Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0G20702g1.318ON1401407331e-101
TDEL0D018701.318ON1001003372e-41
SAKL0D06952g1.318ON1071073071e-36
Kwal_14.25861.318ON1061053052e-36
KLTH0H10714g1.318ON1061063043e-36
Kpol_1035.251.318ON1061053011e-35
KLLA0F01683g1.318ON98812871e-33
TPHA0O014701.318ON1001002871e-33
Ecym_62891.318ON1031032834e-33
AEL167C1.318ON1011012704e-31
CAGL0I09372g1.318ON103992592e-29
NCAS0B074401.318ON1101092498e-28
Smik_2.4111.318ON1051042471e-27
YBR268W (MRPL37)1.318ON1051042453e-27
Suva_4.5291.318ON1051042429e-27
NDAI0B047701.318ON1131132421e-26
TBLA0F013201.318ON1111052384e-26
KNAG0C017701.318ON1011012332e-25
Skud_2.4001.318ON1051042305e-25
KAFR0C042101.318ON1011022072e-21
YML115C (VAN1)8.842ON53570681.0
NDAI0K023206.360ON27657652.2
Ecym_2326na 1ON30477643.7
SAKL0B03872g4.165ON106027644.0
Kwal_26.7727singletonOFF8754587.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0G20702g
         (140 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0G20702g Chr7 complement(1705327..1705749) [423 bp, 140 aa] ...   286   e-101
TDEL0D01870 Chr4 (366206..366508) [303 bp, 100 aa] {ON} Anc_1.31...   134   2e-41
SAKL0D06952g Chr4 complement(576023..576346) [324 bp, 107 aa] {O...   122   1e-36
Kwal_14.2586 s14 complement(823777..824097) [321 bp, 106 aa] {ON...   122   2e-36
KLTH0H10714g Chr8 complement(924077..924397) [321 bp, 106 aa] {O...   121   3e-36
Kpol_1035.25 s1035 complement(60631..60951) [321 bp, 106 aa] {ON...   120   1e-35
KLLA0F01683g Chr6 complement(158967..159263) [297 bp, 98 aa] {ON...   115   1e-33
TPHA0O01470 Chr15 complement(295860..296162) [303 bp, 100 aa] {O...   115   1e-33
Ecym_6289 Chr6 (542978..543289) [312 bp, 103 aa] {ON} similar to...   113   4e-33
AEL167C Chr5 complement(322363..322668) [306 bp, 101 aa] {ON} Sy...   108   4e-31
CAGL0I09372g Chr9 (901576..901887) [312 bp, 103 aa] {ON} similar...   104   2e-29
NCAS0B07440 Chr2 complement(1405363..1405695) [333 bp, 110 aa] {...   100   8e-28
Smik_2.411 Chr2 (727356..727673) [318 bp, 105 aa] {ON} YBR268W (...   100   1e-27
YBR268W Chr2 (741299..741616) [318 bp, 105 aa] {ON}  MRPL37Mitoc...    99   3e-27
Suva_4.529 Chr4 (912965..913282) [318 bp, 105 aa] {ON} YBR268W (...    98   9e-27
NDAI0B04770 Chr2 complement(1176179..1176520) [342 bp, 113 aa] {...    98   1e-26
TBLA0F01320 Chr6 complement(332337..332672) [336 bp, 111 aa] {ON...    96   4e-26
KNAG0C01770 Chr3 (349006..349311) [306 bp, 101 aa] {ON} Anc_1.31...    94   2e-25
Skud_2.400 Chr2 (710286..710603) [318 bp, 105 aa] {ON} YBR268W (...    93   5e-25
KAFR0C04210 Chr3 (839148..839453) [306 bp, 101 aa] {ON} Anc_1.31...    84   2e-21
YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}  V...    31   1.0  
NDAI0K02320 Chr11 (520425..521255) [831 bp, 276 aa] {ON} Anc_6.3...    30   2.2  
Ecym_2326 Chr2 complement(636937..637851) [915 bp, 304 aa] {ON} ...    29   3.7  
SAKL0B03872g Chr2 complement(342546..345728) [3183 bp, 1060 aa] ...    29   4.0  
Kwal_26.7727 s26 (487735..487998) [264 bp, 87 aa] {OFF} [contig ...    27   7.9  

