Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0G18150g1.195ON53053027420.0
TDEL0C035801.195ON53053021380.0
KLLA0D16412g1.195ON52952920970.0
SAKL0F00396g1.195ON52753119430.0
YJL153C (INO1)1.195ON53352419230.0
Smik_10.811.195ON53352419220.0
TBLA0C020701.195ON53653419000.0
CAGL0I06050g1.195ON53853818970.0
Skud_10.631.195ON53352618930.0
TPHA0A028801.195ON54053418850.0
Suva_6.2311.195ON54353618780.0
KAFR0F018601.195ON54252517370.0
Kpol_2001.171.195ON47147117280.0
NCAS0I027501.195ON58352417350.0
KNAG0C025201.195ON59251217190.0
NDAI0B001201.195ON56753416970.0
KLLA0F21846g5.278ON37638696.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0G18150g
         (530 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0G18150g Chr7 (1494235..1495827) [1593 bp, 530 aa] {ON} high...  1060   0.0  
TDEL0C03580 Chr3 (627672..629264) [1593 bp, 530 aa] {ON} Anc_1.1...   828   0.0  
KLLA0D16412g Chr4 complement(1382063..1383652) [1590 bp, 529 aa]...   812   0.0  
SAKL0F00396g Chr6 (31629..33212) [1584 bp, 527 aa] {ON} highly s...   753   0.0  
YJL153C Chr10 complement(134332..135933) [1602 bp, 533 aa] {ON} ...   745   0.0  
Smik_10.81 Chr10 complement(132183..133784) [1602 bp, 533 aa] {O...   744   0.0  
TBLA0C02070 Chr3 (490480..492090) [1611 bp, 536 aa] {ON} Anc_1.1...   736   0.0  
CAGL0I06050g Chr9 (575188..576804) [1617 bp, 538 aa] {ON} highly...   735   0.0  
Skud_10.63 Chr10 complement(109499..111100) [1602 bp, 533 aa] {O...   733   0.0  
TPHA0A02880 Chr1 complement(624919..626541) [1623 bp, 540 aa] {O...   730   0.0  
Suva_6.231 Chr6 (414131..415762) [1632 bp, 543 aa] {ON} YJL153C ...   728   0.0  
KAFR0F01860 Chr6 complement(365737..367365) [1629 bp, 542 aa] {O...   673   0.0  
Kpol_2001.17 s2001 (48908..50323) [1416 bp, 471 aa] {ON} (48908....   670   0.0  
NCAS0I02750 Chr9 (510393..512144) [1752 bp, 583 aa] {ON} Anc_1.1...   672   0.0  
KNAG0C02520 Chr3 complement(492578..494356) [1779 bp, 592 aa] {O...   666   0.0  
NDAI0B00120 Chr2 (3784..5487) [1704 bp, 567 aa] {ON} Anc_1.195 Y...   658   0.0  
KLLA0F21846g Chr6 complement(2033135..2034265) [1131 bp, 376 aa]...    31   6.9  

>ZYRO0G18150g Chr7 (1494235..1495827) [1593 bp, 530 aa] {ON} highly
           similar to gnl|GLV|KLLA0D16412g Kluyveromyces lactis
           KLLA0D16412g and similar to YJL153C uniprot|P11986
           Saccharomyces cerevisiae YJL153C INO1 Inositol 1-
           phosphate synthase involved in synthesis of inositol
           phosphates and inositol-containing phospholipids
           transcription is coregulated with other phospholipid
           biosynthetic genes by Ino2p and Ino4p which bind the
           UASINO DNA element
          Length = 530

 Score = 1060 bits (2742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/530 (96%), Positives = 513/530 (96%)

Query: 1   MTAANYFTPSVKVATDKVHYSETELTTKYTYVNSIVTENAATNTVDVNPIKQEYDFKVDL 60
           MTAANYFTPSVKVATDKVHYSETELTTKYTYVNSIVTENAATNTVDVNPIKQEYDFKVDL
Sbjct: 1   MTAANYFTPSVKVATDKVHYSETELTTKYTYVNSIVTENAATNTVDVNPIKQEYDFKVDL 60

Query: 61  KLPRVGVMLVGIGGNNGTTFLASILANRQKMKFHNKEGLKEANYYGSVTQCSTLKLGVRP 120
           KLPRVGVMLVGIGGNNGTTFLASILANRQKMKFHNKEGLKEANYYGSVTQCSTLKLGVRP
Sbjct: 61  KLPRVGVMLVGIGGNNGTTFLASILANRQKMKFHNKEGLKEANYYGSVTQCSTLKLGVRP 120

Query: 121 DGNDFYVPFNSLLPFVSPNDFEVTGWDISATNLGDAMERAQVLEYDLQRQLKPEMSEYKP 180
           DGNDFYVPFNSLLPFVSPNDFEVTGWDISATNLGDAMERAQVLEYDLQRQLKPEMSEYKP
Sbjct: 121 DGNDFYVPFNSLLPFVSPNDFEVTGWDISATNLGDAMERAQVLEYDLQRQLKPEMSEYKP 180

Query: 181 LPSIYYPDFIAANQDGRADNCINRPNNAGPASTKNKWEHLERIRADIREFKQQKDLDKVI 240
           LPSIYYPDFIAANQDGRADNCINRPNNAGPASTKNKWEHLERIRADIREFKQQKDLDKVI
Sbjct: 181 LPSIYYPDFIAANQDGRADNCINRPNNAGPASTKNKWEHLERIRADIREFKQQKDLDKVI 240

Query: 241 VLWTANTERYADIIPGVNDTADNLLNAIKQDGEEIAPSTIFAVASILEGSVYINGSPQNT 300
           VLWTANTERYADIIPGVNDTADNLLNAIKQDGEEIAPSTIFAVASILEGSVYINGSPQNT
Sbjct: 241 VLWTANTERYADIIPGVNDTADNLLNAIKQDGEEIAPSTIFAVASILEGSVYINGSPQNT 300

Query: 301 FVPGVIELAEREDSFIAGDDFKSGQTKIKSVLAQFLVEAGIKPTSIASYNHLGNNDGYNL 360
           FVPGVIELAEREDSFIAGDDFKSGQTKIKSVLAQFLVEAGIKPTSIASYNHLGNNDGYNL
Sbjct: 301 FVPGVIELAEREDSFIAGDDFKSGQTKIKSVLAQFLVEAGIKPTSIASYNHLGNNDGYNL 360

Query: 361 SSERQFXXXXXXXXXXXXXXXXXNPLLYNDKLGNKIDHCIVIKYMNAVGDSKVAMDEYYS 420
           SSERQF                 NPLLYNDKLGNKIDHCIVIKYMNAVGDSKVAMDEYYS
Sbjct: 361 SSERQFKSKEISKKSVVDDVVASNPLLYNDKLGNKIDHCIVIKYMNAVGDSKVAMDEYYS 420

Query: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMAEFCTRVSYKRVGDGSTEYGKFYNILSF 480
           ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMAEFCTRVSYKRVGDGSTEYGKFYNILSF
Sbjct: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMAEFCTRVSYKRVGDGSTEYGKFYNILSF 480

Query: 481 LSYWLKAPLTRKGYQAINGLNKQRSGLENFMRLLIGLPAQDELRFEERLK 530
           LSYWLKAPLTRKGYQAINGLNKQRSGLENFMRLLIGLPAQDELRFEERLK
Sbjct: 481 LSYWLKAPLTRKGYQAINGLNKQRSGLENFMRLLIGLPAQDELRFEERLK 530

>TDEL0C03580 Chr3 (627672..629264) [1593 bp, 530 aa] {ON} Anc_1.195
           YJL153C
          Length = 530

 Score =  828 bits (2138), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/530 (73%), Positives = 445/530 (83%)

