Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0G20680g1.319ON69269236940.0
TDEL0D018801.319ON69169714770.0
Smik_10.1791.319ON71371114080.0
Suva_6.1371.319ON71871514000.0
YJL061W (NUP82)1.319ON71369913940.0
Skud_10.1581.319ON71669913571e-178
NCAS0A092101.319ON71070613531e-178
NDAI0G057501.319ON73472713141e-171
KAFR0A017201.319ON71668412711e-165
SAKL0D06930g1.319ON69070311351e-145
TBLA0F013101.319ON74271611051e-140
Kpol_1035.241.319ON71772010981e-139
KNAG0C058401.319ON74773210461e-131
TPHA0O014601.319ON7217169631e-119
Kwal_14.25801.319ON6876999421e-117
CAGL0J05214g1.319ON7166958601e-104
KLTH0H10692g1.319ON6917038501e-103
Ecym_62901.319ON6716998261e-100
AEL168C1.319ON6737018127e-98
KLLA0F01661g1.319ON6877165854e-65
Kpol_1039.232.253ON129579810.41
Ecym_40165.705ON12581740.83
Suva_10.2751.56ON21967760.95
NDAI0B017707.193ON26765742.0
Suva_10.1778.276ON24870697.4
NDAI0A052503.347ON390103699.5
Smik_14.393.67ON403116699.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0G20680g
         (692 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0G20680g Chr7 complement(1703031..1705109) [2079 bp, 692 aa]...  1427   0.0  
TDEL0D01880 Chr4 (366715..368790) [2076 bp, 691 aa] {ON} Anc_1.3...   573   0.0  
Smik_10.179 Chr10 (311844..313985) [2142 bp, 713 aa] {ON} YJL061...   546   0.0  
Suva_6.137 Chr6 complement(228953..231109) [2157 bp, 718 aa] {ON...   543   0.0  
YJL061W Chr10 (320016..322157) [2142 bp, 713 aa] {ON}  NUP82Link...   541   0.0  
Skud_10.158 Chr10 complement(296754..298904) [2151 bp, 716 aa] {...   527   e-178
NCAS0A09210 Chr1 complement(1820713..1822845) [2133 bp, 710 aa] ...   525   e-178
NDAI0G05750 Chr7 (1424856..1427060) [2205 bp, 734 aa] {ON} Anc_1...   510   e-171
KAFR0A01720 Chr1 complement(349779..351929) [2151 bp, 716 aa] {O...   494   e-165
SAKL0D06930g Chr4 complement(573700..575772) [2073 bp, 690 aa] {...   441   e-145
TBLA0F01310 Chr6 complement(329569..331797) [2229 bp, 742 aa] {O...   430   e-140
Kpol_1035.24 s1035 complement(57897..60050) [2154 bp, 717 aa] {O...   427   e-139
KNAG0C05840 Chr3 (1135516..1137759) [2244 bp, 747 aa] {ON} Anc_1...   407   e-131
TPHA0O01460 Chr15 complement(293395..295560) [2166 bp, 721 aa] {...   375   e-119
Kwal_14.2580 s14 complement(821497..823560) [2064 bp, 687 aa] {O...   367   e-117
CAGL0J05214g Chr10 complement(501919..504069) [2151 bp, 716 aa] ...   335   e-104
KLTH0H10692g Chr8 complement(921787..923862) [2076 bp, 691 aa] {...   332   e-103
Ecym_6290 Chr6 (543547..545562) [2016 bp, 671 aa] {ON} similar t...   322   e-100
AEL168C Chr5 complement(320121..322142) [2022 bp, 673 aa] {ON} S...   317   7e-98
KLLA0F01661g Chr6 complement(156609..158672) [2064 bp, 687 aa] {...   229   4e-65
Kpol_1039.23 s1039 complement(70067..73954) [3888 bp, 1295 aa] {...    36   0.41 
Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON} si...    33   0.83 
Suva_10.275 Chr10 complement(485732..486391) [660 bp, 219 aa] {O...    34   0.95 
NDAI0B01770 Chr2 (422528..423331) [804 bp, 267 aa] {ON} Anc_7.19...    33   2.0  
Suva_10.177 Chr10 complement(331316..331927,331928..332062) [747...    31   7.4  
NDAI0A05250 Chr1 complement(1184620..1185792) [1173 bp, 390 aa] ...    31   9.5  
Smik_14.39 Chr14 (67153..68364) [1212 bp, 403 aa] {ON} YNL292W (...    31   9.6  

>ZYRO0G20680g Chr7 complement(1703031..1705109) [2079 bp, 692 aa]
           {ON} similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 692

 Score = 1427 bits (3694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 692/692 (100%), Positives = 692/692 (100%)

Query: 1   MSIGSHSIFKRASGSSKRFLCTSQDGSKVVIYQDSSIRWCNAFDSKYEFMLLEPTIEDVE 60
           MSIGSHSIFKRASGSSKRFLCTSQDGSKVVIYQDSSIRWCNAFDSKYEFMLLEPTIEDVE
Sbjct: 1   MSIGSHSIFKRASGSSKRFLCTSQDGSKVVIYQDSSIRWCNAFDSKYEFMLLEPTIEDVE 60

Query: 61  HVVLSPTGTLLLLYNSREVRIVEIPWGYSQVSYEGFQKFRYSVDSRQDPLIKKVLFHPLA 120
           HVVLSPTGTLLLLYNSREVRIVEIPWGYSQVSYEGFQKFRYSVDSRQDPLIKKVLFHPLA
Sbjct: 61  HVVLSPTGTLLLLYNSREVRIVEIPWGYSQVSYEGFQKFRYSVDSRQDPLIKKVLFHPLA 120

Query: 121 YREHCIVILKTDNTIHLLDRYYPYDKQPKLLVLNQHDGAFGMEGLVTDIESITFSQDGLT 180
           YREHCIVILKTDNTIHLLDRYYPYDKQPKLLVLNQHDGAFGMEGLVTDIESITFSQDGLT
Sbjct: 121 YREHCIVILKTDNTIHLLDRYYPYDKQPKLLVLNQHDGAFGMEGLVTDIESITFSQDGLT 180

Query: 181 LYALSVAEGCDIYAFYPCLPCSIEIDSHKLDLLMHKSLVQYENLSVETPDATKRNTIKQF 240
           LYALSVAEGCDIYAFYPCLPCSIEIDSHKLDLLMHKSLVQYENLSVETPDATKRNTIKQF
Sbjct: 181 LYALSVAEGCDIYAFYPCLPCSIEIDSHKLDLLMHKSLVQYENLSVETPDATKRNTIKQF 240

Query: 241 QFISKLRQGLENDQTKIDIPMDWLRVRGQGPFTIAPFPDRYYDRTAVQLKILPIGANNDL 300
           QFISKLRQGLENDQTKIDIPMDWLRVRGQGPFTIAPFPDRYYDRTAVQLKILPIGANNDL
Sbjct: 241 QFISKLRQGLENDQTKIDIPMDWLRVRGQGPFTIAPFPDRYYDRTAVQLKILPIGANNDL 300

Query: 301 LLMSFDDGTIVVLYQDLELTMCWDSKGYSYNNSLVLVESIRLERGELVLKQGTLSQFFVL 360
           LLMSFDDGTIVVLYQDLELTMCWDSKGYSYNNSLVLVESIRLERGELVLKQGTLSQFFVL
Sbjct: 301 LLMSFDDGTIVVLYQDLELTMCWDSKGYSYNNSLVLVESIRLERGELVLKQGTLSQFFVL 360

Query: 361 GGTSDIYLVDTSPWSKILSNCIDNSDLEPIADLQFKSEISKIEGVSQIDSYAMWKKDTEP 420
           GGTSDIYLVDTSPWSKILSNCIDNSDLEPIADLQFKSEISKIEGVSQIDSYAMWKKDTEP
Sbjct: 361 GGTSDIYLVDTSPWSKILSNCIDNSDLEPIADLQFKSEISKIEGVSQIDSYAMWKKDTEP 420

Query: 421 KDVFVSKDTVFVKSTAVNDQPSTVKDEKKANVDIPRYEVALNQPMSEILSLNASFQTEAK 480
           KDVFVSKDTVFVKSTAVNDQPSTVKDEKKANVDIPRYEVALNQPMSEILSLNASFQTEAK
Sbjct: 421 KDVFVSKDTVFVKSTAVNDQPSTVKDEKKANVDIPRYEVALNQPMSEILSLNASFQTEAK 480

Query: 481 KPLSKLVEPSKRQTKLNNESNEEQLEILTTVSKEFLQKIVKAQALGFNLHNRCLEQQYEL 540
           KPLSKLVEPSKRQTKLNNESNEEQLEILTTVSKEFLQKIVKAQALGFNLHNRCLEQQYEL
Sbjct: 481 KPLSKLVEPSKRQTKLNNESNEEQLEILTTVSKEFLQKIVKAQALGFNLHNRCLEQQYEL 540

Query: 541 TRQLQYSSEILSKQDKLRSKAQSQSSECESKIQRQDKLLQRFNSLSEKLGRINESPKFRE 600
           TRQLQYSSEILSKQDKLRSKAQSQSSECESKIQRQDKLLQRFNSLSEKLGRINESPKFRE
Sbjct: 541 TRQLQYSSEILSKQDKLRSKAQSQSSECESKIQRQDKLLQRFNSLSEKLGRINESPKFRE 600

Query: 601 MNITDKEMAWFKEIRNQVLVFNQYVHHQKNQQDQLRYLQKELENISLEDKDVGEKSKSEW 660
           MNITDKEMAWFKEIRNQVLVFNQYVHHQKNQQDQLRYLQKELENISLEDKDVGEKSKSEW
Sbjct: 601 MNITDKEMAWFKEIRNQVLVFNQYVHHQKNQQDQLRYLQKELENISLEDKDVGEKSKSEW 660

Query: 661 TELLSILESDTKIIKECNNQLAHASSEVGFST 692
           TELLSILESDTKIIKECNNQLAHASSEVGFST
Sbjct: 661 TELLSILESDTKIIKECNNQLAHASSEVGFST 692

>TDEL0D01880 Chr4 (366715..368790) [2076 bp, 691 aa] {ON} Anc_1.319
           YJL061W
          Length = 691

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/697 (44%), Positives = 437/697 (62%), Gaps = 19/697 (2%)

Query: 1   MSIGSHSIFK---RASGSSKRFLCTSQDGSKVVIYQDSSIRWCNAFDSKYEFMLLEPTIE 57
           M++ +H IF+    A   S RF  T+ DG + V+ QDS IRWCN  +  Y  M LE   +
Sbjct: 1   MTVETHPIFRPSLTAQSGSDRFFLTTSDGGRAVVVQDSCIRWCNVSEPGYHSMTLERAFK 60

Query: 58  DVEHVVLSPTGTLLLLYNSREVRIVEIPWGYSQVS--YEGFQKFRYSVDSRQDPLIKKVL 115
           DV+HVV+S +G  L LYN  E+RI+E+PW Y++VS     FQ FR+  D  +   IK+VL
Sbjct: 61  DVKHVVMSNSGEFLCLYNDDELRIIEVPWAYTEVSSMANAFQLFRFVSDEAR---IKQVL 117

Query: 116 FHPLAYREHCIVILKTDNTIHLLDRYYPYDKQPKLLVLNQHDGAFGMEGLVTDIESITFS 175
           FHPLAY++  +VILK D++I +++     D +P   VLN  +G + ++  +TD+E ITFS
Sbjct: 118 FHPLAYQQETVVILKDDDSITIMNWQDFGDSKPD--VLNLSNGTYSLDSSITDVECITFS 175

Query: 176 QDGLTLYALSVAEGCDIYAFYPCLPCSIEIDSHKLDLLMHKSLVQYENLSVETPDATKRN 235
           QDGLTLY LSV+EG DIYAFYPCL   ++ D   LD LM+KSL+QY+ L+V T    KRN
Sbjct: 176 QDGLTLYVLSVSEGADIYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGTDSEVKRN 235

Query: 236 TIKQFQFISKLRQGLENDQTKIDIPMDWLRVRGQGPFTIAPFPDRYYDRTAVQLKILPIG 295
           TIKQ +F+S L +  +N Q  ++IP    +VRGQGPFTIAPFP + Y  T   +  LPI 
Sbjct: 236 TIKQLKFVSGLHKQ-QNSQRILEIPEAQRQVRGQGPFTIAPFPKQIYSSTGTGIASLPIN 294

Query: 296 ANNDLLLMSFDDGTIVVLYQDLELTMCWDSKGYSYNNSLVLVESIRL---ERGELVLKQG 352
             N+LL+MS DDG I +L QDL++TM WDS  Y+YNNS  LVE I L   E  ++V+   
Sbjct: 295 DQNELLIMSLDDGNIAILLQDLDVTMNWDSARYNYNNSFALVELITLGSQEIQQIVVGDH 354

Query: 353 TLSQFFVLGGTSDIYLVDTSPWSKILSNCIDNSDLEPIADLQFKSEISKIEGVSQIDSYA 412
              QF V+     ++ +DTS WS ++++C+  SDL P+A+ + +SE++  E      S A
Sbjct: 355 KYGQFSVMT-PEGVFSIDTSKWSGVMASCLTESDLRPLAETKLESEVTFTELKDSPKSVA 413

Query: 413 MWKKDTEPKDVFVSKDTVFVKSTAVNDQPSTVKDEKKANVDIP-RYEVALNQPMSEILSL 471
            W  +T P+ V V      VKS  V++  S   D+   +   P +Y    +QP++EI+ L
Sbjct: 414 WW--NTTPQSV-VKVSNREVKSKQVSEGVSKQDDDITGSRQEPEKYNAHYSQPIAEIMQL 470

Query: 472 NASFQTEAKKPLSKLVEPSKRQTKLNNESNEEQLEILTTVSKEFLQKIVKAQALGFNLHN 531
           N  FQ E+ K  SK++ P +RQ  L NE++E QL++LT  SK+F+ KI   Q LG  LHN
Sbjct: 471 NQKFQLESSKAPSKVIPPRERQKPLKNEASEIQLDLLTEASKDFVSKIAVGQTLGVTLHN 530

Query: 532 RCLEQQYELTRQLQYSSEILSKQDKLRSKAQSQSSECESKIQRQDKLLQRFNSLSEKLGR 591
           R  EQQ +LT QL+ S E++ KQ  + +   SQSS  ++   R   L+ RFN   + LG+
Sbjct: 531 RIYEQQLDLTHQLKASGELMEKQQTILTHFHSQSSRSDAVHARHSTLMSRFNKFKDNLGQ 590