>ZYRO0G20702g Chr7 complement(1705327..1705749) [423 bp, 140 aa]
           {ON} similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 140

 Score =  286 bits (733), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 140/140 (100%), Positives = 140/140 (100%)

Query: 1   MLLSTSKSFGILYYNKSELREEVYFRVSFLYSGPSSSITSLSMFQLLRLFPRRFVSTSPV 60
           MLLSTSKSFGILYYNKSELREEVYFRVSFLYSGPSSSITSLSMFQLLRLFPRRFVSTSPV
Sbjct: 1   MLLSTSKSFGILYYNKSELREEVYFRVSFLYSGPSSSITSLSMFQLLRLFPRRFVSTSPV 60

Query: 61  LGQAVKSSCPAGTIINVNTKKSGKDPVALEDNEYPDWLWEVLDPEAQMKKLQADPMKLRK 120
           LGQAVKSSCPAGTIINVNTKKSGKDPVALEDNEYPDWLWEVLDPEAQMKKLQADPMKLRK
Sbjct: 61  LGQAVKSSCPAGTIINVNTKKSGKDPVALEDNEYPDWLWEVLDPEAQMKKLQADPMKLRK 120

Query: 121 KQLRKDNREKIKQNNFLKQI 140
           KQLRKDNREKIKQNNFLKQI
Sbjct: 121 KQLRKDNREKIKQNNFLKQI 140

>TDEL0D01870 Chr4 (366206..366508) [303 bp, 100 aa] {ON} Anc_1.318
           YBR268W
          Length = 100

 Score =  134 bits (337), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 77/100 (77%), Gaps = 5/100 (5%)

Query: 46  LLRLFPRRFVSTSPVLGQA-----VKSSCPAGTIINVNTKKSGKDPVALEDNEYPDWLWE 100
           + R  P+R  S   V  Q      VKSSCPAGT+++VN KKSGKDPVALED+EYP WLWE
Sbjct: 1   MFRFVPKRLFSNCRVFLQETPSTIVKSSCPAGTVLSVNVKKSGKDPVALEDSEYPAWLWE 60

Query: 101 VLDPEAQMKKLQADPMKLRKKQLRKDNREKIKQNNFLKQI 140
           VLDPEA+ +KL  DPMKLRKKQ+RK NR +IKQNNFL+Q+
Sbjct: 61  VLDPEARARKLAEDPMKLRKKQIRKANRMQIKQNNFLQQL 100

>SAKL0D06952g Chr4 complement(576023..576346) [324 bp, 107 aa] {ON}
           similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 107

 Score =  122 bits (307), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 63/107 (58%), Positives = 74/107 (69%), Gaps = 9/107 (8%)

Query: 43  MFQLLRLFPRRFVSTSPVLGQA---------VKSSCPAGTIINVNTKKSGKDPVALEDNE 93
           M     L  RRF+ST+ +  Q          VKSSCPAGT +N+  KKSGK+ VALED+E
Sbjct: 1   MLSSFHLASRRFLSTTRITLQQQAATATVSKVKSSCPAGTPLNLQIKKSGKETVALEDHE 60

Query: 94  YPDWLWEVLDPEAQMKKLQADPMKLRKKQLRKDNREKIKQNNFLKQI 140
           YP+WLW VLD +AQ  KL  DP KL+KKQLRK NREKIKQNNFL +I
Sbjct: 61  YPEWLWTVLDEKAQSAKLAQDPAKLKKKQLRKMNREKIKQNNFLTKI 107

>Kwal_14.2586 s14 complement(823777..824097) [321 bp, 106 aa] {ON}
           YBR268W (MRPL37) - Probable mitochondrial protein L37
           [contig 224] FULL
          Length = 106

 Score =  122 bits (305), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 78/105 (74%), Gaps = 7/105 (6%)

Query: 43  MFQLLRLFPRRFVSTSPVLGQA-------VKSSCPAGTIINVNTKKSGKDPVALEDNEYP 95
           + Q+ RL  ++  ST   L Q+       +KSSC AGT +N+  KKSGK+PVALED+EYP
Sbjct: 2   LTQIHRLVVKKPFSTFSALLQSQKGSVSGIKSSCIAGTPLNLQIKKSGKEPVALEDHEYP 61