Query: 1   MTAANYFTPSVKVATDKVHYSETELTTKYTYVNSIVTENAATNTVDVNPIKQEYDFKVDL 60
           MT   YF+P++ VA DK HYSET+LTT+Y YVNS+V ++    T++V P  Q+Y+F+VDL
Sbjct: 1   MTVQRYFSPTINVANDKTHYSETKLTTQYRYVNSVVAKSEVDGTLEVRPTAQDYEFQVDL 60

Query: 61  KLPRVGVMLVGIGGNNGTTFLASILANRQKMKFHNKEGLKEANYYGSVTQCSTLKLGVRP 120
           K+P++GVMLVG+GGNNGTT +AS+LANR K++FH K+G KEANYYGSVTQ ST+KLG+  
Sbjct: 61  KIPKIGVMLVGLGGNNGTTLVASVLANRDKIRFHTKDGAKEANYYGSVTQSSTIKLGIDE 120

Query: 121 DGNDFYVPFNSLLPFVSPNDFEVTGWDISATNLGDAMERAQVLEYDLQRQLKPEMSEYKP 180
            GND YVPFNS+LPFVSPNDF V GWDI+  NLGDAM R+QVLEYDLQ+QL+ EM++  P
Sbjct: 121 QGNDVYVPFNSVLPFVSPNDFVVGGWDINGANLGDAMARSQVLEYDLQQQLRGEMAKTVP 180

Query: 181 LPSIYYPDFIAANQDGRADNCINRPNNAGPASTKNKWEHLERIRADIREFKQQKDLDKVI 240
           LPSIYYPDFIAANQD RADNCINR   +G  STK KW H+E+IR DI+ FK   DLDKVI
Sbjct: 181 LPSIYYPDFIAANQDERADNCINRDGKSGNVSTKGKWSHVEQIRKDIKNFKSGNDLDKVI 240

Query: 241 VLWTANTERYADIIPGVNDTADNLLNAIKQDGEEIAPSTIFAVASILEGSVYINGSPQNT 300
           VLWTANTERYAD++  VND ADNLL AIK D EEIAPSTIFAVASILEG  YINGSPQNT
Sbjct: 241 VLWTANTERYADVLSNVNDNADNLLAAIKNDHEEIAPSTIFAVASILEGVPYINGSPQNT 300

Query: 301 FVPGVIELAEREDSFIAGDDFKSGQTKIKSVLAQFLVEAGIKPTSIASYNHLGNNDGYNL 360
           FVPGVI+LAE+ ++ IAGDDFKSGQTKIKSVLAQFLV+AGIKP SIASYNHLGNNDG+NL
Sbjct: 301 FVPGVIDLAEKHNALIAGDDFKSGQTKIKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNL 360

Query: 361 SSERQFXXXXXXXXXXXXXXXXXNPLLYNDKLGNKIDHCIVIKYMNAVGDSKVAMDEYYS 420
           +SERQF                 N +LYN+K GNKIDHCIVIKYMNAVGDSKVAMDEYYS
Sbjct: 361 TSERQFKSKEISKRSVVDDVIASNKILYNEKAGNKIDHCIVIKYMNAVGDSKVAMDEYYS 420

Query: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMAEFCTRVSYKRVGDGSTEYGKFYNILSF 480
           ELMLGGHNRISIHNVCEDSLLATPLIIDL+VMAEFC+RVSYK++G     Y  FY+ILSF
Sbjct: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLIVMAEFCSRVSYKKLGSDQQSYESFYSILSF 480

Query: 481 LSYWLKAPLTRKGYQAINGLNKQRSGLENFMRLLIGLPAQDELRFEERLK 530
           LSYWLKAPLTRKG++ INGLNKQR G+ENF+RLLIGLPA DELRFEE+LK
Sbjct: 481 LSYWLKAPLTRKGFKTINGLNKQRQGIENFLRLLIGLPALDELRFEEKLK 530

>KLLA0D16412g Chr4 complement(1382063..1383652) [1590 bp, 529 aa]
           {ON} highly similar to uniprot|P11986 Saccharomyces
           cerevisiae YJL153C INO1 Inositol 1-phosphate synthase
           involved in synthesis of inositol phosphates and
           inositol- containing phospholipids transcription is
           coregulated with other phospholipid biosynthetic genes
           by Ino2p and Ino4p which bind the UASINO DNA element
          Length = 529

 Score =  812 bits (2097), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/529 (73%), Positives = 440/529 (83%), Gaps = 1/529 (0%)

Query: 1   MTAANYFTPSVKVATDKVHYSETELTTKYTYVNSIVTENAATNTVDVNPIKQEYDFKVDL 60
           MTA   F P+VKVATD   +SETELTTKYTY N+IV E +A    +V P+ Q+Y+FKVDL
Sbjct: 1   MTAPTVFKPTVKVATDVAEFSETELTTKYTYRNAIV-EKSADGVFNVEPVTQDYEFKVDL 59

Query: 61  KLPRVGVMLVGIGGNNGTTFLASILANRQKMKFHNKEGLKEANYYGSVTQCSTLKLGVRP 120
           KLP+VGVMLVG+GGNNGTTFLASILAN+ K+KF  KEGLKEANYYGSVTQ STLKLGV  
Sbjct: 60  KLPKVGVMLVGLGGNNGTTFLASILANKHKVKFQTKEGLKEANYYGSVTQSSTLKLGVDA 119

Query: 121 DGNDFYVPFNSLLPFVSPNDFEVTGWDISATNLGDAMERAQVLEYDLQRQLKPEMSEYKP 180
           +GND Y PFNSL+P VSPNDF V+GWDI+  +LG AM RA+VL  DLQ +L+ EMS +KP
Sbjct: 120 EGNDVYAPFNSLVPMVSPNDFYVSGWDINGADLGTAMARAEVLGVDLQNKLRQEMSAHKP 179

Query: 181 LPSIYYPDFIAANQDGRADNCINRPNNAGPASTKNKWEHLERIRADIREFKQQKDLDKVI 240
           LPSIYYPDFIAANQD RADNC NR   AGP S K+KW H+E IR DIR+FK+   LDKV+
Sbjct: 180 LPSIYYPDFIAANQDERADNCFNRDGKAGPVSVKDKWSHVEHIRNDIRQFKENNGLDKVL 239

Query: 241 VLWTANTERYADIIPGVNDTADNLLNAIKQDGEEIAPSTIFAVASILEGSVYINGSPQNT 300
           VLWTANTERYADI+ GVNDTA+NL+NAI+ D  EIAPST+FAVASILE   YINGSPQNT
Sbjct: 240 VLWTANTERYADIVTGVNDTAENLINAIRSDHAEIAPSTVFAVASILENVPYINGSPQNT 299

Query: 301 FVPGVIELAEREDSFIAGDDFKSGQTKIKSVLAQFLVEAGIKPTSIASYNHLGNNDGYNL 360
           FVPGVI+LAE+E +FIAGDDFKSGQTK+KSVLAQFLV+AGI+P SIASYNHLGNNDGYNL
Sbjct: 300 FVPGVIDLAEKEGAFIAGDDFKSGQTKMKSVLAQFLVDAGIRPVSIASYNHLGNNDGYNL 359

Query: 361 SSERQFXXXXXXXXXXXXXXXXXNPLLYNDKLGNKIDHCIVIKYMNAVGDSKVAMDEYYS 420
           SS +QF                 N +LYNDKLGNKIDHCIVIKYM AVGDSKVAMDEYYS
Sbjct: 360 SSPQQFKSKEISKASVVDDIIESNQILYNDKLGNKIDHCIVIKYMPAVGDSKVAMDEYYS 419

Query: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMAEFCTRVSYKRVGDGSTEYGKFYNILSF 480
           ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMAEFC+R+ YK++ D S  Y  FY +L+ 
Sbjct: 420 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMAEFCSRIKYKKINDLSGGYHSFYPVLTM 479

