIGNTSLLFYARSDAAAAFEVPALMNGSSTLPVLRVGDCAIFDQDQVESHRRFP 177

Query: 165 LV 166
           LV
Sbjct: 178 LV 179

>Kwal_YGOB_EST3 s55 complement(581681..581974,581976..582260) [579
           bp, 192 aa] {ON} ANNOTATED BY YGOB - Ribosomal
           frameshifting (Farabaugh, J Mol Evol 63:545, 2006)
          Length = 192

 Score =  108 bits (271), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 94/175 (53%), Gaps = 14/175 (8%)

Query: 2   PQAIVSVKPFDSVFLQPWIQTALAEHDPR--------LGDRLIPPVPTQDLSQPELSSKV 53
           P AI   K  +S FL+ WIQ  + E              +R +P +   D    +LSS++
Sbjct: 4   PSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSD-GPMQLSSQL 62

Query: 54  LSNIRHFVKVTRFFDVDHYTVYASIRDSKAQLLVEFTPQCVSDFERRYYTRITAETTNCV 113
           L N RHF+K+T F  + ++ VYAS RD   Q+LVEFTP+CVS FERR+  RITA T N +
Sbjct: 63  LQNRRHFLKITGFHKIHNFAVYASGRDDSCQILVEFTPKCVSQFERRHGLRITARTVNTI 122

Query: 114 FIIADCQLIYHSPSYIENHYKIVTRGET-----PVLRVNQTAIFDWDQVESLETY 163
           F+I    + Y     +   +   +  +T     PVL VN+  +FD DQVES   +
Sbjct: 123 FLIGAVTIKYIPIYEVRETWCWASDLDTRIPVLPVLVVNECTVFDLDQVESRRKF 177

>Kthe_YGOB_EST3 Chr6 complement(1055444..1055740,1055742..1056026)
           [582 bp, 193 aa] {ON} ANNOTATED BY YGOB - Ribosomal
           frameshifting (Farabaugh, J Mol Evol 63:545, 2006).
           Replaces KLTH0F12606g.
          Length = 193

 Score = 89.0 bits (219), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 88/165 (53%), Gaps = 14/165 (8%)

Query: 12  DSVFLQPWIQT----ALAEHDPR----LGDRLIPPVPTQDLSQPELSSKVLSNIRHFVKV 63
           +SVFL+ WI +     + EH P          +PP+       P   S++L N RHF+K+
Sbjct: 14  ESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVP-FKSEILLNRRHFLKI 72

Query: 64  TRFFDVDHYTVYASIRDSKAQLLVEFTPQCVSDFERRYYTRITAETTNCVFIIADCQLIY 123
           T F  V+ + V+AS RD+  ++LVEFTPQCVS FER    RITA+T N + +I    L Y
Sbjct: 73  TNFHRVEKFAVFASGRDNNCRILVEFTPQCVSAFERLNSIRITAKTVNTILLIGSGTLKY 132

Query: 124 H--SPSYIENHYKI---VTRGETPVLRVNQTAIFDWDQVESLETY 163
                +Y +    I         PVL V Q A+FD DQVE+  ++
Sbjct: 133 LPVHEAYTQWSLSIPLDPRVPVVPVLVVEQCAVFDLDQVEARPSF 177

>TBLA0A00960 Chr1 complement(212858..213151,213153..213506) [648 bp,
           215 aa] {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 215

 Score = 84.0 bits (206), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 71/121 (58%), Gaps = 13/121 (10%)

Query: 59  HFVKVTRFFDVDHYTVYASIRDSKAQLLVEFTPQCVSDFERRYYTRITAETTNCVFIIAD 118
           H +K+T+FF V++Y + AS++D++ Q+LVE TP CV+++ER+   R+T+ T +C+F+I D
Sbjct: 91  HIIKITKFFKVNNYKICASVQDAECQILVELTPICVTEYERKTRDRMTSNTLDCLFVIGD 150

Query: 119 CQLIYHSPSYIENHYKIVT-------------RGETPVLRVNQTAIFDWDQVESLETYPL 165
           C+L + + + + +++   T                 PVL +NQ    D    +SL T P 
Sbjct: 151 CRLYFQNKNEVLHNFNCNTFRNIIPGLNALDRDSLIPVLVINQIICVDRHPSKSLSTLPF 210

Query: 166 V 166
           +
Sbjct: 211 L 211

>KLLA0D14289g Chr4 (1215729..1216283) [555 bp, 184 aa] {ON} similar
           to uniprot|Q03096 Saccharomyces cerevisiae YIL009C-A
           EST3 Component of the telomerase holoenzyme involved in
           telomere replication
          Length = 184

 Score = 73.6 bits (179), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 83/171 (48%), Gaps = 12/171 (7%)

Query: 1   MPQAIVSVK--PFDSVFLQPWIQTA-----LAEHDPRLG---DRLIPPVPTQDLSQPELS 50
           MP  ++S +    DSVFLQ WI+ +     L     +       L+  +   D+ +    
Sbjct: 1   MPNVVLSSRLTNNDSVFLQEWIKPSVRPYYLKNEKTKFWPEQRELVTDLLEHDIIESAFQ 60

Query: 51  SKVLSNIRHFVKVTRFFDVDHYTVYASIRDSKAQLLVEFTPQCVSDFERRYYTRITAETT 110
           + +    + FV++ +F  V+ YTVYA+IRDS A +L  FT  CV D+E     RIT  T 
Sbjct: 61  TALNPAPQRFVRIVKFHRVNDYTVYATIRDSTALILCYFTVDCVLDYETINNDRITLNTL 120