Query: 96  DWLWEVLDPEAQMKKLQADPMKLRKKQLRKDNREKIKQNNFLKQI 140
           +WLW VLD +AQ+KKLQ DP+KLRKKQLR  NR+KIKQNNFL +I
Sbjct: 62  EWLWSVLDDKAQLKKLQEDPLKLRKKQLRSANRQKIKQNNFLSEI 106

>KLTH0H10714g Chr8 complement(924077..924397) [321 bp, 106 aa] {ON}
           similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 106

 Score =  121 bits (304), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 75/106 (70%), Gaps = 8/106 (7%)

Query: 43  MFQLLR-LFPRRFVSTSPVLGQAVK-------SSCPAGTIINVNTKKSGKDPVALEDNEY 94
           MF  LR L  +R +S S    Q  K       SSCPAGT +N+  KKSGK+PVALED+EY
Sbjct: 1   MFANLRNLTSKRALSVSRATFQGQKASPSGVVSSCPAGTPLNLQIKKSGKEPVALEDHEY 60

Query: 95  PDWLWEVLDPEAQMKKLQADPMKLRKKQLRKDNREKIKQNNFLKQI 140
           P+WLW VLD  AQ+KKLQ DP+KLRKKQLR  NR KIKQNNFL +I
Sbjct: 61  PEWLWTVLDSRAQLKKLQEDPLKLRKKQLRSANRNKIKQNNFLSEI 106

>Kpol_1035.25 s1035 complement(60631..60951) [321 bp, 106 aa] {ON}
           complement(60631..60951) [321 nt, 107 aa]
          Length = 106

 Score =  120 bits (301), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 78/105 (74%), Gaps = 10/105 (9%)

Query: 46  LLRLFPRRFVSTSPVL--------GQAVK--SSCPAGTIINVNTKKSGKDPVALEDNEYP 95
           L ++F +R +S+S +L        GQ++K  SSCPAG+++ +N KK+GKDPVALED EYP
Sbjct: 2   LKQIFQKRLLSSSRLLWQETVKTSGQSLKIQSSCPAGSVLTLNIKKAGKDPVALEDAEYP 61

Query: 96  DWLWEVLDPEAQMKKLQADPMKLRKKQLRKDNREKIKQNNFLKQI 140
            WLW VLD EAQ + L  DP+ LRKK+LR+ NR+ IKQNNFLKQI
Sbjct: 62  TWLWTVLDKEAQAEALSKDPLALRKKKLRQANRKNIKQNNFLKQI 106

>KLLA0F01683g Chr6 complement(158967..159263) [297 bp, 98 aa] {ON}
           similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 98

 Score =  115 bits (287), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 64/81 (79%), Gaps = 2/81 (2%)

Query: 62  GQAVK--SSCPAGTIINVNTKKSGKDPVALEDNEYPDWLWEVLDPEAQMKKLQADPMKLR 119
           GQA K  SSCPAGT +N+  KKSGK+PVALED+EYP+WLW VLD   Q +KL ADP+KLR
Sbjct: 18  GQAAKIVSSCPAGTPLNLQIKKSGKEPVALEDSEYPEWLWTVLDANVQAEKLAADPIKLR 77

Query: 120 KKQLRKDNREKIKQNNFLKQI 140
           KKQLR  NR  IKQNNFL +I
Sbjct: 78  KKQLRIANRANIKQNNFLAKI 98

>TPHA0O01470 Chr15 complement(295860..296162) [303 bp, 100 aa] {ON}
           Anc_1.318 YBR268W
          Length = 100

 Score =  115 bits (287), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 72/100 (72%), Gaps = 5/100 (5%)

Query: 46  LLRLFPRRFVSTSPVLGQ-----AVKSSCPAGTIINVNTKKSGKDPVALEDNEYPDWLWE 100
           ++ +F +RF S   +L Q      +KSSC AGT + +N  K+GKDP+ALED+EYP WLW 
Sbjct: 1   MISVFAKRFFSRGSILLQESQANVLKSSCKAGTPLQINVLKTGKDPIALEDSEYPPWLWT 60