Query: 481 LSYWLKAPLTRKGYQAINGLNKQRSGLENFMRLLIGLPAQDELRFEERL 529
           LSYWLKAPLTR G++AINGLNKQR+ LENF+RLLIGLPA DELRFEERL
Sbjct: 480 LSYWLKAPLTRPGFKAINGLNKQRAALENFLRLLIGLPALDELRFEERL 528

>SAKL0F00396g Chr6 (31629..33212) [1584 bp, 527 aa] {ON} highly
           similar to gnl|GLV|KLLA0D16412g Kluyveromyces lactis
           KLLA0D16412g and similar to YJL153C uniprot|P11986
           Saccharomyces cerevisiae YJL153C INO1 Inositol 1-
           phosphate synthase involved in synthesis of inositol
           phosphates and inositol-containing phospholipids
           transcription is coregulated with other phospholipid
           biosynthetic genes by Ino2p and Ino4p which bind the
           UASINO DNA element
          Length = 527

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/531 (69%), Positives = 430/531 (80%), Gaps = 7/531 (1%)

Query: 1   MTAANYFTPSVKVATDKVHYSETELTTKYTYVNSIVTENAATNTVDVNPIKQEYDFKVDL 60
           MTA   +TP VKVAT+   Y  ++L T YTY N+IV++  +  +    P+ + Y FKVDL
Sbjct: 1   MTAQ--YTPKVKVATENCQYRGSDLITNYTYKNTIVSK-CSDGSYSAQPVVENYQFKVDL 57

Query: 61  KLPRVGVMLVGIGGNNGTTFLASILANRQKMKFHNKEGLKEANYYGSVTQCSTLKLGVRP 120
           K+P++GVMLVG+GGNNG+TF+ASILAN+ K++F++KEG   ANYYGSVTQ ST+KLG+  
Sbjct: 58  KVPKLGVMLVGLGGNNGSTFIASILANKHKIQFNSKEGTIGANYYGSVTQASTIKLGIDA 117

Query: 121 DGNDFYVPFNSLLPFVSPNDFEVTGWDISATNLGDAMERAQVLEYDLQRQLKPEMSEYKP 180
           DGND YVPFNS+LPFV+PNDF V GWDI+ +N+ +AM RA+VLEYDLQ +LK EM +  P
Sbjct: 118 DGNDVYVPFNSVLPFVNPNDFVVGGWDINGSNMYEAMVRAKVLEYDLQEKLKAEMEKIHP 177

Query: 181 LPSIYYPDFIAANQDGRADNCINRPNNAGPASTKNKWEHLERIRADIREFKQQKDLDKVI 240
           LPS+YYPD+IAANQD RA+NCINR    G  STKNKW+H+E+IR DIR+FK+   LDKVI
Sbjct: 178 LPSVYYPDYIAANQDERANNCINRVK--GTVSTKNKWDHVEKIRKDIRDFKETNGLDKVI 235

Query: 241 VLWTANTERYADIIPGVNDTADNLLNAIKQDGEEIAPSTIFAVASILEGSVYINGSPQNT 300
           VLWTANTERY+D+I GVND A+NLL AIK D  EI+PS IFAVASILE   YINGSPQNT
Sbjct: 236 VLWTANTERYSDLIDGVNDNAENLLKAIKSDHTEISPSAIFAVASILENVPYINGSPQNT 295

Query: 301 FVPGVIELAEREDSFIAGDDFKSGQTKIKSVLAQFLVEAGIKPTSIASYNHLGNNDGYNL 360
           FVPG++ELAE+  SFI GDDFKSGQTK+KSVLAQFLV+AGI+P SIASYNHLGNNDGYNL
Sbjct: 296 FVPGIVELAEKNKSFIGGDDFKSGQTKLKSVLAQFLVDAGIRPVSIASYNHLGNNDGYNL 355

Query: 361 SSERQFXXXXXXXXXXXXXXXXXNPLLYNDKLGNKIDHCIVIKYMNAVGDSKVAMDEYYS 420
           SS +QF                 N +LYN+KLG KIDHCIVIKYM AV DSKVAMDEYYS
Sbjct: 356 SSPKQFKSKEISKSSVVDDIIASNSILYNEKLGKKIDHCIVIKYMPAVADSKVAMDEYYS 415

Query: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMAEFCTRVSYKRV-GDGST-EYGKFYNIL 478
           ELMLGGHNRISIHNVCEDSLLATPLIIDLLVM+EF +RV+YK++  D S   Y K Y+IL
Sbjct: 416 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMSEFLSRVTYKKLESDASAGSYEKLYSIL 475

Query: 479 SFLSYWLKAPLTRKGYQAINGLNKQRSGLENFMRLLIGLPAQDELRFEERL 529
           SFLSYWLKAPLTRKG++ INGLNKQR  LENF+RLLIGLPA DELRFEERL
Sbjct: 476 SFLSYWLKAPLTRKGFETINGLNKQRMALENFLRLLIGLPAIDELRFEERL 526

>YJL153C Chr10 complement(134332..135933) [1602 bp, 533 aa] {ON}
           INO1Inositol-3-phosphate synthase, involved in synthesis
           of inositol phosphates and inositol-containing
           phospholipids; transcription is coregulated with other
           phospholipid biosynthetic genes by Ino2p and Ino4p,
           which bind the UASINO DNA element
          Length = 533

 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/524 (68%), Positives = 425/524 (81%), Gaps = 6/524 (1%)

Query: 10  SVKVATDKVHYSETELTTKYTYVNSIVTENAATNTVDVNPIKQEYDFKVDLKLP-RVGVM 68
           SVKV TDK  Y + EL TKY+Y N++VT+  A+   DV P  Q+Y FK+DLK P ++G+M
Sbjct: 11  SVKVVTDKCTYKDNELLTKYSYENAVVTK-TASGRFDVTPTVQDYVFKLDLKKPEKLGIM 69

Query: 69  LVGIGGNNGTTFLASILANRQKMKFHNKEGLKEANYYGSVTQCSTLKLGVRPDGNDFYVP 128
           L+G+GGNNG+T +AS+LAN+  ++F  KEG+K+ NY+GS+TQCSTLKLG+  +GND Y P
Sbjct: 70  LIGLGGNNGSTLVASVLANKHNVEFQTKEGVKQPNYFGSMTQCSTLKLGIDAEGNDVYAP 129

Query: 129 FNSLLPFVSPNDFEVTGWDISATNLGDAMERAQVLEYDLQRQLKPEMSEYKPLPSIYYPD 188
           FNSLLP VSPNDF V+GWDI+  +L +AM+R+QVLEYDLQ++LK +MS  KPLPSIYYPD
Sbjct: 130 FNSLLPMVSPNDFVVSGWDINNADLYEAMQRSQVLEYDLQQRLKAKMSLVKPLPSIYYPD 189

Query: 189 FIAANQDGRADNCINRPNNAGPASTKNKWEHLERIRADIREFKQQKDLDKVIVLWTANTE 248
           FIAANQD RA+NCIN  +  G  +T+ KW HL+RIR DI+ FK++  LDKVIVLWTANTE
Sbjct: 190 FIAANQDERANNCINL-DEKGNVTTRGKWTHLQRIRRDIQNFKEENALDKVIVLWTANTE 248

Query: 249 RYADIIPGVNDTADNLLNAIKQDGEEIAPSTIFAVASILEGSVYINGSPQNTFVPGVIEL 308
           RY ++ PGVNDT +NLL +IK D EEIAPSTIFA ASILEG  YINGSPQNTFVPG+++L
Sbjct: 249 RYVEVSPGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPGLVQL 308

Query: 309 AEREDSFIAGDDFKSGQTKIKSVLAQFLVEAGIKPTSIASYNHLGNNDGYNLSSERQFXX 368
           AE E +FIAGDD KSGQTK+KSVLAQFLV+AGIKP SIASYNHLGNNDGYNLS+ +QF  
Sbjct: 309 AEHEGTFIAGDDLKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGYNLSAPKQFRS 368