Query: 592 INESPKFREMNITDKEMAWFKEIRNQVLVFNQYVHHQKNQQDQLRYLQKELENISLEDKD 651
           I  S +F+++ I+ +E+ WFKEIR QVL FN+ VH+QK  QDQL +L++E+  I+    D
Sbjct: 591 IQNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDVHNQKRLQDQLIHLKQEMNRIAQVTGD 650

Query: 652 VGEKSKSEWTELLSILESDTKIIKECNNQLAHASSEV 688
              +++ EW EL  +LE DT I+++CNNQL  A+ +V
Sbjct: 651 QNSQARDEWHELRHMLEEDTIILQDCNNQLKSAARQV 687

>Smik_10.179 Chr10 (311844..313985) [2142 bp, 713 aa] {ON} YJL061W
           (REAL)
          Length = 713

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/711 (41%), Positives = 450/711 (63%), Gaps = 24/711 (3%)

Query: 2   SIGSHSIFKRASGSSK--RFLCTSQDGSKVVIYQDSSIRWCNAF-DSKYEFMLLEP--TI 56
           S+ S  IF+ +  +S+  R++ TSQ+G+++V  QD+ IRW N   D  Y  + L     +
Sbjct: 6   SLASLPIFQASLSASQSPRYIFTSQNGTRIVFIQDNIIRWYNVLTDPCYHSLSLSRHLVL 65

Query: 57  EDVEHVVLSPTGTLLLLYNSREVRIVEIPWGYSQVS----YEGFQKFRYSVDSRQ---DP 109
           +D  HV+ S +G LL  +N +E+ ++E+PWGYS V      + FQ F YSVD  +     
Sbjct: 66  DDTFHVISSTSGDLLCFFNDQEIFVMEVPWGYSNVENISIQDAFQVFHYSVDETELGPKS 125

Query: 110 LIKKVLFHPLAYREHCIVILKTDNTIHLLDRYYPYDKQPKLLVLNQHDGAFGMEGLVTDI 169
           LIKKVLFHP +Y + CIV+LK ++TI + D     ++Q K ++LN+ + +FG++  + DI
Sbjct: 126 LIKKVLFHPKSYHDSCIVVLKENDTIIMFD---ILNQQEKPIILNKPNNSFGLDARLNDI 182

Query: 170 ESITFSQDGLTLYALSVAEGCDIYAFYPCLPCSIEIDSHKLDLLMHKSLVQYENLSVETP 229
             + FS+DGLTLY L+  EG DI+AFYP LP ++ ++ + L  +++KSLV YE+L   T 
Sbjct: 183 TDLVFSKDGLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLSWILNKSLVMYESLDPTTD 242

Query: 230 DATKRNTIKQFQFISKLRQGLENDQTKIDIPMDWLRVRGQGPFTIAPFPDRYYDRTAVQL 289
              KRN IKQ QF+SKL +  ++   K+DI  ++  V+ QGPFTI PFP+  YD TA  +
Sbjct: 243 VTVKRNIIKQLQFVSKLHENWDSKLNKVDIDSEYRLVKVQGPFTINPFPNELYDYTAKNI 302

Query: 290 KILPI-GANNDLLLMSFDDGTIVVLYQDLELTMCWDSKGYSYNNSLVLVESIRLERG--E 346
             + I    N++  +SFDDG++++L +DLE++M WD   Y YN+SLVL+E +++++    
Sbjct: 303 ATISIDNQQNEIFCISFDDGSLILLLKDLEMSMSWDVGNYVYNDSLVLIERVKMQKEIES 362

Query: 347 LVLKQGTLSQFFVLGGTSDIYLVDTSPWSKILSNCIDNSDLEPIADLQFKSEISKIEGVS 406
           L+     + + +V      +Y V+++ W+  +S CI+ SDL P+ DL+F+S+I  I  V 
Sbjct: 363 LITLPEQMGKLYVFSKNF-VYQVNSTSWTSTISKCINESDLNPLGDLKFESKIENIATVE 421

Query: 407 QIDSYAMWKKDTEPKDVFVSKDTVFVKSTAVNDQPSTVKDE-----KKANVDIPRYEVAL 461
            + + A    +        S   +  ++ +V+ +  + + E     +++ +   RYE+  
Sbjct: 422 GMPNLAHIYWNNTSNLALASNKELTFQTVSVDQKMQSTETETDIGTEESGLAKCRYELRF 481

Query: 462 NQPMSEILSLNASFQTEAKKPLSKLVEPSKRQTKLNNESNEEQLEILTTVSKEFLQKIVK 521
            QP+SEIL+LN +FQ     P  +++  + RQ  L NE++E QLEI T VSKEFLQKI K
Sbjct: 482 TQPLSEILTLNENFQRACISPCEQIIPSTDRQIPLKNEASENQLEIFTDVSKEFLQKIAK 541

Query: 522 AQALGFNLHNRCLEQQYELTRQLQYSSEILSKQDKLRSKAQSQSSECESKIQRQDKLLQR 581
           AQ+LG +++NR  EQQ ELTRQLQ + +I+SK   LR K ++Q+ + +++I RQ KL++R
Sbjct: 542 AQSLGVSIYNRIHEQQLELTRQLQSTCKIISKDVDLRKKFEAQNKKWDAQIIRQSKLMER 601

Query: 582 FNSLSEKLGRINESPKFREMNITDKEMAWFKEIRNQVLVFNQYVHHQKNQQDQLRYLQKE 641
           F+ L+E L  I++S KF+E NI++ EM WFKEIRNQ+L FN YVH QK+ Q  L YL++E
Sbjct: 602 FSKLTENLSEISKSNKFKEKNISNAEMEWFKEIRNQILQFNCYVHSQKSLQQDLSYLKRE 661

Query: 642 LENISLEDKDVGEKSKSEWTELLSILESDTKIIKECNNQLAHASSEVGFST 692
           L  I  E   V +KS+SEW EL  +LE D+KIIKECN +L HAS ++   T
Sbjct: 662 LTRIETETIQVDKKSQSEWNELRKMLEIDSKIIKECNEELQHASQQLTTKT 712

>Suva_6.137 Chr6 complement(228953..231109) [2157 bp, 718 aa] {ON}
           YJL061W (REAL)
          Length = 718

 Score =  543 bits (1400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/715 (40%), Positives = 444/715 (62%), Gaps = 27/715 (3%)

Query: 2   SIGSHSIFKRA--SGSSKRFLCTSQDGSKVVIYQDSSIRWCNAF-DSKYEFMLLEP--TI 56
           S+ +  IF+ +  +  S R++ +S +G+++V+ QD  IRWC+   D  Y  +       +
Sbjct: 6   SLAALPIFQASLSANQSPRYIFSSHNGTRLVVIQDDIIRWCSLLTDPSYHSLNFSRHLVL 65

Query: 57  EDVEHVVLSPTGTLLLLYNSREVRIVEIPWGYSQVS----YEGFQKFRYSVDSRQ---DP 109
           +D  H + S +G LL  Y+ +E+ ++EIPWGY  +      + FQ F YSVD  +   + 
Sbjct: 66  DDTFHAISSASGDLLCFYSDQEIFVMEIPWGYLNLGDVSIQDAFQVFHYSVDELELGSNS 125

Query: 110 LIKKVLFHPLAYREHCIVILKTDNTIHLLDRYYPYDKQPKLLVLNQHDGAFGMEGLVTDI 169
            IKKVLFHP +Y + CIV+LK D+TI + D     ++Q   ++LN+ + +FG++  V DI
Sbjct: 126 PIKKVLFHPKSYNDSCIVVLKNDDTITMFD---ILNQQEAPIILNKRNSSFGLDARVNDI 182

Query: 170 ESITFSQDGLTLYALSVAEGCDIYAFYPCLPCSIEIDSHKLDLLMHKSLVQYENLSVETP 229
               FS+DGLTLY L+  EG DI+AFYP LP  + +    L  +++KSLV YE+L+  T 
Sbjct: 183 TDFAFSKDGLTLYCLNTTEGGDIFAFYPFLPSVLSLSEKDLGWILNKSLVMYESLNATTD 242

Query: 230 DATKRNTIKQFQFISKLRQGLENDQTKIDIPMDWLRVRGQGPFTIAPFPDRYYDRTAVQL 289
              KRN  KQ QF+SKL +  ++   K+ I  ++  V+ QGPFTI PFP+  YD TA ++
Sbjct: 243 YKVKRNITKQLQFVSKLHKNWDSKLAKVKIDDEYRLVKMQGPFTINPFPNELYDFTASKI 302

Query: 290 KILPI-GANNDLLLMSFDDGTIVVLYQDLELTMCWDSKGYSYNNSLVLVESIRLERGELV 348
             +PI    N+++ +SFDDG++++L+QDLE++M WD   Y YNNSL+L+E I+L++ E+ 
Sbjct: 303 TTIPIDNQQNEIVCVSFDDGSLIILFQDLEMSMSWDVDNYVYNNSLILIERIKLQQKEMK 362

Query: 349 LKQGTLSQFFVLGGT--SDIYLVDTSPWSKILSNCIDNSDLEPIADLQFKSEISKIEGVS 406
                  Q   L  T  S ++ +D + W+ +LS CID SDL  +AD++F S+   I  + 
Sbjct: 363 SLTALPDQLGKLYVTLESSVHQLDCTSWTSVLSKCIDESDLNALADVKFVSKFEDIATIH 422

Query: 407 QIDSYAMWKKDTEPKDVFVSKDTVFVK--STAVNDQPSTVKDEKKANVDIPR-------Y 457
           Q+ ++A    + +     +SK+ + ++  S    +Q      E   NV+  +       Y
Sbjct: 423 QLSNFAYINWNDKSSLALISKEKLTIQNISNHKKEQSLNAPAELDTNVNSDKSDTGKRGY 482

Query: 458 EVALNQPMSEILSLNASFQTEAKKPLSKLVEPSKRQTKLNNESNEEQLEILTTVSKEFLQ 517
           E++  QP++EILSLN SFQ     P  +++ P+ RQ  L NE+NE QLEI T +SKEFL+
Sbjct: 483 EISFTQPINEILSLNESFQKVCLSPCERIIPPADRQLPLKNEANENQLEIFTDISKEFLR 542

Query: 518 KIVKAQALGFNLHNRCLEQQYELTRQLQYSSEILSKQDKLRSKAQSQSSECESKIQRQDK 577
           KI+KAQ+LG +++NR  EQQ+ELTRQLQ +S+I++K + L+ K ++Q+ +  S+  RQ +
Sbjct: 543 KIIKAQSLGVSIYNRIHEQQFELTRQLQSTSKIIAKDEILQKKLEAQTEKWNSQSSRQAE 602

Query: 578 LLQRFNSLSEKLGRINESPKFREMNITDKEMAWFKEIRNQVLVFNQYVHHQKNQQDQLRY 637
           L+ RF  L+E L ++ ES KF+E NI+  EM WFKEIRNQ+L FN +VH QK+ Q  L Y
Sbjct: 603 LMTRFGKLTENLSKVAESDKFKEQNISHGEMEWFKEIRNQILQFNGFVHSQKSIQQDLSY 662

Query: 638 LQKELENISLEDKDVGEKSKSEWTELLSILESDTKIIKECNNQLAHASSEVGFST 692
           L++EL  I  E  +  +KS++EW EL  +LE D+KIIKECN +L H S ++   T
Sbjct: 663 LKRELIRIESETINADKKSQNEWDELRKMLEVDSKIIKECNEELVHVSQQLTTKT 717

>YJL061W Chr10 (320016..322157) [2142 bp, 713 aa] {ON}  NUP82Linker
           nucleoporin component of the nuclear pore complex (NPC);
           also part of the NPC cytoplasmic filaments; contributes
           to nucleocytoplasmic transport and NPC biogenesis; forms
           stable associations with three FG-nucleoporins (Nsp1p,
           Nup159p, and Nup116p)
          Length = 713

 Score =  541 bits (1394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/699 (41%), Positives = 438/699 (62%), Gaps = 22/699 (3%)

Query: 12  ASGSSKRFLCTSQDGSKVVIYQDSSIRWCNAF-DSKYEFMLLEP--TIEDVEHVVLSPTG 68
           ++  S R++ +SQ+G+++V  QD+ IRW N   DS Y  +       ++D  HV+ S +G
Sbjct: 18  SASQSPRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNFSRHLVLDDTFHVISSTSG 77

Query: 69  TLLLLYNSREVRIVEIPWGYSQVS----YEGFQKFRYSVDSRQ---DPLIKKVLFHPLAY 121
            LL L+N  E+ ++E+PWGYS V      + FQ F YS+D  +      IKKVLFHP +Y
Sbjct: 78  DLLCLFNDNEIFVMEVPWGYSNVEDVSIQDAFQIFHYSIDEEEVGPKSSIKKVLFHPKSY 137

Query: 122 REHCIVILKTDNTIHLLDRYYPYDKQPKLLVLNQHDGAFGMEGLVTDIESITFSQDGLTL 181
           R+ CIV+LK D+TI + D     + Q K +VLN+ + +FG++  V DI  + FS+DGLTL
Sbjct: 138 RDSCIVVLKEDDTITMFD---ILNSQEKPIVLNKPNNSFGLDARVNDITDLEFSKDGLTL 194

Query: 182 YALSVAEGCDIYAFYPCLPCSIEIDSHKLDLLMHKSLVQYENLSVETPDATKRNTIKQFQ 241
           Y L+  EG DI+AFYP LP  + ++   L+L+++KSLV YE+L   T    KRN IKQ Q
Sbjct: 195 YCLNTTEGGDIFAFYPFLPSVLLLNEKDLNLILNKSLVMYESLDSTTDVIVKRNVIKQLQ 254

Query: 242 FISKLRQGLENDQTKIDIPMDWLRVRGQGPFTIAPFPDRYYDRTAVQLKILPI-GANNDL 300
           F+SKL +   +   K+DI  ++   + QGPFTI PFP   YD TA  +  + I    N++
Sbjct: 255 FVSKLHENWNSRFGKVDIQKEYRLAKVQGPFTINPFPGELYDYTATNIATILIDNGQNEI 314

Query: 301 LLMSFDDGTIVVLYQDLELTMCWDSKGYSYNNSLVLVESIRLER--GELVLKQGTLSQFF 358
           + +SFDDG++++L++DLE++M WD   Y YNNSLVL+E ++L+R    L+     L + +
Sbjct: 315 VCVSFDDGSLILLFKDLEMSMSWDVDNYVYNNSLVLIERVKLQREIKSLITLPEQLGKLY 374