Query: 101 VLDPEAQMKKLQADPMKLRKKQLRKDNREKIKQNNFLKQI 140
           VLD  AQ  +L+ DP+KLR+K+LR+ NR  IKQNNFLKQI
Sbjct: 61  VLDKGAQAARLENDPLKLRRKELRRKNRANIKQNNFLKQI 100

>Ecym_6289 Chr6 (542978..543289) [312 bp, 103 aa] {ON} similar to
           Ashbya gossypii AEL167C
          Length = 103

 Score =  113 bits (283), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 72/103 (69%), Gaps = 5/103 (4%)

Query: 43  MFQLLRLFPRRFVSTSPVLGQ-----AVKSSCPAGTIINVNTKKSGKDPVALEDNEYPDW 97
           MF    +  +R +ST+  L +     A+ SSCPAGT +N+  KK+GK+PVAL ++EYP+W
Sbjct: 1   MFSSPLIINKRLISTTLRLAEQKGSKAIISSCPAGTPLNLQIKKTGKEPVALHESEYPEW 60

Query: 98  LWEVLDPEAQMKKLQADPMKLRKKQLRKDNREKIKQNNFLKQI 140
           LW VLDP+ +  KL  DP   RKKQLRK NREKIKQNNFL +I
Sbjct: 61  LWGVLDPQVEAAKLNEDPFAARKKQLRKMNREKIKQNNFLSRI 103

>AEL167C Chr5 complement(322363..322668) [306 bp, 101 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR268W
           (MRPL37)
          Length = 101

 Score =  108 bits (270), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 69/101 (68%), Gaps = 3/101 (2%)

Query: 43  MFQLLRLFPRRFVSTSPVLGQAVK---SSCPAGTIINVNTKKSGKDPVALEDNEYPDWLW 99
           M  L   F R F  +  V  Q  +   SSCPAGT +N+  KK GK+P+ALED++YP+WLW
Sbjct: 1   MLSLRSSFRRLFSVSCRVYDQQAQKAVSSCPAGTPLNLLIKKGGKEPLALEDSDYPEWLW 60

Query: 100 EVLDPEAQMKKLQADPMKLRKKQLRKDNREKIKQNNFLKQI 140
           +VLDPEAQ  KL  DP+K RKK LR+ NRE IKQ NFL ++
Sbjct: 61  KVLDPEAQAAKLAEDPIKARKKALRRMNREHIKQQNFLAKM 101

>CAGL0I09372g Chr9 (901576..901887) [312 bp, 103 aa] {ON} similar to
           uniprot|P36532 Saccharomyces cerevisiae YBR268w MRPL37
          Length = 103

 Score =  104 bits (259), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 53/99 (53%), Positives = 70/99 (70%), Gaps = 7/99 (7%)

Query: 49  LFPRRFVSTSPVL---GQAVKSSCPAGTIINVNTKKSGKDPVALEDNEYPDWLWEVLD-- 103
           LF +R +S+S VL    + +KSSC AGT +++N KK+GKDPVALED+EYP+WLW VLD  
Sbjct: 5   LFTKRLLSSSVVLRNEAKQIKSSCLAGTPLSLNVKKTGKDPVALEDSEYPEWLWTVLDQT 64

Query: 104 --PEAQMKKLQADPMKLRKKQLRKDNREKIKQNNFLKQI 140
               A    +  + +K RKKQ+R+ NREKIKQ NFL Q+
Sbjct: 65  NTAAAAKAPVSEESLKARKKQIRQSNREKIKQRNFLNQL 103

>NCAS0B07440 Chr2 complement(1405363..1405695) [333 bp, 110 aa] {ON}
           Anc_1.318 YBR268W
          Length = 110

 Score =  100 bits (249), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 54/109 (49%), Positives = 72/109 (66%), Gaps = 14/109 (12%)

Query: 46  LLRLFPRRFVSTS-----------PVLGQAVKSSCPAGTIINVNTKKSGKDPVALEDNEY 94
           +LRL  +R +STS                 +KSSC AGT +N+N KK+GKDP+ALEDNEY
Sbjct: 1   MLRLVFKRSLSTSFRVLTAEAATTANASTNIKSSCLAGTSLNLNIKKNGKDPIALEDNEY 60