Query: 369 XXXXXXXXXXXXXXXNPLLYNDKLGNKIDHCIVIKYMNAVGDSKVAMDEYYSELMLGGHN 428
                          N +LYNDKLG K+DHCIVIKYM  VGDSKVAMDEYYSELMLGGHN
Sbjct: 369 KEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYSELMLGGHN 428

Query: 429 RISIHNVCEDSLLATPLIIDLLVMAEFCTRVSYKRVGDGSTEYGK---FYNILSFLSYWL 485
           RISIHNVCEDSLLATPLIIDLLVM EFCTRVSYK+V     + GK   FY +L+FLSYWL
Sbjct: 429 RISIHNVCEDSLLATPLIIDLLVMTEFCTRVSYKKVDPVKEDAGKFENFYPVLTFLSYWL 488

Query: 486 KAPLTRKGYQAINGLNKQRSGLENFMRLLIGLPAQDELRFEERL 529
           KAPLTR G+  +NGLNKQR+ LENF+RLLIGLP+Q+ELRFEERL
Sbjct: 489 KAPLTRPGFHPVNGLNKQRTALENFLRLLIGLPSQNELRFEERL 532

>Smik_10.81 Chr10 complement(132183..133784) [1602 bp, 533 aa] {ON}
           YJL153C (REAL)
          Length = 533

 Score =  744 bits (1922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/524 (68%), Positives = 421/524 (80%), Gaps = 6/524 (1%)

Query: 10  SVKVATDKVHYSETELTTKYTYVNSIVTENAATNTVDVNPIKQEYDFKVDLKLPR-VGVM 68
           SVKV TDK  Y+E EL TKY+Y N++VT+ A     DV P  Q+Y FK+DL  P+ +G+M
Sbjct: 11  SVKVVTDKCTYTENELLTKYSYENAVVTKTAG-GQFDVTPTVQDYVFKLDLNKPKKLGIM 69

Query: 69  LVGIGGNNGTTFLASILANRQKMKFHNKEGLKEANYYGSVTQCSTLKLGVRPDGNDFYVP 128
           L+G+GGNNG+T +ASILANR  M+F  KEGLK+ NY+GS+TQCSTLKLG+  +GND Y P
Sbjct: 70  LIGLGGNNGSTLVASILANRHDMEFQTKEGLKKPNYFGSMTQCSTLKLGIDAEGNDVYAP 129

Query: 129 FNSLLPFVSPNDFEVTGWDISATNLGDAMERAQVLEYDLQRQLKPEMSEYKPLPSIYYPD 188
           FNSLLP V+PNDF V+GWDI+  NL +AM+R QVLEYDLQ++LK +MS  KPLPSIYYPD
Sbjct: 130 FNSLLPMVNPNDFIVSGWDINKANLYEAMQRGQVLEYDLQQRLKAKMSTVKPLPSIYYPD 189

Query: 189 FIAANQDGRADNCINRPNNAGPASTKNKWEHLERIRADIREFKQQKDLDKVIVLWTANTE 248
           FIAANQD RA+NCIN  +  G  +T+ KW HL++IR DI+ FK++  LDKVIVLWTANTE
Sbjct: 190 FIAANQDERANNCINL-DEKGKVTTRGKWSHLQQIRRDIQHFKEENSLDKVIVLWTANTE 248

Query: 249 RYADIIPGVNDTADNLLNAIKQDGEEIAPSTIFAVASILEGSVYINGSPQNTFVPGVIEL 308
           RY ++  GVNDT  NLL +IK D EEIAPST+FA ASILEG  YINGSPQNTFVPG+++L
Sbjct: 249 RYVEVTAGVNDTMQNLLQSIKDDHEEIAPSTVFAAASILEGVPYINGSPQNTFVPGLVQL 308

Query: 309 AEREDSFIAGDDFKSGQTKIKSVLAQFLVEAGIKPTSIASYNHLGNNDGYNLSSERQFXX 368
           AE E +FIAGDDFKSGQTK+KSVLAQFLV+AGIKP SIASYNHLGNNDGYNLS+ +QF  
Sbjct: 309 AEHEGTFIAGDDFKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGYNLSAPKQFRS 368

Query: 369 XXXXXXXXXXXXXXXNPLLYNDKLGNKIDHCIVIKYMNAVGDSKVAMDEYYSELMLGGHN 428
                          N +LYNDKLG K+DHCIVIKYM  VGDSKVAMDEYYSELMLGGHN
Sbjct: 369 KEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYSELMLGGHN 428

Query: 429 RISIHNVCEDSLLATPLIIDLLVMAEFCTRVSYKR---VGDGSTEYGKFYNILSFLSYWL 485
           RISIHNVCEDSLLATPLIIDLLVM EFC+RVSYK+   V +   +Y  FY +L+FLSYWL
Sbjct: 429 RISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKKGSSVQEDHDKYESFYPVLTFLSYWL 488

Query: 486 KAPLTRKGYQAINGLNKQRSGLENFMRLLIGLPAQDELRFEERL 529
           KAPLTR G+  +NGLNKQR+ LENF+RLLIGLP+ +ELRFEERL
Sbjct: 489 KAPLTRPGFHPVNGLNKQRTALENFLRLLIGLPSLNELRFEERL 532

>TBLA0C02070 Chr3 (490480..492090) [1611 bp, 536 aa] {ON} Anc_1.195
           YJL153C
          Length = 536

 Score =  736 bits (1900), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/534 (67%), Positives = 423/534 (79%), Gaps = 7/534 (1%)

Query: 3   AANYFTPSVKVATDKVHYSETELTTKYTYVNSIVTENAATNTVDVNPIKQEYDFKVDLKL 62
            A  F P+VKV TDK  Y+E EL TKYTY N +V  N A  + DV    ++Y+FK DLK+
Sbjct: 2   TAQTFVPAVKVQTDKCRYTEDELITKYTYKNVLVDSNQAKTSFDVKIQNEDYEFKTDLKI 61

Query: 63  PRVGVMLVGIGGNNGTTFLASILANRQKMKFHNK--EGLKEANYYGSVTQCSTLKLGVRP 120
           P+VGVMLVG+GGNNGTTF+AS+LAN++K+KF  K  +GLK+ANYYGSVTQ ST+KLGV  
Sbjct: 62  PKVGVMLVGMGGNNGTTFVASVLANKKKLKFRTKNFKGLKDANYYGSVTQASTVKLGVDS 121

Query: 121 DG-NDFYVPFNSLLPFVSPNDFEVTGWDISATNLGDAMERAQVLEYDLQRQLKPEMSEYK 179
           +  ND Y+PFNSLLP V+PNDF V+GWDI   N  DAM  +QVLEYDL +QLKPEMS+ K
Sbjct: 122 ETLNDVYIPFNSLLPMVNPNDFVVSGWDIQDYNCYDAMVESQVLEYDLIQQLKPEMSQIK 181

Query: 180 PLPSIYYPDFIAANQDGRADNCINRPNNAGPA-STKNKWEHLERIRADIREFKQQKDLDK 238
           PL SIYYPDF+A NQ  RA+NCINR +N+      KNK   L+ IR DI+ FKQ+  LDK
Sbjct: 182 PLKSIYYPDFLAMNQIERANNCINRKDNSSEVIDIKNKQSDLDHIRNDIKTFKQENHLDK 241

Query: 239 VIVLWTANTERYADIIPGVNDTADNLLNAIKQDGEEIAPSTIFAVASILEGSVYINGSPQ 298
           VIVLWTA+TERYADII GVNDTADNLLN+IK   EEIAPSTIFAVASILEG++YINGSPQ
Sbjct: 242 VIVLWTASTERYADIIEGVNDTADNLLNSIKTSHEEIAPSTIFAVASILEGAIYINGSPQ 301

Query: 299 NTFVPGVIELAEREDSFIAGDDFKSGQTKIKSVLAQFLVEAGIKPTSIASYNHLGNNDGY 358
           NT VPGV++L++RE++ IAGDDFK+GQTK+KSVLAQFL++AGIKP S+ASYNHLGNNDGY
Sbjct: 302 NTLVPGVVDLSKRENTIIAGDDFKTGQTKLKSVLAQFLIDAGIKPLSVASYNHLGNNDGY 361