Query: 359 VLGGTSDIYLVDTSPWSKILSNCIDNSDLEPIADLQFKSEISKIEGVSQIDSYAMWKKDT 418
           V+     I  V+   W+  LS CI+ SDL P+A L+F+S++  I  + +I + A    + 
Sbjct: 375 VISDNI-IQQVNFMSWASTLSKCINESDLNPLAGLKFESKLEDIATIERIPNLAYINWND 433

Query: 419 EPKDVFVSKDTVFVKSTAVNDQPSTVKDE-----KKANVDIPRYEVALNQPMSEILSLNA 473
           +     +S  T+  ++ + + +P +   E     +K++     ++++  QP++EIL LN 
Sbjct: 434 QSNLALMSNKTLTFQNISSDMKPQSTAAETSISTEKSDTVGDGFKMSFTQPINEILILND 493

Query: 474 SFQTEAKKPLSKLVEPSKRQTKLNNESNEEQLEILTTVSKEFLQKIVKAQALGFNLHNRC 533
           +FQ     P  +++  + RQ  L NE++E QLEI T +SKEFLQ+IVKAQ LG ++HNR 
Sbjct: 494 NFQKACISPCERIIPSADRQIPLKNEASENQLEIFTDISKEFLQRIVKAQTLGVSIHNRI 553

Query: 534 LEQQYELTRQLQYSSEILSKQDKLRSKAQSQSSECESKIQRQDKLLQRFNSLSEKLGRIN 593
            EQQ+ELTRQLQ + +I+SK D LR K ++Q+ + ++++ RQ +L++RF+ LS+KL +I 
Sbjct: 554 HEQQFELTRQLQSTCKIISKDDDLRRKFEAQNKKWDAQLSRQSELMERFSKLSKKLSQIA 613

Query: 594 ESPKFREMNITDKEMAWFKEIRNQVLVFNQYVHHQKNQQDQLRYLQKELENISLEDKDVG 653
           ES KF+E  I+  EM WFKEIRNQ+L FN +VH QK+ Q  L YL+ EL  I  E   V 
Sbjct: 614 ESNKFKEKKISHGEMKWFKEIRNQILQFNSFVHSQKSLQQDLSYLKSELTRIEAETIKVD 673

Query: 654 EKSKSEWTELLSILESDTKIIKECNNQLAHASSEVGFST 692
           +KS++EW EL  +LE D+KIIKECN +L   S E    T
Sbjct: 674 KKSQNEWDELRKMLEIDSKIIKECNEELLQVSQEFTTKT 712

>Skud_10.158 Chr10 complement(296754..298904) [2151 bp, 716 aa] {ON}
           YJL061W (REAL)
          Length = 716

 Score =  527 bits (1357), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 287/699 (41%), Positives = 440/699 (62%), Gaps = 22/699 (3%)

Query: 12  ASGSSKRFLCTSQDGSKVVIYQDSSIRWCNAF-DSKYEFMLLEP--TIEDVEHVVLSPTG 68
           ++  S  ++ +S +G++VV  QD+ IRWCN+  +S Y+ +       ++D   V+ S +G
Sbjct: 18  SASQSPSYIFSSHNGTRVVFIQDNIIRWCNSLTESSYQSLDFSRHLILDDTFRVISSASG 77

Query: 69  TLLLLYNSREVRIVEIPWGYSQVS----YEGFQKFRYSVDSRQD---PLIKKVLFHPLAY 121
            LL  +N +E+ ++E+PWGY+ +      + FQ F YSV   ++    LIKKVLFHP +Y
Sbjct: 78  DLLGFFNVQEIFVMEVPWGYNNIEEASVQDAFQLFHYSVGQVENGSRSLIKKVLFHPKSY 137

Query: 122 REHCIVILKTDNTIHLLDRYYPYDKQPKLLVLNQHDGAFGMEGLVTDIESITFSQDGLTL 181
            + CIV+LK D+TI + D     ++Q K +VLN+   +FG++  V DI  + FS+DGLTL
Sbjct: 138 HDSCIVVLKEDDTITMFD---ILNQQHKPIVLNKRSNSFGLDARVNDITDLAFSRDGLTL 194

Query: 182 YALSVAEGCDIYAFYPCLPCSIEIDSHKLDLLMHKSLVQYENLSVETPDATKRNTIKQFQ 241
           Y L+  EG D++AFYP LP  + +    L  +++KSLV YE+L   T    KRN IKQ Q
Sbjct: 195 YCLNTTEGGDVFAFYPLLPPVLLLGEKDLGWILNKSLVMYESLDSTTDITVKRNIIKQLQ 254

Query: 242 FISKLRQGLENDQTKIDIPMDWLRVRGQGPFTIAPFPDRYYDRTAVQLKILPI-GANNDL 300
            +SKL + L++   K++I  ++  V+ QGPFTI PFPD  Y+ TA  +  +PI    N++
Sbjct: 255 LVSKLHENLDSQLGKVEIDEEYRLVKMQGPFTINPFPDELYEYTAANITTIPIDNMQNEI 314

Query: 301 LLMSFDDGTIVVLYQDLELTMCWDSKGYSYNNSLVLVESIRLERGEL-VLKQ--GTLSQF 357
           + + FDDG++ +L+QDLE++M WD   Y +NNSLVL+E I+++  ++  LK     L + 
Sbjct: 315 VCVGFDDGSLNLLFQDLEMSMSWDVDNYVHNNSLVLIERIKIQETDIKSLKTLPEELGKL 374

Query: 358 FVLGGTSDIYLVDTSPWSKILSNCIDNSDLEPIADLQFKSEISKIEGVSQIDSYAMWKKD 417
           +V    S ++ +D++ WS ILS CI+ SDL  + D++F+S++  I  +    + A    +
Sbjct: 375 YVFSENS-VHQLDSTNWSAILSRCIEESDLNALGDVKFESKLENIVTIEHPSNLAYISWN 433

Query: 418 TEPKDVFVSKDTVFVKSTAVNDQPSTVK---DEKKANVDIPR-YEVALNQPMSEILSLNA 473
                V  ++  +  ++ + + +  T K   + K   +D  + YE++  QP++EILSLN 
Sbjct: 434 DTSNLVLTARGKLTFQNISNDKELQTTKFDANNKSDRIDAGKHYEMSFTQPINEILSLNE 493

Query: 474 SFQTEAKKPLSKLVEPSKRQTKLNNESNEEQLEILTTVSKEFLQKIVKAQALGFNLHNRC 533
           SFQ     P  K++ P+ RQ  L NE++E QLEI T +SKEFLQKI+KAQ+LGF+++NR 
Sbjct: 494 SFQKACISPCEKIIPPAYRQMPLKNEASENQLEIFTGISKEFLQKIIKAQSLGFSIYNRI 553

Query: 534 LEQQYELTRQLQYSSEILSKQDKLRSKAQSQSSECESKIQRQDKLLQRFNSLSEKLGRIN 593
            EQQ+ELTRQLQ +S+I+SK   L+ K  +Q+ + ++++ RQ KL++RF  L+E L +I 
Sbjct: 554 QEQQFELTRQLQATSKIISKDADLQEKLGAQNKKWDAQVSRQVKLMERFKKLTENLSQIA 613

Query: 594 ESPKFREMNITDKEMAWFKEIRNQVLVFNQYVHHQKNQQDQLRYLQKELENISLEDKDVG 653
           ES K RE NI   EM WFKEIRNQ+L FN +V  QK+ Q  L Y++KEL  I  E     
Sbjct: 614 ESKKLREKNINRGEMKWFKEIRNQILQFNNFVRSQKSLQQDLSYMKKELTRIEAETIKTD 673

Query: 654 EKSKSEWTELLSILESDTKIIKECNNQLAHASSEVGFST 692
           EK+++EW EL  +LE D+KIIKECN +L H S ++  +T
Sbjct: 674 EKTQNEWDELRKMLEEDSKIIKECNEELMHVSQQLTTNT 712

>NCAS0A09210 Chr1 complement(1820713..1822845) [2133 bp, 710 aa]
           {ON} Anc_1.319 YJL061W
          Length = 710

 Score =  525 bits (1353), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 288/706 (40%), Positives = 436/706 (61%), Gaps = 34/706 (4%)

Query: 2   SIGSHSIFKR---ASGSSKRFLCTSQDGSKVVIYQDSSIRWCNAFDSKYEFM---LLEPT 55
           SI SH IF+       ++ RFL TS  G+++V+ Q   +RWC+   S +  M     +P 
Sbjct: 6   SIASHPIFQGLDCTQDAAPRFLFTSHHGTRMVVLQGGLLRWCSVTASSFNSMTIDFFQPE 65

Query: 56  IEDVEHVVLSPTGTLLLLYNSREVRIVEIPWGYSQVSYEGFQKFR-YSVDSRQD---PLI 111
               +  +LS +G  + +Y +  + ++EIPWGY   S     KF+ +S +++ D     I
Sbjct: 66  STAPQKAILSNSGEFICVYTNHTIEVIEIPWGYVTPSPSMVSKFQLFSYNNKDDDGYSPI 125

Query: 112 KKVLFHPLAYREHCIVILKTDNTIHLLDRYYPYDKQPKLLVLNQHDGAFGMEGLVTDIES 171
           K+VLFHP AY++ C+V+L  + TI L+D      +  K + LN+    FG++  +TDIES
Sbjct: 126 KQVLFHPEAYKDSCLVVLYDNGTISLMD----VTQITKTITLNKRVATFGIDTQITDIES 181

Query: 172 ITFSQDGLTLYALSVAEGCDIYAFYPCLPCSIEIDSHKLDLLMHKSLVQYENLSVETPDA 231
           I FS+DG TLYALS+++G DIYAFYPCLP  +E+   K+  L+H+S++ YE+L ++T   
Sbjct: 182 ICFSKDGWTLYALSISDGGDIYAFYPCLPQQLEVKREKITSLLHESVLLYESLKLDTDRD 241

Query: 232 TKRNTIKQFQFISKLRQGL-ENDQTK----IDIPMDWLRVRGQGPFTIAPFPDRYYDRTA 286
            KRN I+Q QF++KL   L EN++      I+I  ++  +RGQGPFTI P+P+R Y  TA
Sbjct: 242 VKRNVIRQVQFVNKLNGLLTENEKNSNEDFIEIEQEYRLIRGQGPFTIDPYPERLYSATA 301

Query: 287 VQLKILPIGANNDLLLMSFDDGTIVVLYQDLELTMCWDSKGYSYNNSLVLVESIRLERGE 346
           +++  LPI +NN+L+ M FDDG+I +L++DL LTM WD   Y +NNS  LVE ++L+  +
Sbjct: 302 LEISTLPINSNNELMCMIFDDGSIALLFKDLPLTMSWDVDNYVHNNSFSLVELMQLKDTD 361

Query: 347 ---LVLKQGTLSQFFVLGGTSDIYLVDTSPWSKILSNCIDNSDLEPIADLQFKSEISKIE 403
              +V    T  QFF+ G +S ++LV T  WS +L+  IDNS+L  + ++ F S++   E
Sbjct: 362 VKRIVSYPDTYGQFFIFGDSS-LFLVHTHIWSDLLAKAIDNSNLNELLEMNFTSKLDFFE 420

Query: 404 GVSQIDSYAMWKKDTEPKDVFVSKDTVFVKSTAV-------NDQPSTVKDEKKANVDIPR 456
             + I   +  K       +F++K+ V++    +       N++P  V +E+  + +   
Sbjct: 421 TTNGITKCSPCKWRGRDVILFITKEDVYMHPVEMRKSGILGNNKPVLVNNEELKHQE--- 477

Query: 457 YEVALNQPMSEILSLNASFQTEAKKPLSKLVEPSKRQTKLNNESNEEQLEILTTVSKEFL 516
           Y+ +  QP+ E+++LN  FQ +    +SKL+ P +RQ  LNNE+NE QLE+L+ VSKE +
Sbjct: 478 YKTSFKQPVEELMALNKLFQQQCSMGVSKLIAPEERQVLLNNENNEVQLELLSDVSKEVI 537

Query: 517 QKIVKAQALGFNLHNRCLEQQYELTRQLQYSSEILSKQDKLRSKAQSQSSECESKIQRQD 576
            KI + Q L  NLH+R LEQQYELTRQL+    I+SKQ  LR K++ QS   + +  R  
Sbjct: 538 SKIGQGQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLRRKSEEQSRRWDDQTSRSS 597

Query: 577 KLLQRFNSLSEKLGRINESPKFREMNITDKEMAWFKEIRNQVLVFNQYVHHQKNQQDQLR 636
           +L++R   L  K+  IN SPK +E  I DKE+ WFKEIRNQVL FN +VH+Q++ Q++L 
Sbjct: 598 QLIKRLQDLDAKILEINNSPKLKEYPINDKELEWFKEIRNQVLKFNSFVHNQRDAQEELN 657

Query: 637 YLQKELENISLEDKDV-GEKSKSEWTELLSILESDTKIIKECNNQL 681
           +L+K+L  IS E   +  EKS  EW EL  IL+ D +II+ECN +L
Sbjct: 658 HLKKDLARISKETSQLRDEKSDKEWDELRDILKHDAQIIQECNKEL 703

>NDAI0G05750 Chr7 (1424856..1427060) [2205 bp, 734 aa] {ON}
           Anc_1.319 YJL061W
          Length = 734

 Score =  510 bits (1314), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 288/727 (39%), Positives = 430/727 (59%), Gaps = 45/727 (6%)

Query: 3   IGSHSIFKRA---SGSSKRFLCTSQDGSKVVIYQDSSIRWCNAFDSKYEFMLLEPTIEDV 59
           I SH IF  +   +  S+RF  TS  G+++V+ Q   ++WCN  D+ Y  M ++    + 
Sbjct: 8   IASHPIFGTSIITNEDSQRFFFTSHQGTRMVLLQGCILKWCNVIDTTYHSMKVKSIFNNK 67

Query: 60  EHVV---LSPTGTLLLLYNSREVRIVEIPWGYSQVSYE---GFQKFRYSVDSRQDPL--- 110
             ++   LS +G  L +Y ++ + I+EIPWGY ++  E    FQ F Y + S    L   
Sbjct: 68  RKIIDVKLSESGDFLCIYTTKTIDILEIPWGYEKIPDELLSKFQPFHYDISSSTSALSSP 127

Query: 111 --IKKVLFHPLAYREHCIVILKTDNTIHLLDRYYPYDKQPKLLVLNQHDGAFGMEGLVTD 168
             IK+VLFHP +Y E C+VIL  D+ I L+D         + + +NQ  G  G+E  V D
Sbjct: 128 SDIKQVLFHPKSYHETCLVILYEDSIIQLIDTT----ASTETITINQPTGTLGVETRVID 183