Query: 95  PDWLWEVLD---PEAQMKKLQADPMKLRKKQLRKDNREKIKQNNFLKQI 140
           P WLW+VL+   P+      + + + +RKKQLRK+NR+KIKQNNFL Q+
Sbjct: 61  PAWLWKVLESKAPKEASDLSEQEVLAMRKKQLRKENRKKIKQNNFLSQL 109

>Smik_2.411 Chr2 (727356..727673) [318 bp, 105 aa] {ON} YBR268W
           (REAL)
          Length = 105

 Score = 99.8 bits (247), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 53/104 (50%), Positives = 69/104 (66%), Gaps = 9/104 (8%)

Query: 46  LLRLFPRRFVSTSPVL-----GQAVKSSCPAGTIINVNTKKSGKDPVALEDNEYPDWLWE 100
           L R    RF+STS VL      ++V SSCPAGT +N+N  KSGKD VALED EYP+WLW 
Sbjct: 2   LARSLGYRFISTSRVLFNKPAVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLWG 61

Query: 101 VLDPEAQMKKLQADP----MKLRKKQLRKDNREKIKQNNFLKQI 140
           +L+ E  ++    DP    +  R+K +RK NR++IKQNNFL Q+
Sbjct: 62  ILNNEQTVEHTTKDPEGEALLKRRKNIRKANRQRIKQNNFLSQL 105

>YBR268W Chr2 (741299..741616) [318 bp, 105 aa] {ON}
           MRPL37Mitochondrial ribosomal protein of the large
           subunit
          Length = 105

 Score = 99.0 bits (245), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 68/104 (65%), Gaps = 9/104 (8%)

Query: 46  LLRLFPRRFVSTSPVL-----GQAVKSSCPAGTIINVNTKKSGKDPVALEDNEYPDWLWE 100
           L R    R +STS +L      ++V SSCPAGT +N+N  KSGKD VALED EYP+WLW 
Sbjct: 2   LARSLGYRLISTSRILYNKPTVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLWS 61

Query: 101 VLDPEAQMKKLQADP----MKLRKKQLRKDNREKIKQNNFLKQI 140
           VLD +  ++    DP    +  R+K +RK NR++IKQNNFL Q+
Sbjct: 62  VLDSDHVVEHAAEDPEGQALLKRRKNIRKANRQRIKQNNFLSQL 105

>Suva_4.529 Chr4 (912965..913282) [318 bp, 105 aa] {ON} YBR268W
           (REAL)
          Length = 105

 Score = 97.8 bits (242), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 55/104 (52%), Positives = 66/104 (63%), Gaps = 9/104 (8%)

Query: 46  LLRLFPRRFVSTSPVL--GQAVK---SSCPAGTIINVNTKKSGKDPVALEDNEYPDWLWE 100
           L R    R++STS V    QAVK   SSCPAGT +N+N  KSGKD  ALED EYP WLW 
Sbjct: 2   LARSVSCRWLSTSRVFYNKQAVKVVASSCPAGTSLNLNIWKSGKDAQALEDREYPSWLWS 61

Query: 101 VLDPEAQMKKLQADP----MKLRKKQLRKDNREKIKQNNFLKQI 140
           VLD +  +     DP    +  RKK +RK NR++IKQNNFL Q+
Sbjct: 62  VLDAKQAVDHAAKDPEGEALSQRKKNIRKANRQQIKQNNFLSQL 105

>NDAI0B04770 Chr2 complement(1176179..1176520) [342 bp, 113 aa] {ON}
           Anc_1.318 YBR268W
          Length = 113

 Score = 97.8 bits (242), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 70/113 (61%), Gaps = 18/113 (15%)

Query: 46  LLRLFPRRFVSTS-----------PVLGQAVKSSCPAGTIINVNTKKSGKDPVALEDNEY 94
           +LRLF +R  STS             +   +KSSC AGT +N+N KK+GK+P+ALED EY
Sbjct: 1   MLRLFVKRSFSTSIKVLNAEVKVASTIASEIKSSCLAGTPLNLNIKKTGKEPIALEDKEY 60