Query: 359 NLSSERQFXXXXXXXXXXXXXXXXXNPLLYNDKLGNKIDHCIVIKYMNAVGDSKVAMDEY 418
           NLS+ +QF                 N +LYN K G ++DHCIVIKYM AVGD+KVAMDEY
Sbjct: 362 NLSAPKQFRSKEISKSSVIDDMIESNEILYNAKTGAEVDHCIVIKYMPAVGDNKVAMDEY 421

Query: 419 YSELMLGGHNRISIHNVCEDSLLATPLIIDLLVMAEFCTRVSYKRVG---DGSTEYGKFY 475
           YSELMLGGHNRIS+HNVCEDSLLATP++IDL+VM EF +R+SYKRV    D   EY  F 
Sbjct: 422 YSELMLGGHNRISVHNVCEDSLLATPIMIDLMVMVEFISRISYKRVNSRDDEELEYSTFN 481

Query: 476 NILSFLSYWLKAPLTRKGYQAINGLNKQRSGLENFMRLLIGLPAQDELRFEERL 529
           + LSFLSYWLKAP+ +KG+Q INGLNKQR  LENF+RLLIGLP  DELRFEERL
Sbjct: 482 STLSFLSYWLKAPMVKKGFQPINGLNKQRLALENFLRLLIGLPPNDELRFEERL 535

>CAGL0I06050g Chr9 (575188..576804) [1617 bp, 538 aa] {ON} highly
           similar to uniprot|P11986 Saccharomyces cerevisiae
           YJL153c INO1 myo-inositol-1-phosphate synthase
          Length = 538

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/538 (67%), Positives = 414/538 (76%), Gaps = 8/538 (1%)

Query: 1   MTAANYFTPSVKVATDKVHYSETELTTKYTYVNSIVTENAATNTVDVNPIKQEYDFKVDL 60
           MT     +  V    DKV Y E EL T YTY  ++V  N+     +V P+ + Y FKVDL
Sbjct: 1   MTVNKGISIRVNNVGDKVSYKENELLTNYTYHTNVVHTNSDKTQFEVTPLDKNYQFKVDL 60

Query: 61  KLP-RVGVMLVGIGGNNGTTFLASILANRQKMKFH--NKEGLKEANYYGSVTQCSTLKLG 117
             P R+GVMLVG+GGNNG+T +A++LAN+  + F   +KEGL E NYYGS+TQ ST+KLG
Sbjct: 61  NKPERLGVMLVGLGGNNGSTMMAAVLANKHNVCFRTRDKEGLTEPNYYGSLTQSSTIKLG 120

Query: 118 VRPDGNDFYVPFNSLLPFVSPNDFEVTGWDISATNLGDAMERAQVLEYDLQRQLKPEMSE 177
           V   G D YVPFNSL+P V+PNDF V+GWDI+   +  AMERA VLE DL+ +L P M +
Sbjct: 121 VDSKGKDVYVPFNSLVPMVNPNDFVVSGWDINGATMDQAMERASVLEVDLRNKLAPMMKD 180

Query: 178 YKPLPSIYYPDFIAANQDGRADNCINRPNNAGPASTKNKWEHLERIRADIREFKQQKDLD 237
           +KPL S+YYPDFIAANQD RADNC+N     G  +T  KWEHL  IR DIR FKQQ DLD
Sbjct: 181 HKPLKSVYYPDFIAANQDERADNCLNVDPQTGKVTTTGKWEHLNHIRNDIRTFKQQNDLD 240

Query: 238 KVIVLWTANTERYADIIPGVNDTADNLLNAIKQDGEEIAPSTIFAVASILEGSVYINGSP 297
           KVI+LWTANTERY +I+PGVNDT +NLL AIK D  EIAPSTIFA ASILE   YINGSP
Sbjct: 241 KVIILWTANTERYVEILPGVNDTMENLLEAIKNDHTEIAPSTIFAAASILEHCPYINGSP 300

Query: 298 QNTFVPGVIELAEREDSFIAGDDFKSGQTKIKSVLAQFLVEAGIKPTSIASYNHLGNNDG 357
           QNTFVPG+IELAE+ DS IAGDDFKSGQTK+KSVLAQFLV+AGI+P SIASYNHLGNNDG
Sbjct: 301 QNTFVPGLIELAEKNDSLIAGDDFKSGQTKMKSVLAQFLVDAGIRPVSIASYNHLGNNDG 360

Query: 358 YNLSSERQFXXXXXXXXXXXXXXXXXNPLLYNDKLGNKIDHCIVIKYMNAVGDSKVAMDE 417
           YNLSS +QF                 NP+LYNDKLGNKIDHCIVIKYM+AVGDSKVAMDE
Sbjct: 361 YNLSSPQQFRSKEISKASVVDDIIESNPILYNDKLGNKIDHCIVIKYMHAVGDSKVAMDE 420

Query: 418 YYSELMLGGHNRISIHNVCEDSLLATPLIIDLLVMAEFCTRVSYKRVG--DGSTEYG--- 472
           YYSELMLGGHNRISIHNVCEDSLLATPLIIDL+VM EFC+RV+Y+ V   DG+   G   
Sbjct: 421 YYSELMLGGHNRISIHNVCEDSLLATPLIIDLIVMTEFCSRVTYRNVDGQDGAEAKGDFE 480

Query: 473 KFYNILSFLSYWLKAPLTRKGYQAINGLNKQRSGLENFMRLLIGLPAQDELRFEERLK 530
            FY +LSFLSYWLKAPLT+ GYQ INGLNKQR+ LENF+RLLIGLPA DELRFEERLK
Sbjct: 481 NFYPVLSFLSYWLKAPLTKPGYQPINGLNKQRTALENFLRLLIGLPAIDELRFEERLK 538

>Skud_10.63 Chr10 complement(109499..111100) [1602 bp, 533 aa] {ON}
           YJL153C (REAL)
          Length = 533

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/526 (68%), Positives = 418/526 (79%), Gaps = 6/526 (1%)

Query: 8   TPSVKVATDKVHYSETELTTKYTYVNSIVTENAATNTVDVNPIKQEYDFKVDLKLP-RVG 66
           T SV+VAT+K  Y+E EL TKY+Y N++V++       DV P  Q+Y FKV L  P ++G
Sbjct: 9   TASVRVATEKCTYTEDELLTKYSYENAVVSK-TPDGRFDVTPTVQDYVFKVGLDKPDKLG 67

Query: 67  VMLVGIGGNNGTTFLASILANRQKMKFHNKEGLKEANYYGSVTQCSTLKLGVRPDGNDFY 126
           +MLVG+GGNNG+T +AS+LAN+  ++FH KEGLK+ NY+GS+TQ STLKLGV   GND Y
Sbjct: 68  IMLVGLGGNNGSTLVASVLANKHDIEFHTKEGLKKPNYFGSMTQSSTLKLGVDAAGNDVY 127

Query: 127 VPFNSLLPFVSPNDFEVTGWDISATNLGDAMERAQVLEYDLQRQLKPEMSEYKPLPSIYY 186
            PFNSLLP V+PNDF ++GWDI+  NL +AM+RAQVLEYDLQ++L   MS  KPLPS+YY
Sbjct: 128 APFNSLLPMVNPNDFVISGWDINDANLSEAMQRAQVLEYDLQQRLNSRMSAVKPLPSVYY 187

Query: 187 PDFIAANQDGRADNCINRPNNAGPASTKNKWEHLERIRADIREFKQQKDLDKVIVLWTAN 246
           PDFIAANQD RA+NCIN  +  G  +T  KW HL++IR DI++FK++  LDKVIVLWTAN
Sbjct: 188 PDFIAANQDERANNCINV-DAKGSVTTVGKWAHLQQIRHDIQDFKKENSLDKVIVLWTAN 246