Query: 169 IESITFSQD-GLTLYALSVAEGCDIYAFYPCLPCSIEIDSHKLDLLMHKSLVQYENLSVE 227
           IESI F +  GL LYALS+++G DIYA YPCLP  +++   ++DLL+ KS+V Y++L   
Sbjct: 184 IESICFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKKEVDLLLQKSIVLYDSLKEN 243

Query: 228 TPDATKRNTIKQFQFISKLRQGL------ENDQTK-----------IDIPMDWLRVRGQG 270
             +  KRN IKQ QF +KL+         E D+ +           +D+ +++  V  QG
Sbjct: 244 MSNDVKRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLILDVDLEYRLVNFQG 303

Query: 271 PFTIAPFPDRYYDRTAVQLKILPIGANNDLLLMSFDDGTIVVLYQDLELTMCWDSKGYSY 330
           PFTI+PFP+  Y  TA + + + I  NN+LL+M+FDDG++ +L++DLELTM WD   Y +
Sbjct: 304 PFTISPFPNELYSATAKESQCMKINENNELLIMTFDDGSVALLFRDLELTMSWDIANYIH 363

Query: 331 NNSLVLVESIRL---ERGELVLKQGTLSQFFVLGGTSDIYLVDTSPWSKILSNCIDNSDL 387
           +NS  LVE I+L   + G L++ Q    +FF+L     I LV T+ WS  L+  ID+S+L
Sbjct: 364 DNSFALVELIKLKPTDIGRLIIYQDNFGKFFLLSDDV-IMLVHTNSWSDKLAKAIDDSNL 422

Query: 388 EPIADLQFKSEISKIEGVSQIDSYAMWKKDTEPKDVFVSKDTVFVKSTAVNDQPSTVKDE 447
             ++++ F+SEI+  + + + ++    K   +   +FVS D VFV++       + +K  
Sbjct: 423 NILSEIGFESEITWFDVMGKFNNCTPCKYHGKESIIFVSSDNVFVENLTKKHSMNNIKGS 482

Query: 448 KKANVDI----PRYEVALNQPMSEILSLNASFQTEAKKPLSKLVEPSKRQTKLNNESNEE 503
             +N +       Y+V   QP+ E+++LN  FQ + + P SKL++P  RQ +L+NESNE 
Sbjct: 483 STSNSNEETAESEYKVTFKQPIDELMTLNELFQKQCRMPFSKLIKPEDRQIELSNESNEI 542

Query: 504 QLEILTTVSKEFLQKIVKAQALGFNLHNRCLEQQYELTRQLQYSSEILSKQDKLRSKAQS 563
           QLEILT +SKE + KI+  Q LGFNLHNR  EQQ ELTRQL+++  +  KQD +++K + 
Sbjct: 543 QLEILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTRQLKHTQIVFEKQDCIKNKNKE 602

Query: 564 QSSECESKIQRQDKLLQRFNSLSEKLGRINESPKFREMNITDKEMAWFKEIRNQVLVFNQ 623
                  ++ R  KL  R  +L+EKL  IN+SP      IT  E+ WFKEIRNQV  FN 
Sbjct: 603 ILKRWNEQLNRSVKLTDRLQNLNEKLITINDSPNLSSYPITSVELEWFKEIRNQVHKFNS 662

Query: 624 YVHHQKNQQDQLRYLQKELENISLEDKD-VGEKSKSEWTELLSILESDTKIIKECNNQLA 682
           +VH Q++  ++L +L+KEL+ IS +    V EKSK EW EL +ILE D+KIIKECN +L 
Sbjct: 663 FVHTQRDANEELSFLKKELDRISNDVTSVVDEKSKKEWEELRAILEQDSKIIKECNIELT 722

Query: 683 HASSEVG 689
             +  + 
Sbjct: 723 KTTESMA 729

>KAFR0A01720 Chr1 complement(349779..351929) [2151 bp, 716 aa] {ON}
           Anc_1.319 YJL061W
          Length = 716

 Score =  494 bits (1271), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 274/684 (40%), Positives = 421/684 (61%), Gaps = 32/684 (4%)

Query: 23  SQDGSKVVIYQDSSIRWCNAFDSKYEFM-LLEPTIEDVEHVVLSPTGTLLLLYNSREVRI 81
           +QD S   IY+ + +RW +   S+Y  + LL       E+V++S +G  L LY+ + + +
Sbjct: 43  AQDSS---IYKKNQLRWGSVASSQYHSLPLLFFDDSAYENVIISNSGQFLCLYDKKSLSL 99

Query: 82  VEIPWGYSQVSYE---GFQKFRYSVDSRQDPLIKKVLFHPLAYREHCIVILKTDNTIHLL 138
           +EIPWGY          FQ+    V+   D  IKK+LFHP A  + C+VIL  ++ I L 
Sbjct: 100 IEIPWGYDGAVTSIKSSFQRVFRDVNKSSD--IKKILFHPKAADDGCVVILFENDVICLF 157

Query: 139 DRYYPYDKQPKLLVLNQHDGAFGMEGLVTDIESITFSQDGLTLYALSVAEGCDIYAFYPC 198
           D      ++ + L LN+     G+E  VTDIE + FSQDGLTLY LSV +G DIYAFYPC
Sbjct: 158 DL-----RKSEKLFLNKTANKLGIETRVTDIEDMEFSQDGLTLYMLSVTDGGDIYAFYPC 212

Query: 199 LPCSIEIDSHKLDLLMHKSLVQYENLSVETPDATKRNTIKQFQFISKLRQGLENDQTK-- 256
           LP  + +    L+ L +KS + Y++L        ++N +KQ +FI+ LR    +D+TK  
Sbjct: 213 LPPKLSLKKSVLEDLFNKSRILYDSLDSTVSIEVRKNVLKQIKFIASLRDS-SSDETKNS 271

Query: 257 -IDIPMDWLRVRGQGPFTIAPFPDRYYDRTAVQLKILPIGANNDLLLMSFDDGTIVVLYQ 315
            ++I  D+ +V+ QGPFT+AP+P++ Y+ TA ++  L IG NN+L  ++FD+GT+ +L +
Sbjct: 272 CLEISNDFRQVKAQGPFTVAPYPEKLYEATAKEIYTLDIGNNNELFAITFDNGTVTLLLK 331

Query: 316 DLELTMCWDSKGYSYNNSLVLVESIRLERGEL-VLKQGTLS-QFFVLGGTSDIYLVDTSP 373
           DLEL+M W++  Y YNNS VL+ES+ +    + +LK  +L+ Q F+    S +  +DT+ 
Sbjct: 332 DLELSMSWNADNYVYNNSFVLIESVEMGPESIKLLKSSSLTGQMFISQNHSSVRKIDTTA 391

Query: 374 WSKILSNCIDNSDLEPIADLQFKSEISKIEGVSQIDSYAMWKKDTEPKDVFVSKDTVFVK 433
           WS  +S CI NSDL  + D+ FKS+IS ++    +D Y +W    E   +FVS  +V  +
Sbjct: 392 WSFKVSKCITNSDLTSLIDVDFKSKISDLDIKENVDCYGVWSLRGERGILFVSNSSVISR 451

Query: 434 STAVNDQPSTVK-DE--KKANVDIP---RYEVALNQPMSEILSLNASFQTEAKKPLSKLV 487
           +   +D    +K DE  +  N++ P   +YEV+  QP+SEI++LN SFQ   + P  K++
Sbjct: 452 TLPESDSSFVIKLDEMSRSKNIEDPVTKKYEVSFTQPISEIMNLNDSFQRICRHPFKKII 511

Query: 488 EPSKRQTKLNNESNEEQLEILTTVSKEFLQKIVKAQALGFNLHNRCLEQQYELTRQLQYS 547
            P +RQT L+N+SNE QL  LT +S + +  IV+ Q+LG  L NR  EQQYELT+QL+ S
Sbjct: 512 SPEERQTVLSNDSNETQLATLTEISNDLVSNIVEGQSLGLVLRNRLYEQQYELTKQLKES 571

Query: 548 SEILSKQDKLRSKAQSQSSECESKIQRQDKLLQRFNSLSEKLGRINESPKFREMNITDKE 607
            +++ KQ  L+S    +       +++QD+L+QRFN+L+  L +I+ES +  +  I++KE
Sbjct: 572 IQLIEKQSLLKSSYDDKMVRWNKNLKKQDELIQRFNALNGNLAKIHESKEISKTPISEKE 631

Query: 608 MAWFKEIRNQVLVFNQYVHHQKNQQDQLRYLQKELENISLEDKDVGEKSK---SEWTELL 664
           + WFKE+RNQ+L FN +VH  +N Q+Q+ +L+K L  I   +  VG++S    SEW E  
Sbjct: 632 VEWFKEVRNQILKFNDFVHVHRNMQEQINFLRKGLSRI---ESKVGQRSSHLTSEWAEFK 688

Query: 665 SILESDTKIIKECNNQLAHASSEV 688
            ILE+DT IIKECN +L  A +++
Sbjct: 689 KILETDTNIIKECNEELTKAHTQL 712

>SAKL0D06930g Chr4 complement(573700..575772) [2073 bp, 690 aa] {ON}
           similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 690

 Score =  441 bits (1135), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 261/703 (37%), Positives = 408/703 (58%), Gaps = 32/703 (4%)

Query: 1   MSIGSHSIFKRASGSSKRF---LCTSQDGSKVVIYQDSSIRWCNAFDSKYEFMLLEPTIE 57
           MS   H IF+  S   + +   L T+QDG +VV+ Q  +IR C++ +S+Y+  ++E  I 
Sbjct: 1   MSAEDHPIFQNISVGKESYPKKLLTTQDGCRVVVIQGDTIRLCSSGNSQYQ--IIECGIN 58

Query: 58  DVEHVVLSPTGTLLLLYNSREVRIVEIPWGYSQVSYEGFQKFRYSVDSRQDPLIKKVLFH 117
            V    L+ +GTLL  YN  E++++ +P  +   S+ G  K      + + P IK+V +H
Sbjct: 59  TVAGAALNNSGTLLCAYNETELQVIVLPSPFVS-SHGGILKPHTYNITVKSP-IKQVQWH 116

Query: 118 PLAYREHCIVILKTDNTIHLLDRYYPYDKQPKLLVLNQHDGAFGMEGLVTDIESITFSQD 177
           P    +   V+L  D+TI + + Y    +QP   VLN      G+   +TDIES+ FS+D
Sbjct: 117 PRGKLDSVPVVLHKDDTIAMYELYNEDFQQPTA-VLNTMQNQLGVTSHITDIESMCFSKD 175

Query: 178 GLTLYALSVAEGCDIYAFYPCLPCSIEIDSHKLDLLMHKSLVQYENLSVETPDATKRNTI 237
           GL LY L+ +EG D+YA YP LP  + I    L++  +KS + YENLS +     KRN I
Sbjct: 176 GLALYLLNSSEGGDVYALYPFLPSVLVIPEQHLEMCFYKSCINYENLSSDDSPTVKRNVI 235

Query: 238 KQFQFISKLRQGLE--------NDQTKIDIPMDWLRVRGQGPFTIAPFPDRYYDRTAVQL 289
           KQ QF+S+L +  +        N     +I   +   + QGPFTI PF ++ Y  TA Q+
Sbjct: 236 KQLQFVSRLHKQYKSETVDKARNGDLVFNIQESYRNAKIQGPFTINPFAEKLYSATATQI 295

Query: 290 KILPIGANNDLLLMSFDDGTIVVLYQDLELTMCWDSKGYSYNNSLVLVESIRLERGELVL 349
             +PI   N+L+L+ FD+GTI+  +QDL+L+MCW+    S NNSLV++ES+ +  G+++ 
Sbjct: 296 TTMPIDEFNELILVYFDNGTILQCFQDLDLSMCWEEIDSSSNNSLVVLESLDILSGQIIC 355

Query: 350 KQGTLSQFFVLGGTSDIYLVDTSPWSKILSNCIDNSDLEPIADLQFKSEISKIEGVSQID 409
              T  +F VLG  S  ++VD+S W+K LS CI+ S+LE ++ +  KS I+ + G     
Sbjct: 356 L--TPHKFAVLGPKS--FVVDSSEWTKALSECINFSNLEVLSQINIKSTITPVNGA--FT 409

Query: 410 SYAMWKKDTEPKDVFVSKDTVFVKSTAVNDQPSTVKDEKKANVDIP----RYEVALNQPM 465
              +W+ + E + +F+S  +V  KS  +  +P+  KD     V  P    +YE   +QP+
Sbjct: 410 QAGLWESNGEKQLIFMSDKSV--KSITL-PEPNKTKDAVSKTVQ-PVTEVKYEPVFSQPI 465

Query: 466 SEILSLNASFQTEAKKPLSKLVEPSKRQTKLNNESNEEQLEILTTVSKEFLQKIVKAQAL 525
            EIL LN  FQ+E  +    ++ P      L N+SNE+QL +LT +SKE   KI++ Q L
Sbjct: 466 GEILLLNKKFQSECSRATQTVIPPHLMDLPLQNDSNEDQLALLTDISKEVFSKIIQGQTL 525

Query: 526 GFNLHNRCLEQQYELTRQLQYSSEILSKQDKLRSKAQSQSSECESKIQRQDKLLQRFNSL 585
           G  +HNR  EQ+YELTRQL+ SSEIL K   L+ +   Q+S  E   ++Q+ +  RF  L
Sbjct: 526 GLLIHNRLFEQRYELTRQLERSSEILHKAKCLQERYPDQNSRWEHVSKKQENIDSRFEKL 585

Query: 586 SEKLGRINESPKFREMNITDKEMAWFKEIRNQVLVFNQYVHHQKNQQDQLRYLQKELENI 645
             +L  I+ S K +++ I+ +EM WFKEI++QV +FN++V  Q++ ++QL ++Q EL+  
Sbjct: 586 QSRLNEISSSGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQQQDVKEQLEFVQSELKTA 645

Query: 646 SLEDKDVGEKSKSEWTELLSILESDTKIIKECNNQLAHASSEV 688
              ++ V ++   +W EL  +L  D++IIKECN  L  A+ E+
Sbjct: 646 G--ERRVSKEDVFDWAELQELLSVDSEIIKECNEGLVEAAKEL 686

>TBLA0F01310 Chr6 complement(329569..331797) [2229 bp, 742 aa] {ON}
           Anc_1.319 YJL061W
          Length = 742

 Score =  430 bits (1105), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 254/716 (35%), Positives = 401/716 (56%), Gaps = 43/716 (6%)

Query: 5   SHSIFKRASGSSK------RFLCTSQDGSKVVIYQDSSIRWCNAFDSKYEFMLLEPTIED 58
           SH IFKR   SS       RF  T+   ++VV+ QD SIRWC  F   Y    +     D
Sbjct: 17  SHPIFKRNYLSSSFQETSPRFFFTTNRDNRVVVVQDGSIRWCYTFSQNYHSYTIASRNFD 76