Query: 95  PDWLWEVLDPEAQMKKLQA-------DPMKLRKKQLRKDNREKIKQNNFLKQI 140
           P+WLW VLD +    + ++       + +  RK+QLR + R+KIKQNNFL QI
Sbjct: 61  PEWLWTVLDTKTANGRAKSGKGTSVEESLLARKRQLRVETRKKIKQNNFLSQI 113

>TBLA0F01320 Chr6 complement(332337..332672) [336 bp, 111 aa] {ON}
           Anc_1.318 YBR268W
          Length = 111

 Score = 96.3 bits (238), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 67/105 (63%), Gaps = 4/105 (3%)

Query: 40  SLSMF--QLLR--LFPRRFVSTSPVLGQAVKSSCPAGTIINVNTKKSGKDPVALEDNEYP 95
           SLS F  +LL+  L P    +      QA+KSSCPAGT + +N  K GKDPVALED +YP
Sbjct: 6   SLSTFANRLLQQELMPAAKAAAKKTPQQAIKSSCPAGTELRLNVYKDGKDPVALEDEKYP 65

Query: 96  DWLWEVLDPEAQMKKLQADPMKLRKKQLRKDNREKIKQNNFLKQI 140
            WLW +L P         + +  RKK LRK+NR++IKQNNFLKQ+
Sbjct: 66  PWLWSILTPSNNKNPSPMEAIAQRKKVLRKNNRDRIKQNNFLKQL 110

>KNAG0C01770 Chr3 (349006..349311) [306 bp, 101 aa] {ON} Anc_1.318
           YBR268W
          Length = 101

 Score = 94.4 bits (233), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 46/101 (45%), Positives = 65/101 (64%), Gaps = 6/101 (5%)

Query: 46  LLRLFPRRFVSTSPVLGQ-----AVKSSCPAGTIINVNTKKSGKDPVALEDNEYPDWLWE 100
           + R   RR      VLGQ     AVKSSC AGT + ++ +K G+DPVA+ D EYP+WLW 
Sbjct: 1   MWRFVQRRMWHGGRVLGQTAQGPAVKSSCLAGTPLKLDIRKDGRDPVAMRDEEYPEWLWH 60

Query: 101 VLDPE-AQMKKLQADPMKLRKKQLRKDNREKIKQNNFLKQI 140
           VL+P        +ADP+  R+K+LR+ +R +IKQ+N+L Q+
Sbjct: 61  VLEPATGGDASARADPLAARRKELRRKHRNEIKQSNYLSQL 101

>Skud_2.400 Chr2 (710286..710603) [318 bp, 105 aa] {ON} YBR268W
           (REAL)
          Length = 105

 Score = 93.2 bits (230), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 68/104 (65%), Gaps = 9/104 (8%)

Query: 46  LLRLFPRRFVSTSPVL--GQAVK---SSCPAGTIINVNTKKSGKDPVALEDNEYPDWLWE 100
           L R    R++STS VL   QAVK   SSCPAGT +N+N  KSGKD +ALE+ EYP WLW 
Sbjct: 2   LARSVSYRWISTSRVLYNKQAVKTVVSSCPAGTSLNLNIWKSGKDALALEEKEYPSWLWS 61

Query: 101 VLDP----EAQMKKLQADPMKLRKKQLRKDNREKIKQNNFLKQI 140
           VLD     E   +  + + +  R+K +RK NR++IKQ+NFL Q+
Sbjct: 62  VLDNKQDVEHAGQDQEGEALLKRRKNIRKANRQRIKQSNFLSQL 105

>KAFR0C04210 Chr3 (839148..839453) [306 bp, 101 aa] {ON} Anc_1.318
           YBR268W
          Length = 101

 Score = 84.3 bits (207), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 66/102 (64%), Gaps = 8/102 (7%)

Query: 46  LLRLFPRRFVSTSPVLGQAVK----SSCPAGTIINVNTKKSGKDPVALEDNEYPDWLWEV 101
           +LRL  RRF S S  + Q+ K    SSCP GT + +  +K  K P+AL+D EYP WLW V
Sbjct: 1   MLRL-SRRFFSHSRSVLQSTKCLLVSSCPEGTPLKLGVRKGQKPPLALKDEEYPGWLWSV 59