Query: 247 TERYADIIPGVNDTADNLLNAIKQDGEEIAPSTIFAVASILEGSVYINGSPQNTFVPGVI 306
           TERY +I  GVNDT +NLL +IK D EEIAPSTIFA ASILEG  YINGSPQNTFVPG++
Sbjct: 247 TERYVEISAGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPGLV 306

Query: 307 ELAEREDSFIAGDDFKSGQTKIKSVLAQFLVEAGIKPTSIASYNHLGNNDGYNLSSERQF 366
           +LAE E  FIAGDD KSGQTK+KSVLAQFLV+AGIKP SIASYNHLGNNDGYNLS+ +QF
Sbjct: 307 QLAEHEAVFIAGDDLKSGQTKLKSVLAQFLVDAGIKPLSIASYNHLGNNDGYNLSAPKQF 366

Query: 367 XXXXXXXXXXXXXXXXXNPLLYNDKLGNKIDHCIVIKYMNAVGDSKVAMDEYYSELMLGG 426
                            N +LYNDKLG K+DHCIVIKYM  VGDSKVAMDEYYSELMLGG
Sbjct: 367 RSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYSELMLGG 426

Query: 427 HNRISIHNVCEDSLLATPLIIDLLVMAEFCTRVSYKRVGDGSTEYGK---FYNILSFLSY 483
           HNRISIHNVCEDSLLATPLIIDLLVM EFC+RVSYKRV     + GK   FY +L+FLSY
Sbjct: 427 HNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKRVNPAQEDDGKFESFYPVLTFLSY 486

Query: 484 WLKAPLTRKGYQAINGLNKQRSGLENFMRLLIGLPAQDELRFEERL 529
           WLKAPLTR G+  +NGLNKQRS LENFMRLLIGLP+ +ELRFEERL
Sbjct: 487 WLKAPLTRPGFHPVNGLNKQRSALENFMRLLIGLPSLNELRFEERL 532

>TPHA0A02880 Chr1 complement(624919..626541) [1623 bp, 540 aa] {ON}
           Anc_1.195 YJL153C
          Length = 540

 Score =  730 bits (1885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/534 (67%), Positives = 426/534 (79%), Gaps = 11/534 (2%)

Query: 7   FTPSVKVATDKVHYSETELTTKYTYVNSIVTENAATNTVDVNPIKQEYDFKVDLKLPRVG 66
           F P + V  DK       L +KYTY +++VT+N +TN+  V+ +K++Y+F VDL LP++G
Sbjct: 6   FEPKIIVNNDKCTIEGNTLKSKYTYTSNLVTKNDSTNSYIVDTVKKDYEFNVDLNLPKLG 65

Query: 67  VMLVGIGGNNGTTFLASILANRQKMKFHNK--EGLKEANYYGSVTQCSTLKLGVRPDGND 124
           +MLVG+GGNNGTT LAS+LAN+  ++F++K  +GLK+ANYYGSVTQ ST+KLG+ P  ND
Sbjct: 66  IMLVGLGGNNGTTLLASVLANKNNLEFYSKNFKGLKKANYYGSVTQSSTIKLGIDPKTND 125

Query: 125 -FYVPFNSLLPFVSPNDFEVTGWDISATNLGDAMERAQVLEYDLQRQLKPEMSEYKPLPS 183
             YVPF  +LP  +PNDF +TGWDIS  N  +AM+RA VLE+DLQ QLK EM + KPL S
Sbjct: 126 EIYVPFTDILPLSNPNDFVITGWDISDLNCFEAMQRACVLEHDLQMQLKDEMEKIKPLKS 185

Query: 184 IYYPDFIAANQDGRADNCINRPN----NAGPAS----TKNKWEHLERIRADIREFKQQKD 235
           IYYPDFIA NQ+ RA++C NR +    N  P S    TKNKW H+E+IR DIR FK++ +
Sbjct: 186 IYYPDFIALNQNERANHCFNRKSEAEGNKDPLSLDGLTKNKWSHVEQIRDDIRNFKKENN 245

Query: 236 LDKVIVLWTANTERYADIIPGVNDTADNLLNAIKQDGEEIAPSTIFAVASILEGSVYING 295
           LDKVIVLWTANTERY+ I  GVND ADNLLNAIK D  E++PSTIFAVASILEG  YING
Sbjct: 246 LDKVIVLWTANTERYSTIEAGVNDNADNLLNAIKNDHSEVSPSTIFAVASILEGVPYING 305

Query: 296 SPQNTFVPGVIELAEREDSFIAGDDFKSGQTKIKSVLAQFLVEAGIKPTSIASYNHLGNN 355
           SPQNTFVPGVI+LAERE SFIAGDDFKSGQTK+KSVLAQFLV+AGIKP SIASYNHLGNN
Sbjct: 306 SPQNTFVPGVIDLAEREHSFIAGDDFKSGQTKMKSVLAQFLVDAGIKPLSIASYNHLGNN 365

Query: 356 DGYNLSSERQFXXXXXXXXXXXXXXXXXNPLLYNDKLGNKIDHCIVIKYMNAVGDSKVAM 415
           DG+NLSS  QF                 N +L+NDK+G  IDHCIVIKY+NAVGDSKVAM
Sbjct: 366 DGFNLSSPMQFKSKEISKRGVCDDMIESNQILFNDKVGKTIDHCIVIKYLNAVGDSKVAM 425

Query: 416 DEYYSELMLGGHNRISIHNVCEDSLLATPLIIDLLVMAEFCTRVSYKRVGDGSTEYGKFY 475
           DEYYSELMLGGHNRISIHNVCEDSLLATPLIIDLLVM EFCTRV+YK++G+G+T+Y +FY
Sbjct: 426 DEYYSELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCTRVTYKKLGEGATDYEQFY 485

Query: 476 NILSFLSYWLKAPLTRKGYQAINGLNKQRSGLENFMRLLIGLPAQDELRFEERL 529
            +L+ LSYWLKAPLTR G++ INGL KQR+ LENF+RLLIGLP  D+LRFEERL
Sbjct: 486 PVLTLLSYWLKAPLTRPGFKPINGLMKQRAALENFLRLLIGLPPLDDLRFEERL 539

>Suva_6.231 Chr6 (414131..415762) [1632 bp, 543 aa] {ON} YJL153C
           (REAL)
          Length = 543

 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/536 (66%), Positives = 419/536 (78%), Gaps = 16/536 (2%)

Query: 8   TPSVKVATDKVHYSETELTTKYTYVNSIVTENAATNTVDVNPIKQEYDFKVDLKLP-RVG 66
           T SV+VA++K  Y++ EL TKY+Y N++V++       DV P  Q+Y FK+DL  P ++G
Sbjct: 9   TASVRVASNKCTYTDNELLTKYSYENAVVSK-TPDGRYDVTPTVQDYVFKLDLNKPAKLG 67

Query: 67  VMLVGIGGNNGTTFLASILANRQKMKFHNKEGLKEANYYGSVTQCSTLKLGVRPDGNDFY 126
           VMLVG+GGNNG+TF A+ILAN+  ++F  KEGLK+ NY+GS+TQ STLKLG+   GND Y
Sbjct: 68  VMLVGLGGNNGSTFTAAILANKHNIEFQTKEGLKKPNYFGSMTQSSTLKLGIDAQGNDVY 127

Query: 127 VPFNSLLPFVSPNDFEVTGWDISATNLGDAMERAQVLEYDLQRQLKPEMSEYKPLPSIYY 186
            PFNSLLP  +PNDF VTGWDI+  N  +AM+RAQVLEYDLQ++LK +MS  KPLPSIYY
Sbjct: 128 APFNSLLPMANPNDFVVTGWDINNANQFEAMQRAQVLEYDLQQRLKTKMSSLKPLPSIYY 187