Query: 59  VEHVVLSPTGTLLLLYNSREVRIVEIPWGYSQV----SYEGFQKFRYSVDSRQDPLIKKV 114
           ++  ++S +G+ +  Y+  ++ I+EIPW +S      S    QK+RYS   +    +K+V
Sbjct: 77  IKDSLISNSGSFVCYYSDTDISIMEIPWSHSNSVNASSSHCIQKYRYSF-KKYSLTVKQV 135

Query: 115 LFHPLAYREHCIVILKTDNTIHLLDRYYPYDKQPKLLVLNQHDGAFGMEGLVTDIESITF 174
           LFHPLA  E C+V+L +D+TI  +D    +D      +LN+   + G+   ++DI+S+TF
Sbjct: 136 LFHPLATLESCLVVLLSDDTIVFIDFSKSFDLLSSDYILNKKSKSIGLSSQISDIQSLTF 195

Query: 175 SQDGLTLYALSVAEGCDIYAFYPCLPCSIEIDSHKLDLLMHKSLVQYENLSVETPDATKR 234
           SQDGLTLYALS +   D+YAFYPCLP S +    +L+ L++KS+VQYE L  + P A K 
Sbjct: 196 SQDGLTLYALSSSAATDVYAFYPCLPPSAQFSLEQLENLVNKSVVQYEELREDDPTALKI 255

Query: 235 NTIKQFQFISKL----RQGLENDQT----KIDIPMDWLRVRGQGPFTIAPFPDRYYDRTA 286
           N IKQ +F S L    ++ LE D      K D+P+++  +R QGPFTI+PFPD  Y  + 
Sbjct: 256 NIIKQLKFTSDLYKKGKRALEEDTDSKTWKYDVPLEYRLIRPQGPFTISPFPDSLYYSSP 315

Query: 287 VQLKILPIGANNDLLLMSFDDGTIVVLYQDLELTMCWDSKGYSYNNSLVLVESIRLERG- 345
             +  +PI   N+LL++SF DG++V L+QDLELTM WD   ++ NNSLVL+E I+ +   
Sbjct: 316 THIVSVPIDTTNELLVLSFSDGSVVSLFQDLELTMSWDQDNFNENNSLVLLELIKTKEQN 375

Query: 346 --ELVLKQGTLSQFFVLGGTSDIYLVDTSPWSKILSNCIDNSDLEPIADLQFKSEISKIE 403
             +L         F++LG   + + V TS WS  L+ CI +SD+  +++L  KS I   +
Sbjct: 376 IRKLTTYAHQYGTFYILGSVKN-FEVLTSHWSSTLAICIKSSDIRDLSNLLIKSVIKPFD 434

Query: 404 GVS-QIDSYAMWKKDTEPKDVFVSKDTVFVKSTAVNDQPSTVKDEKKANV---------- 452
             + ++ S   W   T    +F++K TV      +N++P  +  +   ++          
Sbjct: 435 NAAYELTSGGWWCSPTISSLLFINKSTVI----ELNEKPKLLLSDDTTHLLTSELAQKYI 490

Query: 453 -----DIPRYEVALNQPMSEILSLNASFQTEAKKPLSKLVEPSKRQTKLNNESNEEQLEI 507
                 I + E+ +   +S++ ++N  F+ E+ K L+  +   +R   L N++NE QLE 
Sbjct: 491 PPLEDKIFKIELPMGILISDLNNMNTVFKEESNKQLTIPIPSQERNVTLFNKTNENQLET 550

Query: 508 LTTVSKEFLQKIVKAQALGFNLHNRCLEQQYELTRQLQYSSEILSKQDKLRSKAQSQSSE 567
           LT +SK    KI   Q+LGF ++N+ L+QQ  +  QL+ +  +L K+  L +K   Q+ +
Sbjct: 551 LTKISKVIGIKISMGQSLGFGIYNKILDQQNIVELQLRQTQRLLEKEKILNTKYNEQADK 610

Query: 568 CESKIQRQDKLLQRFNSLSEKLGRINESPKFREMNITDKEMAWFKEIRNQVLVFNQYVHH 627
             +  +RQ+KL+ R   ++EKL + +       ++I+ KE+ +FKEIR QVL+FN++VH 
Sbjct: 611 LRAFTERQEKLMSRLLIMNEKLKKADLDTNLLNISISKKELEFFKEIRKQVLLFNEFVHK 670

Query: 628 QKNQQDQLRYLQKELENISLEDKDVGEKSKSEWTELLSILESDTKIIKECNNQLAH 683
           QK+Q D L +++KEL  I  E+  V E    +W  L  +L  D   I+ C   + +
Sbjct: 671 QKDQHDTLLFIKKELIRIKGENAIVDENDFKQWDRLRDMLHDDATTIETCTESIKN 726

>Kpol_1035.24 s1035 complement(57897..60050) [2154 bp, 717 aa] {ON}
           complement(57897..60050) [2154 nt, 718 aa]
          Length = 717

 Score =  427 bits (1098), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 256/720 (35%), Positives = 415/720 (57%), Gaps = 44/720 (6%)

Query: 1   MSIGSHSIFKRASGS---SKRFLCTSQDGSKVVIYQDSSIRWCNAFDS-KYEFMLLEPTI 56
           MS   + IFKR S S   +KRF  ++ +G++++++QDS+IRW  + D+  Y+ M L  + 
Sbjct: 1   MSFELNPIFKRPSVSRELTKRFFFSANNGTRIILFQDSTIRWSFSSDNDHYQSMALRDSD 60

Query: 57  EDVEHVVLSPTGTLLLLYNSREVRIVEIPWGYSQVS------YEGFQKFRYSVDSRQDPL 110
            DV   ++S  G  L LYNS ++R++EIPWG + V           Q+  Y+ +  +D L
Sbjct: 61  MDVTGAIISDPGDYLCLYNSHQIRVIEIPWGLTNVDEISNSMASSLQERVYNFN--EDKL 118

Query: 111 -IKKVLFHPLAYREHCIVILKTDNTIHLLD--RYYPYDKQPKLLVLNQHD-GAFGMEGLV 166
            +K+VLFHPL+     +V+L + + I  +D    +     P    LN  D    G++  V
Sbjct: 119 SVKQVLFHPLSKSSPFLVVLFSGSQIAFVDLKNVFKSSDIPIDCFLNLTDSNVMGIDNRV 178

Query: 167 TDIESITFSQDGLTLYALSVAEGCDIYAFYPCLPCSIEIDSHKLDLLMHKSLVQYENLSV 226
            +I+ + F+ D L+LY+L+     D+Y FYPCLP    +  +++D L++KS+V YENL +
Sbjct: 179 ENIQYVVFADDCLSLYSLT---DTDVYCFYPCLPPVASLSKNRVDELINKSIVLYENLGI 235

Query: 227 ETPDATKRNTIKQFQFISKLRQGLE-----NDQTKIDIPMD--WLRVRGQGPFTIAPFPD 279
           +  D  ++N IKQ Q  S LR+ +E     N + ++++ +D  + + + QG F+I+P+P+
Sbjct: 236 DADDIVRKNVIKQLQLASSLRKKIEEFENANGEVEVNVEIDLEFRQTKAQGYFSISPYPE 295

Query: 280 RYYDRTAVQLKILPIGANNDLLLMSFDDGTIVVLYQDLELTMCWDSKGYSYNNSLVLVES 339
             Y  T  Q+ +LPIG  N+L L+SFD+GT++V+++D E TM WD   YS+NNS  LVE 
Sbjct: 296 SLYTCTGKQISVLPIGEGNELFLVSFDNGTVLVVFKDKESTMSWDVNDYSFNNSFTLVEI 355

Query: 340 IRLERGEL---VLKQGTLSQFFVLGGTSDIYLVDTSPWSKILSNCIDNSDLEPIADLQFK 396
           I+ +  EL   V+ QG L +F V G  S I LVDT+ WS ++S CI ++DL P+  L+ K
Sbjct: 356 IKFKPEELSNMVVLQGELGKFVVSGEKSTI-LVDTTKWSSVISKCIRDNDLRPLVGLEMK 414

Query: 397 SEISKIEGVSQIDSYAMWKKDTEPKDVFVSKDTV-----FVKSTAVNDQPSTVKDEKKAN 451
           S I+ I    QI+S  +W        + V  + V     F K      + +     +  N
Sbjct: 415 STITHINSDMQINSCGIWNSGEAKSLLLVDTNVVVGYQLFKKEVEFKPESAEEISTELEN 474

Query: 452 VDIPRYEVALNQPMSEILSLNASFQTEAKKPLSKLVEPSKRQTKLNNESNEEQLEILTTV 511
             + ++ V    P +E+ + N  FQ     P SK++  + +Q    + + EEQL+IL  +
Sbjct: 475 FTLDKFTV----PENELKAANYKFQEAVSVPYSKVIPANIKQVPFGSNAMEEQLKILNDI 530

Query: 512 SKEFLQKIVKAQALGFNLHNRCLEQQYELTRQLQYSSEILSKQDKLRSKAQSQSSECESK 571
           S++   KIV+ Q+LG  L++R LEQQ +L+ QL  +++IL +  K++    +Q S+ + K
Sbjct: 531 SRDVGSKIVQGQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQGDYPAQLSKLDEK 590

Query: 572 IQRQDKLLQRFNSLSEKLGRINESPKFREMNITDKEMAWFKEIRNQVLVFNQYVHHQKNQ 631
           +++Q+ L +    +   L  I ES K + + +++KE+  FKE+R+Q+L+FN +VH QK+Q
Sbjct: 591 LKKQEHLEKILLKMESNLNTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFVHKQKDQ 650

Query: 632 QDQLRYLQKELENISLEDKDVGEKSK---SEWTELLSILESDTKIIKECNNQLAHASSEV 688
           +  +++L+KEL+ I   D    E SK   +EW EL  IL  D KIIKECN QL   S E+
Sbjct: 651 KQNIQFLKKELQKII--DISRSESSKGMLNEWEELRQILADDAKIIKECNEQLTQISKEL 708

>KNAG0C05840 Chr3 (1135516..1137759) [2244 bp, 747 aa] {ON}
           Anc_1.319 YJL061W
          Length = 747

 Score =  407 bits (1046), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 256/732 (34%), Positives = 405/732 (55%), Gaps = 60/732 (8%)

Query: 3   IGSHSIFKRASGS----SKRFLCTSQDGSKVVIYQDSS---IRWCNAFDSKYEFMLLEPT 55
           +G   I +  +G     S R++ T+  G+K V Y D +   +RW +  + +Y  M L+ +
Sbjct: 20  MGQRPILQPTAGLPSDLSSRYVFTTDKGTKYV-YLDKTNGLLRWGSVSEDEYNSMPLKIS 78

Query: 56  --IEDVEHVVLSPTGTLLLLYNSREVRIVEIPWGY---SQVSYEGFQKFRYSVDSRQDPL 110
              +   +V+LS +G  L +Y+   V ++E+PW Y    ++SY     F+   + R+D  
Sbjct: 79  NFADKSVNVILSDSGEFLCVYSKDCVTVIEVPWRYRNPEEMSYVFQTSFK---EIRKDSF 135

Query: 111 IKKVLFHPLAYREHCIVILKTDNTIHLLDRYYPYDKQPKLLVLNQHDGAFGMEGLVTDIE 170
           IKKVLFHP A ++ C+VIL  D+TI+L D      +    + LN   G  G+E  +T I 
Sbjct: 136 IKKVLFHPRAIKKTCMVILFEDDTIYLFDV-----EDNNKIALNVPSGNIGIEDRITSIA 190

Query: 171 SITFSQDGLTLYALSVAEGCDIYAFYPCLPCSIEIDSHKLDLLMHKSLVQYENLSVETPD 230
            I FSQDGLTLY LS  +  D+YA YPCLP  + +   +L  LM++S++ Y++L+  TP 
Sbjct: 191 DIEFSQDGLTLYVLSAEDCGDVYAIYPCLPPILAMSQKELKSLMNRSVLLYDSLTETTPS 250

Query: 231 ATKRNTIKQFQFISKLR---QGLENDQTKIDIPMDWLRVRGQGPFTIAPFPDRYYDRTAV 287
           A K+  IKQ +FIS+L+    G E     ++I   +   + QGPFTIAPFP++ Y  TA 
Sbjct: 251 AVKKGVIKQVEFISQLQNISHGKEEISNVLEIDTIYRLAKPQGPFTIAPFPEKLYSATAT 310

Query: 288 QLKILPIGANNDLLLMSFDDGTIVVLYQDLELTMCWDSKGYSYNNSLVLVESIRLERGEL 347
           ++  L IG  N++L +++D+GT + L++DLEL+M WD  G  YNNSLVL+E   L+    
Sbjct: 311 EICPLNIGGGNEILCIAYDNGTALFLFKDLELSMAWDVGGIYYNNSLVLMEEFDLQTESA 370

Query: 348 V-------------------LKQGTLSQFFVLGG------TSDIYLVDTSPWSKILSNCI 382
           V                   ++   +S+ F+  G      +S I  VDT  WS ++S+CI
Sbjct: 371 VSILKSFKMDGLILFKVSDSVQHIDVSKSFIQDGDLLVQQSSMIRCVDTKAWSSVVSDCI 430

Query: 383 DNSDLEPIADLQFKSE--ISKIEGVSQIDSYAMWKKDTEPKDVFVSKDTVFVK--STAVN 438
           D  D+  +  + FKS+     I G S I S   W         +++  +V  K     V+
Sbjct: 431 DRHDINALITVSFKSKGHTWAIAG-SDITSCGAWNHGGTEGVTWITNKSVTCKELKKQVS 489

Query: 439 DQP--STVKDEKKANVDIPRYEVALNQPMSEILSLNASFQTEAKKPLSKLVEPSKRQTKL 496
            +P  ST  ++KK     P + V    P+SE+ +LN ++Q   +     ++ P  RQ  L
Sbjct: 490 WKPEQSTSSEKKKQAFPKPEFSV----PISELNALNINYQDTCRIGFHDIISPLDRQKPL 545

Query: 497 NNESNEEQLEILTTVSKEFLQKIVKAQALGFNLHNRCLEQQYELTRQLQYSSEILSKQDK 556
            N SNE+QL+++T++S   L  + K Q LG  L+NR LEQQ ELT+QLQ S++IL KQ  
Sbjct: 546 LNPSNEKQLQVMTSLSNYLLATVGKGQGLGMTLYNRLLEQQLELTKQLQCSNKILMKQPA 605