Query: 111 NCVFIIADCQLIY--HSPSYIENHYKIVTRGETPVLRVNQTAIFDWDQVES 159
           N +F+I +  L +  H    +  +         PVL++ +  +FD DQ+ S
Sbjct: 121 NTLFVIGNVTLQFWNHRECKLWFNQDFPGLRMVPVLKIEKARMFDRDQISS 171

>Sklu_YGOB_Anc_7.128 Chr6 (413034..413330) [297 bp, 98 aa] {OFF}
          ANNOTATED BY YGOB -
          Length = 98

 Score = 56.6 bits (135), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 55/97 (56%), Gaps = 11/97 (11%)

Query: 1  MPQAIVSV--KPFDSVFLQPWIQTALAEHDPR------LGD--RLIPPVPTQDL-SQPEL 49
          MP+  +S   K  DS++L  WI  ++  H         +GD    +P +  +D+ S   L
Sbjct: 1  MPKVALSSRNKESDSIYLHNWIVHSILPHVREKWAIGIIGDVRSFVPSLDDKDITSDVHL 60

Query: 50 SSKVLSNIRHFVKVTRFFDVDHYTVYASIRDSKAQLL 86
          S K++ N RHF+K+T+F+ V++Y VYAS RDS   +L
Sbjct: 61 SRKIILNHRHFIKLTKFYQVNNYQVYASARDSLCSIL 97

>Kwal_55.20848 s55 complement(581970..582260) [291 bp, 96 aa]
          {OFF} [contig 138] FULL
          Length = 96

 Score = 53.1 bits (126), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 51/94 (54%), Gaps = 11/94 (11%)

Query: 2  PQAIVSVKPFDSVFLQPWIQTALAE----HD-----PRLGDRLIPPVPTQDLSQPELSSK 52
          P AI   K  +S FL+ WIQ  + E    H      P + +R +P +   D    +LSS+
Sbjct: 4  PSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAV-ERFVPSIVRSD-GPMQLSSQ 61

Query: 53 VLSNIRHFVKVTRFFDVDHYTVYASIRDSKAQLL 86
          +L N RHF+K+T F  + ++ VYAS RD   Q+L
Sbjct: 62 LLQNRRHFLKITGFHKIHNFAVYASGRDDSCQIL 95

>KLTH0F12606g Chr6 complement(1055736..1056026) [291 bp, 96 aa]
          {OFF} no similarity
          Length = 96

 Score = 45.4 bits (106), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 9/83 (10%)

Query: 12 DSVFLQPWIQT----ALAEHDPR----LGDRLIPPVPTQDLSQPELSSKVLSNIRHFVKV 63
          +SVFL+ WI +     + EH P          +PP+       P   S++L N RHF+K+
Sbjct: 14 ESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVP-FKSEILLNRRHFLKI 72

Query: 64 TRFFDVDHYTVYASIRDSKAQLL 86
          T F  V+ + V+AS RD+  ++L
Sbjct: 73 TNFHRVEKFAVFASGRDNNCRIL 95

>KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some
           similarities with uniprot|P32490 Saccharomyces
           cerevisiae YOR231W MKK1 Mitogen-activated kinase kinase
           involved in protein kinase C signaling pathway that
           controls cell integrity upon activation by Bck1p
           phosphorylates downstream target Slt2p functionally
           redundant with Mkk2p
          Length = 465

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 5/54 (9%)

Query: 87  VEFTPQCVSDFERRYYTRITAETTNCVFIIADCQLIYHSPSYIENHYK-IVTRG 139
           ++F   C SDF  RYY     E T+ +FI  +    Y     +++ YK ++++G
Sbjct: 226 LQFNKSCKSDFIVRYYGMFACEETSTIFIAME----YMGGRSLDSVYKHLLSKG 275

>Kpol_1001.21 s1001 (56472..58142) [1671 bp, 556 aa] {ON}
           (56472..58142) [1671 nt, 557 aa]
          Length = 556

 Score = 29.6 bits (65), Expect = 4.1,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 6/60 (10%)

Query: 36  IPPVPTQDLSQPELSSKVLSNIRHFVKVTRFFDVDHYTVYASIRDSKAQLLVEFTPQCVS 95
           +PP+  + LS  EL  KV     H  ++ R    DH+     + D++A  +++   QC+S
Sbjct: 61  VPPITNKKLSDDELFDKVTGLPNH--ELLR----DHFKKEGRLTDAQAMRIIDMAVQCLS 114

>KLTH0E13420g Chr5 complement(1191554..1192744) [1191 bp, 396 aa]
           {ON} similar to uniprot|Q02887 Saccharomyces cerevisiae
           YPL100W ATG21 Phosphatidylinositol 3 5- bisphosphate-
           binding protein required for maturation of pro-
           aminopeptidase I predicted to fold as a seven-bladed
           beta- propeller displays punctate cytoplasmic
           localization
          Length = 396

 Score = 28.9 bits (63), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 35/72 (48%), Gaps = 8/72 (11%)

Query: 19  WIQTALAEHDPR-----LGDRLIPPVPTQDLSQPELSSKVLSNIRHFVKVTRFFDVDHYT 73
           W+++ L++  P      L  R+I  +P+Q +++   S KV  ++RH +    F D     
Sbjct: 308 WLESRLSKDSPHQIASFLSRRVISRIPSQSMARDYASMKVSEDVRHCIG---FPDEFPNQ 364

Query: 74  VYASIRDSKAQL 85
           +Y S  D   Q+
Sbjct: 365 IYVSGNDGVLQI 376

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.137    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 16,910,221
Number of extensions: 647291
Number of successful extensions: 1846
Number of sequences better than 10.0: 32
Number of HSP's gapped: 1814
Number of HSP's successfully gapped: 32
Length of query: 168
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 67
Effective length of database: 41,900,133
Effective search space: 2807308911
Effective search space used: 2807308911
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 61 (28.1 bits)