Query: 187 PDFIAANQDGRADNCINRPNNAGPASTKNKWEHLERIRADIREFKQQKDLDKVIVLWTAN 246
           PDFIAANQD RA+NCIN  +  G  +TK KW HL++IR DI+ FK++  LDKVIVLWTAN
Sbjct: 188 PDFIAANQDQRANNCINL-DEKGHVTTKGKWAHLQQIRHDIQSFKEKNSLDKVIVLWTAN 246

Query: 247 TERYADIIPGVNDTADNLLNAIKQDGEEIAPSTIFAVASILEGSVYINGSPQNTFVPGVI 306
           TERY ++  GVNDT +NLL +IK D EEIAPSTIFA ASILEG  YINGSPQNTFVPG++
Sbjct: 247 TERYVEVSAGVNDTMENLLQSIKDDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPGLV 306

Query: 307 ELAEREDSFIAGDDFKSGQTKIKSVLAQFLVEAGIKPTSIASYNHLGNNDGYNLSSERQF 366
           +LAE E +FIAGDDFKSGQTK+KSVLAQFLV+AGIKP SIASYNHLGNNDG+NLS+ +QF
Sbjct: 307 QLAEHEGAFIAGDDFKSGQTKMKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNLSAPKQF 366

Query: 367 XXXXXXXXXXXXXXXXXNPLLYNDKLGNKIDHCIVIKYMNAVGDSKVAMDEYYSELMLGG 426
                            N +LYNDKLGNK+DHCIVIKYM  VGDSKVAMDEYYSELMLGG
Sbjct: 367 RSKEISKSSVIDDIIASNDILYNDKLGNKVDHCIVIKYMKPVGDSKVAMDEYYSELMLGG 426

Query: 427 HNRISIHNVCEDSLLATPLIIDLLVMAEFCTRVSYKRVGDGST-------------EYGK 473
           HNRISIHNVCEDSLLATPLIIDLLVM EFC+RVSYK+                   ++  
Sbjct: 427 HNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKKADSSQENGNGNENENENDGKFES 486

Query: 474 FYNILSFLSYWLKAPLTRKGYQAINGLNKQRSGLENFMRLLIGLPAQDELRFEERL 529
           FY +L+FLSYWLKAPLTR G+  +NGLNKQR+ LENFMRLLIGLP+ +ELRFEERL
Sbjct: 487 FYPVLTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFMRLLIGLPSLNELRFEERL 542

>KAFR0F01860 Chr6 complement(365737..367365) [1629 bp, 542 aa] {ON}
           Anc_1.195 YJL153C
          Length = 542

 Score =  673 bits (1737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/525 (62%), Positives = 403/525 (76%), Gaps = 5/525 (0%)

Query: 9   PSVKVATDKVHYS--ETELTTKYTYVNSIVTENAATNTVDVNPIKQEYDFKVDLKLPRVG 66
           PSVK        S    EL ++Y Y NSIV ++  TN +++ P +Q+Y FK++L   +VG
Sbjct: 20  PSVKFNPRLCTLSGDNNELISRYKYQNSIVVKDIHTNELEITPFEQDYQFKINLNPNKVG 79

Query: 67  VMLVGIGGNNGTTFLASILANRQKMKFHNKEGLKEANYYGSVTQCSTLKLGVRPDGNDFY 126
           +MLVG+GGNNG+TFLAS+LAN+  + F+ +EG  E NYYGS+TQ STLKLG+  +GND +
Sbjct: 80  IMLVGLGGNNGSTFLASLLANKNNISFNTREGTVEPNYYGSMTQSSTLKLGIDSEGNDVF 139

Query: 127 VPFNSLLPFVSPNDFEVTGWDISATNLGDAMERAQVLEYDLQRQLKPEMSEYKPLPSIYY 186
            PFNS+LP V+PNDF V+GWDI+  NL  AM+RA+VLEYDLQ +LKP M  YKPL SIYY
Sbjct: 140 APFNSILPMVNPNDFVVSGWDINDENLFMAMQRAKVLEYDLQSKLKPYMESYKPLKSIYY 199

Query: 187 PDFIAANQDGRADNCINRPNNAGPASTKNKWEHLERIRADIREFKQQKDLDKVIVLWTAN 246
           PDFIA NQ  RA+NCIN+ N+ G  +T++KW  L +IR DI++FK   +L+ +IVLWTAN
Sbjct: 200 PDFIAMNQFERANNCINQ-NDDGQFNTQDKWNDLLKIRQDIKDFKSHNNLENIIVLWTAN 258

Query: 247 TERYADIIPGVNDTADNLLNAIKQDGEEIAPSTIFAVASILEGSVYINGSPQNTFVPGVI 306
           TER  +IIPGVNDT DNL+ +IK +  EI+PS IFA A+I+E   YINGSPQNTFVPG+I
Sbjct: 259 TERCVEIIPGVNDTMDNLIASIKDNHSEISPSNIFATAAIMEKVPYINGSPQNTFVPGLI 318

Query: 307 ELAEREDSFIAGDDFKSGQTKIKSVLAQFLVEAGIKPTSIASYNHLGNNDGYNLSSERQF 366
           ELAE  D  IAGDDFK+GQTK+KSV+ QFLV+AGIKP SIASYNHLGNNDG NLSS  QF
Sbjct: 319 ELAEHNDVLIAGDDFKTGQTKLKSVMTQFLVDAGIKPVSIASYNHLGNNDGLNLSSHAQF 378

Query: 367 XXXXXXXXXXXXXXXXXNPLLYNDKLG-NKIDHCIVIKYMNAVGDSKVAMDEYYSELMLG 425
                            N +L+N K   +K +HCIVIKYM AVGDSKVAMDEYYS+LMLG
Sbjct: 379 RSKEISKSSVIDDCINSNEILFNKKDSTDKTNHCIVIKYMKAVGDSKVAMDEYYSQLMLG 438

Query: 426 GHNRISIHNVCEDSLLATPLIIDLLVMAEFCTRVSYKRVGDGSTEYGKFYNILSFLSYWL 485
           GHNRISIHNVCEDSLLA+P+IIDLLVM EF +R++YK++G+   E+ KFY ILSFLSYWL
Sbjct: 439 GHNRISIHNVCEDSLLASPIIIDLLVMTEFLSRITYKKMGEDQ-EFHKFYPILSFLSYWL 497

Query: 486 KAPLTRKGYQAINGLNKQRSGLENFMRLLIGLPAQDELRFEERLK 530
           KAPLTR G++ IN LN+QR  LENF+RLL+GLP  DELRFEERL+
Sbjct: 498 KAPLTRSGFKPINSLNRQRLALENFLRLLVGLPPNDELRFEERLR 542

>Kpol_2001.17 s2001 (48908..50323) [1416 bp, 471 aa] {ON}
           (48908..50323) [1416 nt, 472 aa]
          Length = 471

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/471 (70%), Positives = 383/471 (81%), Gaps = 10/471 (2%)

Query: 68  MLVGIGGNNGTTFLASILANRQKMKFHNK--EGLKEANYYGSVTQCSTLKLGVRPDGN-D 124
           MLVG+GGNNGTTFLAS+LAN+  ++F++K  +GLK+ANYYGSVTQ ST+KLG+ P+ N D
Sbjct: 1   MLVGLGGNNGTTFLASVLANKNNLEFYSKNFKGLKKANYYGSVTQSSTIKLGINPETNED 60

Query: 125 FYVPFNSLLPFVSPNDFEVTGWDISATNLGDAMERAQVLEYDLQRQLKPEMSEYKPLPSI 184
            Y+PFN +LPFV+PNDF V+GWDI+ +N  +AM+RA VLEYDLQ +LK  M +  PL SI
Sbjct: 61  VYIPFNEILPFVNPNDFVVSGWDINNSNCSEAMQRACVLEYDLQSKLKDYMKDVTPLKSI 120