Query: 557 LRSKAQSQSSECESKIQRQDKLLQRFNSLSEKLGRINESPKFREMNITDKEMAWFKEIRN 616
           +  K + Q S    K+ +Q+KL +RF+SL +KL  I+++ K  ++ ITD+E  WFKE++ 
Sbjct: 606 IAKKLEEQKSVWNEKLAKQNKLKERFSSLQQKLAAIDKTKKSTDLVITDEESVWFKEVKK 665

Query: 617 QVLVFNQYVHHQKNQQDQLRYLQKELENISLEDKDVGEKSKSEWTELLSILESDTKIIKE 676
           + L FN  V+ Q++ QD LR+L++EL     + + +   + +EW  L  +L+ D+ +++ 
Sbjct: 666 EALTFNDLVYKQESVQDDLRFLKRELSTFVSDSQRLPGTANTEWHSLQEMLKHDSLLLRA 725

Query: 677 CNNQLAHASSEV 688
                  ASS+V
Sbjct: 726 DKKDKKDASSQV 737

>TPHA0O01460 Chr15 complement(293395..295560) [2166 bp, 721 aa] {ON}
           Anc_1.319 YJL061W
          Length = 721

 Score =  375 bits (963), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 231/716 (32%), Positives = 384/716 (53%), Gaps = 38/716 (5%)

Query: 6   HSIFKRASG---SSKRFLCTSQDGSKVVIYQDSSIRW--CNAFDSKYEFMLLEPTIEDVE 60
           H+IF R S    SSKR   T  +G K+++YQ++++R+   N  D  ++ + LE  +    
Sbjct: 7   HTIFNRFSVGKVSSKRSSITVDNGLKIILYQNNTVRYGFVNDADGNFKSITLEKEMIGDV 66

Query: 61  HVVLSPTGTLLLLYNSREVRIVEIPWGYSQVSYEGFQKFRYSVDSRQDPL------IKKV 114
            ++    G  L L+N  E+R++E+PW       +   +    V  R   L      I+K+
Sbjct: 67  SIIADQIGNYLCLFNEFEIRVIELPWKLWDAKEDSSFQLDNMVQIRSYDLKSFGTTIQKI 126

Query: 115 LFHPLAYREHCIVILKTDNTIHLLD--RYYPYDKQPKLLVLNQH-DGAFGMEGLVTDIES 171
           LFHPL     C+V+L  ++ I  +D  R    ++ P   +   H  G  G+   + DI  
Sbjct: 127 LFHPLGLAYPCLVVLLKNSNICSIDIKRILKVEEIPSTCITTFHTKGVMGLSSCIDDIID 186

Query: 172 ITFSQDGLTLYALSVAEGCDIYAFYPCLPCSIEIDSHKLDLLMHKSLVQYENLSVETPDA 231
           I+FS D L+LYAL+     DIY FYP L  +I +  +++D L  KS++ +ENL  ++ +A
Sbjct: 187 ISFSSDKLSLYALT---ETDIYLFYPFLIPTISVTKNEIDQLFQKSIILFENLENDSSEA 243

Query: 232 TKRNTIKQFQFISKL--------RQGLENDQTKI---DIPMDWLRVRGQGPFTIAPFPDR 280
            +RN IKQ Q +S L        +Q    D+TKI   DI  ++  V  QG F+IAPFP+ 
Sbjct: 244 VRRNIIKQLQLLSTLSGDIKTQMKQVKNTDETKIYNIDINTEYRSVNAQGSFSIAPFPEE 303

Query: 281 YYDRTAVQLKILPIGANNDLLLMSFDDGTIVVLYQDLELTMCWDSKGYSYNNSLVLVESI 340
            Y ++AV L ++ IG  N+L ++++DDGT+++LY+DLE +M WDS  Y++NNS +L+E +
Sbjct: 304 LYKQSAVNLSVIQIGHGNELYVITYDDGTVLILYRDLESSMSWDSNDYTFNNSFILLEKL 363

Query: 341 RLERGEL--VLKQGTLSQFFVLGGTSDIYLVDTSPWSKILSNCIDNSDLEPIADLQFKSE 398
           +    E   +L     +  F + G   + L+DTS WS ILS CI ++D+  +A L  +S 
Sbjct: 364 KFNPDETKSILDIPFKNGIFAIAGDQTVNLIDTSCWSDILSQCIKDNDIRNLAGLSIESH 423

Query: 399 ISKIEGVSQIDSYAMWKKDTEPKDVFVSKDTVFVKSTAVNDQPSTVKDEKKANVDIPRYE 458
              I  + + +S  +W +  + + +F+++  +       ++  S  K    A  DI + E
Sbjct: 424 KQTINTLEEPNSCILWNEHNKKELLFITETKLISSDILESNNESAEKLPVPAINDIKKIE 483

Query: 459 VA----LNQPMSEILSLNASFQTEAKKPLSKLVEPSKRQTKLNNESNEEQLEILTTVSKE 514
                  +QP+ EI      ++   K P SK++  + RQ    N+ NE+QL  +T +S+E
Sbjct: 484 KLQLKNYSQPIKEINIAVQRYKDSCKVPYSKVIPANIRQKPFANDENEDQLAYITEISQE 543

Query: 515 FLQKIVKAQALGFNLHNRCLEQQYELTRQLQYSSEILSKQDKLRSKAQSQSSECESKIQR 574
              KI++ Q +   +H R  EQQ     QL ++++ L     ++     QS++ +   +R
Sbjct: 544 IGSKILQGQTIALMMHTRLREQQDVFAEQLMHTNKELLHNKTIKQTYDIQSTKIKHITER 603

Query: 575 QDKLLQRFNSLSEKLGRINESPKFREMNITDKEMAWFKEIRNQVLVFNQYVHHQKNQQDQ 634
             KL +R + L E + +I +S +++ M I D E   FKEI+ QVL+FN  V+ Q+ QQ+ 
Sbjct: 604 NTKLNERTSKLIEMMEKIKQSQQYKNMPINDSESKLFKEIKKQVLIFNDAVNRQQEQQEA 663

Query: 635 LRYLQKELENI----SLEDKDVGEKSKSEWTELLSILESDTKIIKECNNQLAHASS 686
           +++LQ EL NI    +     + +  + EW EL  +L  D KII++CN +L+ AS 
Sbjct: 664 IKFLQTELNNIIEQPAQSHDAIIDSDEDEWNELCDLLNRDAKIIEDCNAELSSASG 719

>Kwal_14.2580 s14 complement(821497..823560) [2064 bp, 687 aa] {ON}
           YJL061W (NUP82) - 82-kDa protein, with putative
           coiled-coil domain, has carboxy-terminal domain,
           containing heptad repeats, that binds Nsp1p; nucleoporin
           [contig 224] FULL
          Length = 687

 Score =  367 bits (942), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 232/699 (33%), Positives = 373/699 (53%), Gaps = 33/699 (4%)

Query: 5   SHSIF---KRASGSSKRFLCTSQDGSKVVIYQDSSIRWCNAFDSKYEFMLLEPTIEDVEH 61
           SH IF     +SG S+RF+      SK  + Q +++RWC+A   +Y+++  EP I D   
Sbjct: 5   SHPIFDTKTNSSGKSRRFVFNIGIASKYGVLQGNTLRWCSAGGHEYQYLEFEPRI-DYTS 63

Query: 62  VVLSPTGTLLLLYNSREVRIVEIPWGYSQVSYEGFQKFRYSVDSRQDPLIKKVLFHPLAY 121
           VV++ +G+LL LYNS++V+I+ + W  S+           ++       IK+ L+HP   
Sbjct: 64  VVINESGSLLCLYNSKQVQILAVSWDESKSD---------TILISPPAGIKQALWHPRGR 114

Query: 122 REHCIVILKTDNTIHLLDRYYPYDKQPKLLVLNQHDGAFGMEGLVTDIESITFSQDGLTL 181
              C+ +L T + I L +       +P   +LN      GM  +V DI S++FS DGLTL
Sbjct: 115 LGSCLAVLTTQDEICLYELLTEDYTEPTT-ILNTCTKELGMGSVVKDITSMSFSSDGLTL 173

Query: 182 YALSVAEGCDIYAFYPCLPCSIEIDSHKLDLLMHKSLVQYENLSVETPDATKRNTIKQFQ 241
           Y LS +EG DIY+ YPCLP  +EI    L  + +K+L+QY++L+       +R   KQ Q
Sbjct: 174 YLLSTSEGADIYSIYPCLPSEMEISGALLKSVFNKALLQYQDLNDNDSPDLRRKVTKQLQ 233

Query: 242 FISKLRQGLENDQTK---IDIPMDWLRVRGQGPFTIAPFPDRYYDRTAVQLKILPI-GAN 297
           F+SKL++  +   T+   + I       R QGPFTI PFPD  Y  T  Q++++ + G  
Sbjct: 234 FVSKLQKKNDYKDTESHVVTISKAHRSPRAQGPFTINPFPDNLYLATGRQVEVIKLQGCA 293

Query: 298 NDLLLMSFDDGTIVVLYQDLELTMCWDSKGYSYNNSLVLVESIRLERGELVLKQGTLSQF 357
            +LLL+SFDDGTI+  + D E  M W+ +G+  NNSL+++ S+ +  GE+ L  G     
Sbjct: 294 AELLLISFDDGTILECFPDREPVMSWEDEGFCENNSLIVLGSVNI-GGEIALVNGYT--- 349

Query: 358 FVLGGTSDIYLVDTSPWSKILSNCIDNSDLEPIADLQFKSEISKIEGVSQIDSYAMWKKD 417
           FV+  ++ +  V     ++++ + +++ D+    +     E+  +E   +  S  +    
Sbjct: 350 FVVLSSAKVTFVSLRKLAQVIESSLNDCDISYFDEADLSEEV--VEKNGRFCSAIICASS 407

Query: 418 TEPKDVFVSKDTV-FVKSTAVNDQPSTVKDEKKANVDIPRYEVALNQPMSEILSLNASFQ 476
            +     +S+ T   +      D P        A  D+ +Y     QP++E+L+LN   Q
Sbjct: 408 EKSCVALLSETTTSHIDIPFSLDAPKMRTALGTAKTDVEQYR-PYGQPLNEVLALNEKVQ 466

Query: 477 TEAKKPLSKLVEPSKRQTKLNNESNEEQLEILTTVSKEFLQKIVKAQALGFNLHNRCLEQ 536
              KKPL   V PS RQ KLNNESNE+QL +LT++SKE + +I  AQ L  +L+ R   Q
Sbjct: 467 ALLKKPLQTGVSPSLRQAKLNNESNEDQLSLLTSISKEVMTRIASAQTLALSLYLRLSCQ 526

Query: 537 QYELTRQLQYSSEILSKQDKLRSKAQSQSSECESKIQRQDKLLQRFNSLSEKLGRINESP 596
           Q ELT+ L+  S++   Q K+  + + QSS  E+   +   +  R   +S KL +++ S 
Sbjct: 527 QGELTQHLETVSKVEELQSKVLRRLKDQSSRWEAAQAKNKSISSRLEQISSKLKQVSSSG 586

Query: 597 KFREMNITDKEMAWFKEIRNQVLVFNQYVHHQKNQQDQLRYLQKELENISL-------ED 649
           KF+   I++ E+ WFKEIR+QV+ FN+ VH Q++  + L  L+ ELE + +         
Sbjct: 587 KFQSQPISNHELEWFKEIRDQVIRFNRLVHEQQSLGNTLSNLKCELEYVHVESKEGKSGS 646

Query: 650 KDVGEKSKSEWTELLSILESDTKIIKECNNQLAHASSEV 688
                K +  W EL ++L  D +II EC + L   + ++
Sbjct: 647 SSADNKDEVPWDELRALLAKDLRIIGECQDSLQGVAKQL 685

>CAGL0J05214g Chr10 complement(501919..504069) [2151 bp, 716 aa]
           {ON} similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061w NUP82 nuclear pore protein
          Length = 716

 Score =  335 bits (860), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 216/695 (31%), Positives = 360/695 (51%), Gaps = 39/695 (5%)

Query: 12  ASGSSKRFLCTSQDGSKVVIYQD-SSIRWCNAFDSKYEFMLLEPTIED-VEHVVLSPTGT 69
              +++RFL +S DG+K+V   D   +RWC++  + Y+ +  +   E  VE  V S T  
Sbjct: 14  TGNAAQRFLFSSSDGTKIVSIADRGHLRWCHSTSTTYKSLDFDLQFEGKVEGAVSSTTAD 73

Query: 70  LLLLYNSREVRIVEIPWGYSQVSYEGFQKF--RYSVDSRQDPLIKKVLFHPLAYREHCIV 127
            + +YN  E+ ++E+PW YS     G +     YS    ++  IK+VLFHP +Y +  I+
Sbjct: 74  YVCIYNRDELHVLEVPWMYSG-EENGLKHLCHIYSHKFDENHSIKQVLFHPKSYLDSTIL 132

Query: 128 ILKTDNTIHLLDRYYPYDKQPKLLV-LNQHDGAFGMEGLVTDIESITFSQDGLTLYALSV 186
           +L  D++I +++     ++  K ++ LN  + A G+   + DI+ I FSQDGL+L  LS 
Sbjct: 133 VLTNDDSIFMINT--DDNRSDKNMINLNSKNSALGLYDRINDIQKIIFSQDGLSLLILSA 190

Query: 187 AEGCDIYAFYPCLPCSIEIDSHKLDLLMHKSLVQYENLSVETPDATKRNTIKQFQFISKL 246
            EGCDI+  YPCLP   +I  H++D L  KSL+ Y N++V T    KRN +KQ  F+ K+
Sbjct: 191 EEGCDIFTIYPCLPRRWDISLHEVDTLFAKSLLLYNNMNVNTTPQEKRNIVKQLNFMEKI 250

Query: 247 R---QGLENDQTKIDIPMDWLRVRGQGPFTIAPFPDRYYDRTAVQLKILPIGANNDLLLM 303
           R       ND+  + +   +L  + QGPF++ P+P+  YD  A  + I+ I  N  LL +
Sbjct: 251 RGQKTAFRNDKKPLILEDAYLNAQPQGPFSMTPYPNELYDFMATDINIIQITQNISLLAI 310

Query: 304 SFDDGTIVVLYQDLELTMCWDSKGYSYNNSLVLVESIRLE---RGELVLKQGTLSQFFVL 360
           +F +GT+++   DLE  M WD   +  +NSL L+E I+LE     + +   GT  +F V 
Sbjct: 311 AFSNGTVLLFLSDLEPIMSWDISRFPGSNSLALLEQIKLEITDNAKFLSIPGTYGKFVVT 370