Query: 102 LDPEAQMKKLQADP---MKLRKKQLRKDNREKIKQNNFLKQI 140
           L+ E+   + +  P   ++LR+KQLRK NR+KIKQ NFL ++
Sbjct: 60  LNEESANTQKELSPIQELELRRKQLRKLNRDKIKQKNFLSEL 101

>YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}
           VAN1Component of the mannan polymerase I, which contains
           Van1p and Mnn9p and is involved in the first steps of
           mannan synthesis; mutants are vanadate-resistant
          Length = 535

 Score = 30.8 bits (68), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 36/70 (51%), Gaps = 3/70 (4%)

Query: 37  SITSLSMFQLLRLFPRRFVSTSPVLGQAVKSSCPAGTIINVNTKKSGKDPVALEDNEYPD 96
           SITSL +  +L L+   F+S    +G  V S+    +++  +        + LED EY D
Sbjct: 65  SITSLIIIAVLSLY--LFISFLSGMGIGV-STQNGRSLLGSSKSSENYKTIDLEDEEYYD 121

Query: 97  WLWEVLDPEA 106
           + +E +DPE 
Sbjct: 122 YDFEDIDPEV 131

>NDAI0K02320 Chr11 (520425..521255) [831 bp, 276 aa] {ON} Anc_6.360
           YNR040W
          Length = 276

 Score = 29.6 bits (65), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 10/57 (17%)

Query: 28  SFLYSGPSSSITSLSMFQLLRLFPRRFVSTSPVLGQAVKSSCPAGTIINVNTKKSGK 84
           + +Y  P+  I++L  +Q+ R        TSP+LG+++ +  P G I  V +K +GK
Sbjct: 101 NIVYIPPNLKISTLPHYQITR--------TSPILGRSITTMKPVGQI--VKSKGNGK 147

>Ecym_2326 Chr2 complement(636937..637851) [915 bp, 304 aa] {ON}
           similar to Ashbya gossypii AFR607C
          Length = 304

 Score = 29.3 bits (64), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 7/77 (9%)

Query: 30  LYSGPSSSITSLSMFQLLRL-FPRRF---VSTSPVLGQAVK--SSCPAGTIINVNTKKSG 83
           L+SG ++    +S  Q++   FP R    V  S  L +  K     P   +I V+ K+ G
Sbjct: 65  LFSGKNTEAKDISELQVIHGKFPVRIPFPVKFSGTLDEIYKFLDKHPDEAVI-VSLKQEG 123

Query: 84  KDPVALEDNEYPDWLWE 100
            D    +++E+P+++WE
Sbjct: 124 SDSWNNDEDEFPNYIWE 140

>SAKL0B03872g Chr2 complement(342546..345728) [3183 bp, 1060 aa]
           {ON} similar to uniprot|Q06132 Saccharomyces cerevisiae
           YLR336C SGD1 Suppressor of Glycerol Defect may be
           involved in high osmolarity signaling pathway
          Length = 1060

 Score = 29.3 bits (64), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 18/27 (66%), Gaps = 3/27 (11%)

Query: 74  IINVNTKKSGKDPVALEDN---EYPDW 97
           ++  + KKSGK  +A+ED+   E PDW
Sbjct: 767 VVTTDKKKSGKAEIAIEDDLLEEMPDW 793

>Kwal_26.7727 s26 (487735..487998) [264 bp, 87 aa] {OFF} [contig
          55] FULL
          Length = 87

 Score = 26.9 bits (58), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 3/54 (5%)

Query: 9  FGILYYNKSELREEVYFRVSF-LYSGPSSSITSLSMFQLLRLFPR-RFVSTSPV 60
          F I       L  ++++R SF LY  P+SS  ++ M + L L PR R ++T P+
Sbjct: 35 FNICAKPALTLNSDIFYRFSFTLYLSPTSSAPTMPM-RFLYLLPRCRKITTPPL 87

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 15,023,627
Number of extensions: 596276
Number of successful extensions: 2564
Number of sequences better than 10.0: 51
Number of HSP's gapped: 2553
Number of HSP's successfully gapped: 51
Length of query: 140
Length of database: 53,481,399
Length adjustment: 98
Effective length of query: 42
Effective length of database: 42,244,131
Effective search space: 1774253502
Effective search space used: 1774253502
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 60 (27.7 bits)