Query: 361 GGTSDIYLVDTSPWSKILSNCIDNSDLEPIADLQFKSEISKIEGVSQ-IDSYAMWKKDTE 419
                 + V+T  WS IL+  ID+SD++ +A+L+ KS I  ++ ++    S   WK +  
Sbjct: 371 DNVKSNFFVNTCDWSTILAQIIDDSDIKLLANLKVKSNIENLQQLATTFKSIIYWKNENI 430

Query: 420 PKDVFVSKDTV-------FVKSTAVNDQPSTVKDEKKANVDIPR-----YEVALNQPMSE 467
             +  +S   +        + ST  +        + ++ +D+P      YEV   +P++E
Sbjct: 431 SCNYIISDKKIEELDMLDGISSTTKHKLIDQSNSQVESKLDLPELKNGLYEVKFARPLTE 490

Query: 468 ILSL------NASFQTEAKKPLSKLVEPSKRQTKLNNESNEEQLEILTTVSKEFLQKIVK 521
           I         N   Q   K PL        R   L N SNE QLE LT +S+ +++ I  
Sbjct: 491 IQHYEQIYYKNLQNQNFTKIPLEI------RSAPLKNSSNENQLESLTKISESYMKMISM 544

Query: 522 AQALGFNLHNRCLEQQYELTRQLQYSSEILSKQDKLRSKAQSQSSECESKIQRQDKLLQR 581
           AQ LG+    R ++   E +RQ++ + +I    D      + Q+++ +   ++Q KL++R
Sbjct: 545 AQTLGYIYRKRMIDSIEEFSRQIETTYQINKFWDNFEQIREVQNTKIDKVKEKQQKLMER 604

Query: 582 FNSLSEKLGRINESPKFREMNITDKEMAWFKEIRNQVLVFNQYVHHQKNQQDQLRYLQKE 641
            +SL +K+    E       NI+  E  WF EI+  V+ FN YV        +L +++++
Sbjct: 605 LSSLYDKVEGQKEMGSMNNSNISAAESEWFAEIKRSVIEFNSYVRKASTNHQELEFIKEQ 664

Query: 642 LENISLEDKDVGEKSKSEWTELLSILESDTKIIKE 676
              I+ +  D+  ++  EW +L  +L +D KII E
Sbjct: 665 QAQIANQKPDISSENGKEWNDLQQLLRTDLKIISE 699

>KLTH0H10692g Chr8 complement(921787..923862) [2076 bp, 691 aa] {ON}
           similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 691

 Score =  332 bits (850), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 226/703 (32%), Positives = 370/703 (52%), Gaps = 37/703 (5%)

Query: 5   SHSIFK-RASGSSK--RFLCTSQDGSKVVIYQDSSIRWCNAFDSKYEFMLLEPTIEDVEH 61
           +H IF+ R+ G S+  R    ++D S+ ++ + +S++WC      YE+M L   I +   
Sbjct: 5   AHPIFQARSLGESRSERLCLHTKDLSRTILLEGNSLKWCLMDAPNYEYMELN-AISNYTS 63

Query: 62  VVLSPTGTLLLLYNSREVRIVEIPWGYSQVSYEGFQKFRYSVDSRQDPLIKKVLFHPLAY 121
            VL+ +GTLL L N  E++++ + W  ++      + +R  V +     +K+VL+HP   
Sbjct: 64  AVLNDSGTLLCLNNVDEIQVLALSWDQTRP-----ESYRIKVPAG----VKQVLWHPRGR 114

Query: 122 REHCIVILKTDNTIHLLDRYYPYDKQPKLLVLNQHDGAFGMEGLVTDIESITFSQDGLTL 181
            + C+ +L   + I LL      D      VLN      GM   V DIES+ FS DGLTL
Sbjct: 115 LDSCLTVLNKRDEI-LLYELLSEDFSAPTTVLNASTNELGMGSSVKDIESVCFSADGLTL 173

Query: 182 YALSVAEGCDIYAFYPCLPCSIEIDSHKLDLLMHKSLVQYENLSVETPDATKRNTIKQFQ 241
           Y +SV+EG D+++ YPC+P  + I    L    +K+L+QY+ LS       K    +Q  
Sbjct: 174 YLMSVSEGADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSEGDSPELKLKATRQLH 233

Query: 242 FISKL---RQGLENDQTKI----DIPMDWLRVRGQGPFTIAPFPDRYYDRTAVQLKILPI 294
           F+S L       ++ QT +     I   +   R QGPFTI+PFP++ Y  TA Q+K + +
Sbjct: 234 FMSSLYNQPHDADDSQTNLLQTFHIRKAYRNARAQGPFTISPFPEKLYLATAKQIKAIAL 293

Query: 295 -GANNDLLLMSFDDGTIVVLYQDLELTMCWDSKGYSYNNSLVLVESIRLERGELVLKQGT 353
                +LLL++FDD TI+  + DL   M W+  G S  NSL+ V S++L  G + L  G+
Sbjct: 294 EDETTELLLITFDDDTILECFPDLTPVMSWEDSGSSEKNSLISVGSLKLP-GSISLIYGS 352

Query: 354 LSQFFVLGGTSDIYLVDTSPWSKILSNCIDNSDLEPIADLQFKSEISKIEGVSQIDSYAM 413
               FVL       +V+ S  ++ +   +D+ D   +++     EI++ +G  Q  S  +
Sbjct: 353 C---FVLISAEKAAVVNLSRLTRSIERSLDDCDATELSEEDLTEEITEKKGTFQ--SAGL 407

Query: 414 WKKDTEPKDVFVSKDTVFVKSTAVNDQPSTVKDEKKANVDIPRYEVALNQPMSEILSLNA 473
           W +    K V +S+  +     +    P++   EK    +  R +   +QP+SE+ +LN 
Sbjct: 408 WPESGMQKIVLLSEKEITSIDISSMQTPASSTTEKIEKSETNR-QRPYSQPLSEVQTLNQ 466

Query: 474 SFQTEAKKPLSKLVEPSKRQTKLNNESNEEQLEILTTVSKEFLQKIVKAQALGFNLHNRC 533
             Q+  K PLS ++  + RQ  LNN  NE+QL +LT +SKE L ++  AQ LG +LH R 
Sbjct: 467 KVQSLLKSPLSTVIPAALRQKTLNNTDNEDQLSLLTDISKEVLSRVTLAQTLGLSLHLRL 526

Query: 534 LEQQYELTRQLQYSSEILSKQDKLRSKAQSQSSECESKIQRQDKLLQRFNSLSEKLGRIN 593
           L QQ EL + L+  SE+ +K++++ +   SQ    E+  ++   +  RF SL   + +I+
Sbjct: 527 LGQQDELAQHLRDVSELRTKKERVSAHLASQKPRWEAIQEKNKSIALRFESLHRNMTQIS 586

Query: 594 ESPKFREMNITDKEMAWFKEIRNQVLVFNQYVHHQKNQQDQLRYLQKELENISLEDKDVG 653
           +S + +   I   EM WFKE+RNQV+ FN+ VH Q++  + L  L+  LE + ++  +  
Sbjct: 587 KSSQLQSQPIAKAEMEWFKELRNQVVRFNRLVHEQQDLAEALSSLKLSLEYVRVDSAEAA 646

Query: 654 EKSKSE--------WTELLSILESDTKIIKECNNQLAHASSEV 688
            +SK          W EL ++L  D++IIKEC  +L   + E+
Sbjct: 647 SRSKKSAESAGGVPWDELQAMLAKDSRIIKECQAELQCTTQEL 689

>Ecym_6290 Chr6 (543547..545562) [2016 bp, 671 aa] {ON} similar to
           Ashbya gossypii AEL168C
          Length = 671

 Score =  322 bits (826), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 217/699 (31%), Positives = 365/699 (52%), Gaps = 45/699 (6%)

Query: 1   MSIGSHSIFKRASGS--SKRFLCTSQDGSKVVIYQDSSIRWCNAFDSKYEFMLLEPTIED 58
           M+   H IF+       SK  +   ++ +++V   D ++R+    +  ++   L+  I+ 
Sbjct: 1   MTGDPHPIFQVPPFRTLSKLHVHVCKNATQIVTCFDKNLRYARVTEHTFKSKHLD--IKH 58

Query: 59  VEHVVLSPTGTLLLLYNSREVRIVEIPWGYSQVSYEGFQKFRYSVDSRQDPLIKKVLFHP 118
            EH +L+ +GTL+  Y S +V + ++    S +              R +  IK+VL+HP
Sbjct: 59  SEHSILNNSGTLIAFYGSNDVELFDMDGKKSCL--------------RVELGIKQVLWHP 104

Query: 119 LAYREHCIVILKTDNTIHLLDRYYPYDKQPKLLVLNQHDGAFGMEGLVTDIESITFSQDG 178
           LAY + C+V+L  +NTI L +        P + VLN+     G+   V++I S+ FS DG
Sbjct: 105 LAYLDSCLVVLTKENTIELYELAKANFMYPTV-VLNEKLPQLGISSHVSEICSMAFSPDG 163

Query: 179 LTLYALSVAEGCDIYAFYPCLPCSIEIDSHKLDLLMHKSLVQYENLSVETPDATKRNTIK 238
           LTLY LS+ EG D+YA +P LP  + I     +   +K+   YE++  +TP+  K   I+
Sbjct: 164 LTLYLLSLEEGGDVYALHPLLPSRLRIKRSFWESQWYKATALYESIDKDTPNEKKIAMIE 223

Query: 239 QFQFISKLRQGLENDQT--KIDIPMDWLRVRGQGPFTIAPFPDRYYDRTAVQLKILPIGA 296
            F F+SK+ + ++ D     ++IP     V  +GPF+I  FP+  Y+ TA +L  LP+  
Sbjct: 224 HFDFVSKIYKMIDKDSEFFDVNIPEHKRMVTPRGPFSIYGFPEELYNTTATKLITLPVND 283

Query: 297 NND-LLLMSFDDGTIVVLYQDLELTMCWDSKGYSYNNSLVLVESIRLERGELVLKQGTLS 355
               +L++SFDDGTI+ L+ D+EL M W S+  +   S VL+E  R       ++ G   
Sbjct: 284 EGAYVLILSFDDGTILSLFPDIELLMSW-SRSLNNACSFVLIEKFRAGGEIFAIESGV-- 340

Query: 356 QFFVLGGTSDIYLVDTSPWSKILSNCIDNSDLEPIADLQFKSEISKIEGVSQIDSYAMWK 415
               +   ++ ++V   P+ K L  CI   D+ P+ D++  S+I+ + G     SY    
Sbjct: 341 ---AILEKNNAHIV-RFPYLKALGECIKEGDIAPMVDVKLTSDITPLAG-----SYHTVV 391

Query: 416 KDTEPKDVFVSKDTVFVKSTAVNDQPSTVK-DEKKANVDIP-----RYEVALNQPMSEIL 469
              EP     +K  +F+ ++ +   P  V     K  VD       +Y V     M E+L
Sbjct: 392 TWNEPS----TKGILFIGNSVIRSIPDDVGLSSFKPRVDPAISQNGKYTVCFPSTMEELL 447

Query: 470 SLNASFQTEAKKPLSKLVEPSKRQTKLNNESNEEQLEILTTVSKEFLQKIVKAQALGFNL 529
             N + Q   ++PL  LV   ++   LN+E NE QL  LT +S E + +I+ AQ+LG+ +
Sbjct: 448 KTNKALQHTLRQPLP-LVPLEQKNVPLNSEFNEHQLATLTKISTEVMDRIILAQSLGYLM 506

Query: 530 HNRCLEQQYELTRQLQYSSEILSKQDKLRSKAQSQSSECESKIQRQDKLLQRFNSLSEKL 589
           +NR   QQ+EL RQL+  S++  +   L+   +S +   +S  ++   L  R   L + L
Sbjct: 507 YNRAATQQFELCRQLETVSKLNDRSVTLKQNTKSLTCRLDSVSKKDIALRSRLEKLQQSL 566

Query: 590 GRINESPKFREMNITDKEMAWFKEIRNQVLVFNQYVHHQKNQQDQLRYLQKELENISLED 649
            ++NESPKF E+ ++ KE AWF+E++N VL FN+YV       ++L +L+KELE I    
Sbjct: 567 DKVNESPKFNELPLSMKERAWFRELKNDVLAFNEYVLQNSKLCEELNFLKKELELIESNH 626

Query: 650 KDVGEKSKSEWTELLSILESDTKIIKECNNQLAHASSEV 688
            ++  +    + +L  +L  D+K+I +CN+QL  A+ ++
Sbjct: 627 GNIPNEELFNFEKLQDLLTLDSKMIGDCNDQLLAAAKDL 665

>AEL168C Chr5 complement(320121..322142) [2022 bp, 673 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL061W
           (NUP82)
          Length = 673

 Score =  317 bits (812), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 222/701 (31%), Positives = 358/701 (51%), Gaps = 57/701 (8%)

Query: 6   HSIFKR-ASGSSKRFLC-TSQDGSKVVIYQDSSIRWCNAFDSKYEFMLLEPTIEDVEHVV 63
           H IF   A G+S R    T  DG+K+V Y +  +R     +  Y+    E  ++     +
Sbjct: 6   HPIFNADALGASHRLHAHTHGDGTKIVGYYNKHLRLGRFTEQTYKSWHAE--VDAKASSI 63

Query: 64  LSPTGTLLLLYNSREVRIVEIPWGYSQVSYEGFQKFRYSVDSRQDPLIKKVLFHPLAYRE 123
           L+ +G+LL  Y      I+E+      V  EG +K   +V+      IK+VL+HPLAY +
Sbjct: 64  LNGSGSLLAFYGDH---IIEV------VDREG-KKITLTVNGG----IKQVLWHPLAYLD 109

Query: 124 HCIVILKTDNTIHLLDRYYPYDKQPKLLVLNQHDGAFGMEGLVTDIESITFSQDGLTLYA 183
            C+V+L    TI + +   P  ++P L VLN+     G+   V DI +I F+ DGL+LY 
Sbjct: 110 SCLVVLTGQETIEIYELNEPRYEKPTL-VLNEPTSQLGISSRVIDITNIAFAPDGLSLYL 168

Query: 184 LSVAEGCDIYAFYPCLPCSIEIDSHKLDLLMHKSLVQYENLSVETPDATKRNTIKQFQFI 243
            S +EG D++   P LP  I+ D  K     +K+   Y  L+ +TPD  K  TI+  +F+
Sbjct: 169 FSTSEGGDVHVICPLLPSRIKADRAKWARQWNKATALYSTLTKDTPDDAKVATIEYLEFV 228

Query: 244 SKLRQGLENDQT--KIDIPMDWLRVRGQGPFTIAPFPDRYYDRTAVQLKILPIG-ANNDL 300
           ++L Q +E + +  ++ IP    R   QGP+ I  FP++ Y     +L ++P+G +   L
Sbjct: 229 TQLLQAIEKNGSDGELVIPEHRRRTISQGPYNIHGFPEKLYSAVGTKLTVVPLGESEAHL 288

Query: 301 LLMSFDDGTIVVLYQDLELTMCWDSKGYSYNNSLVLVESIRLERGELVLKQGTLSQFFVL 360
           LL+SFDD T ++L+   E+ M W +K      +L+LVE              T + F   
Sbjct: 289 LLLSFDDSTNILLFPSTEVLMSW-TKDLKNAYTLMLVEEF----------TATGTAFATC 337

Query: 361 GGTSDIYLVDTS-----PWSKILSNCIDNSDLEPIADLQFKSEISKIEGVSQIDSYAMWK 415
            G + +  +D++     P+ + L +CI + +L  + D+ F S I KI G  +  S A + 
Sbjct: 338 DGVA-VLGIDSAQRVEIPYLQALEDCIRDCNLAALQDINFTSSICKIPG--KFHSVARFN 394

Query: 416 KDTEPKDVFVSKDTVFVKSTAVNDQPST--VKDEKKANVDI-----PRYEVALNQPMSEI 468
                     +K  + V        PST   K + +  +D      P Y V     + EI
Sbjct: 395 APG-------NKGIILVGDHHAKIVPSTEAAKSDTETELDSQPGKEPTYTVCFPNSLEEI 447

Query: 469 LSLNASFQTEAKKPLSKLVEPSKRQTKLNNESNEEQLEILTTVSKEFLQKIVKAQALGFN 528
           L+ N   Q    +PL  LV P+ +   LN++ NE+ L  LT +SKE + +I+ +Q+ G  
Sbjct: 448 LNTNKELQRRKHQPLP-LVPPALKNIPLNSDLNEQHLATLTNISKEVMDRIILSQSAGLL 506

Query: 529 LHNRCLEQQYELTRQLQYSSEILSKQDKLRSKAQSQSSECESKIQRQDKLLQRFNSLSEK 588
           +HNR   QQYEL RQ++  ++I S+   LR  +++ SS   S ++R  +L QR   L   
Sbjct: 507 MHNRLSLQQYELHRQVETVADICSRHSVLRDSSEAMSSRLTSVLKRDRRLKQRLCMLQST 566

Query: 589 LGRINESPKFREMNITDKEMAWFKEIRNQVLVFNQYVHHQKNQQDQLRYLQKELENI-SL 647
           L RIN S KF ++ ++ KE  WF+E++NQ + FN YV      +D+L +L+ ELE++   
Sbjct: 567 LNRINSSHKFSDLPLSKKEADWFRELKNQAISFNDYVLQSAQLRDELAFLKNELESLPEH 626

Query: 648 EDKDVGEKSKSEWTELLSILESDTKIIKECNNQLAHASSEV 688
              D  E+   ++  L  +L+ D+KII EC + L+ A+ E+
Sbjct: 627 RQHDRQEEEPFDFRRLQELLKLDSKIITECTDNLSAAAREL 667

>KLLA0F01661g Chr6 complement(156609..158672) [2064 bp, 687 aa] {ON}
           weakly similar to uniprot|P40368 Saccharomyces
           cerevisiae YJL061W NUP82 Subunit of the nuclear pore
           complex (NPC) forms a subcomplex with Nup159p and Nsp1p
           interacts with Nup116p and is required for proper
           localization of Nup116p in the NPC
          Length = 687

 Score =  229 bits (585), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 198/716 (27%), Positives = 339/716 (47%), Gaps = 83/716 (11%)

Query: 7   SIFKRAS-GSSKRFLCTSQDGSKVVIYQDSSIRWCNAFDSKYEFMLLE-PTIEDVEHVVL 64
           +IF+  S   S R +C   + + + ++QD+ +R  +  +++Y    +E P +   E +V+
Sbjct: 11  AIFQEVSLNPSDRLVC--NNSNTIYLWQDNILRVQSDHETQYRSYNVELPFVP--EQMVI 66

Query: 65  SPTGTLLLLYNSREVRIVEIPWGYSQVSYEGFQKFRYSVDSRQDPLIKKVLFHPLAYREH 124
           SP+G L+  + + E+ ++E+            ++ R          IKK+L+HPLA    
Sbjct: 67  SPSGGLVAFHANSELYVMEVN-----------EQSRLRKHFNTSLGIKKLLWHPLATYGL 115

Query: 125 CIVILKTDNTIHLLDRYYPYDKQPK-LLVLNQHDGAFGMEGLVTDIESITFSQDGLTLYA 183
             VIL  D+TI + D     D +P+ + V N+   +FG+   V  +  I F   GLTLY 
Sbjct: 116 SFVILHDDSTIRIYDLE---DLEPESITVFNRKSRSFGLSDHVESVCDIAFDPTGLTLYL 172

Query: 184 LSVAEGCDIYAFYPCLPCSIEIDSHKL-------------DLLMHKSLVQYENL------ 224
           LS    CDIYA +PCLP +  + S+               D ++HKSL  Y +L      
Sbjct: 173 LSSFNYCDIYAIHPCLPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSLSLYNSLDKQLKL 232

Query: 225 -SVETPDA------TKRNTIKQFQFISKLRQ--GLENDQTKI---DIPMDWLRVRGQGPF 272
            S   PD        K + +KQ QF    ++  G++   +K     +P        QGPF
Sbjct: 233 ISGSDPDVESDYLTLKHDLLKQIQFFDNYKKNDGIDTFTSKAIRNSVP--------QGPF 284

Query: 273 TIAPFPDRYYDRTAVQLKILPIGANNDLLLMSFDDGTIVVLYQDLELTMCWDSKGYSYNN 332
            I  FP     +    L I+P+G    LL + F DGT VVL+ D E+ M W  +  +  N
Sbjct: 285 IIKKFPTALNAKEVTGLTIIPVGERLGLLNLQFIDGTNVVLFSDSEIVMSWSLRSNTTFN 344

Query: 333 SLVLVESIRLERGELVLKQGTLSQFFVLGGTSDIYLVDTSPWSKILSNCIDNSDLEPIAD 392
           +L ++      +G+  L   +  +    G +S   +    PW + L+ CI   D   I D
Sbjct: 345 NLSVITMFN-AKGQCQLLNSSEPKLVFTGDSSTTIM--EMPWLEPLAQCIRLHDFSIIDD 401

Query: 393 LQFKSEISKIEGVSQIDSYAMWKKDTEPKDVFVSKDTVFVKSTAVNDQPSTVKDEKKANV 452
           ++F+++I  + G        +    T   D+  + ++   K    ND+ +T K   + + 
Sbjct: 402 VKFENKIRTVSGT------FLGVLSTLSGDILYNGNSF--KVIESNDKSTTQKPINRTDE 453

Query: 453 DIPRYEVALNQPMSEILSLNASFQTEAKKPLSKLVEPSKRQTKLNNESNEEQLEILTTVS 512
               Y+ +L     E+  L   ++TEA   +S + + S     L N SNE QLE+++ + 
Sbjct: 454 VKYTYKPSLPTSGKELDMLLTKYKTEANGFISGIPD-SLAPLPLKNNSNERQLEVVSELY 512

Query: 513 KEFLQKIVKAQALGFNLHNRCLEQQYELTRQLQYSSEILSKQDKLRSKAQSQSSECESKI 572
           KE ++++   Q + F + N+  E+  EL RQL+ ++EI    + LR+K      + + + 
Sbjct: 513 KETMKRVKLGQMILFRMFNKSNEEVAELHRQLRKTNEI----EMLRNKLNGNLGDLQERY 568

Query: 573 QRQDK----LLQRFNSLSEKLGRINESPKFREMNITDKEMAWFKEIRNQVLVFNQYVHHQ 628
            R ++    L +R + L E    I  + K R  +I++ E+ WFK I+NQVL FN YVH  
Sbjct: 569 SRYEEKSKTLEKRLDKLKETFSSIENNEKLRTSSISEAELVWFKSIKNQVLKFNNYVHLT 628

Query: 629 KNQQDQLRYLQKELENISLEDKDVGEKSKSEWTELLSILESDTKIIKECNNQLAHA 684
              +++L +L  +L + +  D    E    E++ L  +L +D K+I  C N+L+ +
Sbjct: 629 NKLREELEFLDTQLRSTTKGDDFFSEL---EFSSLQQMLLNDKKVINSCMNELSAS 681

>Kpol_1039.23 s1039 complement(70067..73954) [3888 bp, 1295 aa] {ON}
            complement(70067..73954) [3888 nt, 1296 aa]
          Length = 1295

 Score = 35.8 bits (81), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 44/79 (55%), Gaps = 2/79 (2%)

Query: 568  CESKIQRQDKLLQRFNSLSEKLGR-INESPKFREMNITDKEMAWFKEIRNQVLVFNQYVH 626
            C S+  +QD LL R + L+EK+ + ++E  KF+E   T  E+   KE R + L   Q   
Sbjct: 1110 CASQFSKQDDLLLRVDELTEKIKKNVDEKIKFKEFINTLDEIVNGKEERVRDLTLYQST- 1168

Query: 627  HQKNQQDQLRYLQKELENI 645
             Q N ++++R L +++  I
Sbjct: 1169 VQNNLRNKIRVLSEKINRI 1187

>Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON}
           similar to Ashbya gossypii AFR289W
          Length = 125

 Score = 33.1 bits (74), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 5/81 (6%)

Query: 515 FLQKIVKAQALGFNLHNRCLEQQYELTRQLQYSSEILSKQDKLRSKAQSQSSECESKIQR 574
           FL+K +  ++L     NRCLE  +E  +Q + + E+L     LR     +    +  IQ 
Sbjct: 32  FLKKSLDHRSLTLPSPNRCLEVPFENGKQAEIAREVLHHDPVLR----PEDFRVDYTIQ- 86

Query: 575 QDKLLQRFNSLSEKLGRINES 595
            +KLL  FNS+  +  R+  S
Sbjct: 87  HEKLLVNFNSIDARSLRVGVS 107

>Suva_10.275 Chr10 complement(485732..486391) [660 bp, 219 aa] {ON}
           YLR178C (REAL)
          Length = 219

 Score = 33.9 bits (76), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 16/67 (23%), Positives = 32/67 (47%)

Query: 619 LVFNQYVHHQKNQQDQLRYLQKELENISLEDKDVGEKSKSEWTELLSILESDTKIIKECN 678
             FN+ +     Q D       +L  + + D D   K+  +W+E   ++ESD K++ +  
Sbjct: 65  FTFNKQMQKNTAQADAYVPQDDDLFTLVMTDPDAPSKTDHKWSEFCHLVESDLKLLNKST 124

Query: 679 NQLAHAS 685
           ++ A A+
Sbjct: 125 HESAGAT 131

>NDAI0B01770 Chr2 (422528..423331) [804 bp, 267 aa] {ON} Anc_7.193
           YIL020C
          Length = 267

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 33/65 (50%)

Query: 486 LVEPSKRQTKLNNESNEEQLEILTTVSKEFLQKIVKAQALGFNLHNRCLEQQYELTRQLQ 545
           +V  +K QT  N E NEE  ++L+  S EFL      + L   +    + + YE T+ ++
Sbjct: 150 VVAMNKWQTLTNLELNEEVFKLLSEYSDEFLIHAADVEGLCKGIDEELVTKLYEWTKDIK 209

Query: 546 YSSEI 550
           +S  I
Sbjct: 210 HSESI 214

>Suva_10.177 Chr10 complement(331316..331927,331928..332062) [747
           bp, 248 aa] {ON} YLR093C (REAL)
          Length = 248

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 39/70 (55%), Gaps = 5/70 (7%)

Query: 552 SKQDKLRSKAQSQSSECESKIQRQDKLLQRFNSLSEKLGRINESP-KFREMNITDKEMAW 610
           + +D+++   Q  +   +  ++RQ    +R + L +K  ++N S  KFR   +  KE+ W
Sbjct: 165 ATEDQIKDVIQIMNDNIDKFLERQ----ERVSLLVDKTSQLNSSSNKFRRKAVNIKEIMW 220

Query: 611 FKEIRNQVLV 620
           +++++N  L+
Sbjct: 221 WQKVKNITLL 230

>NDAI0A05250 Chr1 complement(1184620..1185792) [1173 bp, 390 aa]
           {ON} Anc_3.347 YPR057W
          Length = 390

 Score = 31.2 bits (69), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 46/103 (44%), Gaps = 19/103 (18%)

Query: 608 MAWFKEIRNQ----------------VLVFNQYVHHQKNQQDQLRYLQKELENISLEDKD 651
           + WFK  RN                 V  F +Y+  + +Q D +++L + L++  +E++D
Sbjct: 132 IEWFKTARNSLIQNGYRYDDTTLNLLVYYFKKYLEERNDQDDYVKHLAEVLQHHFVENED 191

Query: 652 VGEKSKSEWTE--LLSILESDTKIIKECNNQLAHASSE-VGFS 691
                 +EW E  L  I E + + I +    ++  S E  GFS
Sbjct: 192 DSLIIDNEWAERTLAKIREGEVRTIDDIKKFISGNSYEPYGFS 234

>Smik_14.39 Chr14 (67153..68364) [1212 bp, 403 aa] {ON} YNL292W
           (REAL)
          Length = 403

 Score = 31.2 bits (69), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 49/116 (42%), Gaps = 15/116 (12%)

Query: 327 GYSYNNSLVLVESIRLERGELVLKQGTLSQFFVLGGTSDIYLVDTSPWSKILSNCIDNSD 386
           G S  +S  +V+ IRL++ +  L++  + Q       +D    D   W K+L   +D   
Sbjct: 293 GKSMRSSCYMVKLIRLQQQDWSLERNNVFQL------ADFTERDEKVWGKVLKKVLDEG- 345

Query: 387 LEPIADLQFKSEISKIEGVSQIDSYAMWKKDTEPKDVFVSKDTVFVKSTAVNDQPS 442
               A +    E+ K E     D     K+ T P D F S+     K TA  +QPS
Sbjct: 346 ----ASVDVIEELKKAEKEVPAD----VKEGTVPNDQFESETITETKETADVEQPS 393

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 73,521,337
Number of extensions: 3358442
Number of successful extensions: 15891
Number of sequences better than 10.0: 459
Number of HSP's gapped: 16257
Number of HSP's successfully gapped: 583
Length of query: 692
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 575
Effective length of database: 40,065,477
Effective search space: 23037649275
Effective search space used: 23037649275
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)