Query: 185 YYPDFIAANQDGRADNCINRPNN--AGPASTKNKWEHLERIRADIREFKQQKDLDKVIVL 242
           YYPDFIA NQ+ RA+N INR  N  +    +K KW H+E IR DIR FK + +LDKVIVL
Sbjct: 121 YYPDFIAINQNERANNVINRGTNDLSLENLSKGKWSHVEHIRNDIRNFKNENNLDKVIVL 180

Query: 243 WTANTERYADIIPGVNDTADNLLNAIKQDGEEIAPSTIFAVASILEGSVYINGSPQNTFV 302
           WTANTERY+ I  G+NDTADNL+N+IK D  E++PSTIFAVASILEG  YINGSPQNTFV
Sbjct: 181 WTANTERYSVIENGINDTADNLINSIKNDHAEVSPSTIFAVASILEGVPYINGSPQNTFV 240

Query: 303 PGVIELAEREDSFIAGDDFKSGQTKIKSVLAQFLVEAGIKPTSIASYNHLGNNDGYNLSS 362
           PGVIELAERE SFIAGDDFKSGQTK+KSVLAQFLV+AGIKP SIASYNHLGNNDGYNLSS
Sbjct: 241 PGVIELAEREHSFIAGDDFKSGQTKMKSVLAQFLVDAGIKPLSIASYNHLGNNDGYNLSS 300

Query: 363 ERQFXXXXXXXXXXXXXXXXXNPLLYNDKLGNKIDHCIVIKYMNAVGDSKVAMDEYYSEL 422
             QF                 N +L+NDK+G  IDHCIVIKYMNAVGDSKVAMDEYYSEL
Sbjct: 301 PMQFKSKEISKRGVCDDMIESNQILFNDKVGKTIDHCIVIKYMNAVGDSKVAMDEYYSEL 360

Query: 423 MLGGHNRISIHNVCEDSLLATPLIIDLLVMAEFCTRVSYKRVGDGS----TEYGKFYNIL 478
           MLGGHNRISIHNVCEDSLLATPLIIDLLVM EFCTRV+YK++ DG+     E+  FY +L
Sbjct: 361 MLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCTRVTYKKL-DGADATKKEFEPFYPVL 419

Query: 479 SFLSYWLKAPLTRKGYQAINGLNKQRSGLENFMRLLIGLPAQDELRFEERL 529
           + LSYWLKAPLTR G++AINGL KQR+ LENFMRLLIGLP  DELRFEERL
Sbjct: 420 TLLSYWLKAPLTRPGFKAINGLMKQRAALENFMRLLIGLPPLDELRFEERL 470

>NCAS0I02750 Chr9 (510393..512144) [1752 bp, 583 aa] {ON} Anc_1.195
           YJL153C
          Length = 583

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/524 (62%), Positives = 402/524 (76%), Gaps = 7/524 (1%)

Query: 10  SVKVATDKVHYSETE--LTTKYTYVNSIVTENAATNTVDVNPIKQEYDFKVDLKLPRVGV 67
           +V +AT K  YS  +  L T Y Y  S V  N A  ++ V+  +Q+Y FK+DLK+P+VGV
Sbjct: 62  NVVLATGKCQYSAKDNVLLTDYKYKTSTVKNNKADGSIKVSLEEQDYKFKIDLKVPKVGV 121

Query: 68  MLVGIGGNNGTTFLASILANRQKMKFHNKEGLKEANYYGSVTQCSTLKLGVRPD-GNDFY 126
           MLVG GGNNG+T LASILAN+  + FHNK+G  + NY GS+TQ +T+ LG   + G DF+
Sbjct: 122 MLVGFGGNNGSTLLASILANKHNISFHNKDGEIKPNYLGSMTQSATVHLGRDEETGRDFF 181

Query: 127 VPFNSLLPFVSPNDFEVTGWDISATNLGDAMERAQVLEYDLQRQLKPEMSEYKPLPSIYY 186
            PFN++LP V+PND  VTGWDIS  NL ++M+RAQVL+YDLQRQL P M EY P+ SIYY
Sbjct: 182 QPFNAVLPMVNPNDLIVTGWDISNLNLAESMQRAQVLDYDLQRQLTPLMKEYTPMKSIYY 241

Query: 187 PDFIAANQDGRADNCINRPNNAGPASTKNKWEHLERIRADIREFKQQKDLDKVIVLWTAN 246
           P+FIAANQ  RA+NCIN  +     +TK KW+H+ ++R+DI+ FK +  LDKVIVLWTAN
Sbjct: 242 PEFIAANQFDRANNCIN--SKGDEFTTKGKWDHMMQVRSDIKTFKTENQLDKVIVLWTAN 299

Query: 247 TERYADIIPGVNDTADNLLNAIKQDGEEIAPSTIFAVASILEGSVYINGSPQNTFVPGVI 306
           TE++A I+PGVNDT +NLL AIK D EEIAPST+FAVASILEG  YINGSPQNTFVPG+I
Sbjct: 300 TEKFAQIVPGVNDTHENLLQAIKNDHEEIAPSTLFAVASILEGVPYINGSPQNTFVPGLI 359

Query: 307 ELAEREDSFIAGDDFKSGQTKIKSVLAQFLVEAGIKPTSIASYNHLGNNDGYNLSSERQF 366
           +LAE E+  IAGDDFK+GQTK+KSVL QFLV+AGI+P SIASYNHLGNNDG NLSS+ QF
Sbjct: 360 KLAEHENVLIAGDDFKTGQTKLKSVLTQFLVDAGIRPVSIASYNHLGNNDGKNLSSQMQF 419

Query: 367 XXXXXXXXXXXXXXXXXNPLLY-NDKLGNKIDHCIVIKYMNAVGDSKVAMDEYYSELMLG 425
                            N ++Y +D    +IDHCIVIKYM AVGDSKVAMDEYY+ELMLG
Sbjct: 420 KSKEISKSGVINDILESNSIMYGDDPEKARIDHCIVIKYMPAVGDSKVAMDEYYNELMLG 479

Query: 426 GHNRISIHNVCEDSLLATPLIIDLLVMAEFCTRVSYKRVGDGSTEYGKFYNILSFLSYWL 485
           GHNRIS+HNVCEDSLLA P+I+DL++M EFC+RV+YK   D   +Y KF+ +L+ LSYWL
Sbjct: 480 GHNRISLHNVCEDSLLAAPIILDLVIMCEFCSRVTYKEANDNG-DYKKFHPVLTLLSYWL 538

Query: 486 KAPLTRKGYQAINGLNKQRSGLENFMRLLIGLPAQDELRFEERL 529
           KAPL R+ +  +NGL KQR+ LENFMRLLIGLPA DELRFEERL
Sbjct: 539 KAPLAREDFLPVNGLMKQRAALENFMRLLIGLPANDELRFEERL 582

>KNAG0C02520 Chr3 complement(492578..494356) [1779 bp, 592 aa] {ON}
           Anc_1.195 YJL153C
          Length = 592

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/512 (65%), Positives = 392/512 (76%), Gaps = 6/512 (1%)

Query: 24  ELTTKYTYVNSIVTENAATNTV-DVNPIKQEYDFKVDLKLP-RVGVMLVGIGGNNGTTFL 81
           EL + + Y N+++  + +T  V  ++P +  Y+FKVDL +P +VGV+LVG GGNNG+T L
Sbjct: 80  ELVSSFKYQNTVIDTDPSTGAVRGLSPREINYNFKVDLSVPEKVGVLLVGFGGNNGSTLL 139

Query: 82  ASILANRQKMKFHNKEGLKEANYYGSVTQCSTLKLGVRPDGNDFYVPFNSLLPFVSPNDF 141
           ASILANRQKM F+NKEG + AN++GS+TQ ST+KLGV   GND +VPFNS+LP   P +F
Sbjct: 140 ASILANRQKMVFNNKEGPQRANFFGSMTQSSTMKLGVDVKGNDVFVPFNSVLPMADPTEF 199

Query: 142 EVTGWDISATNLGDAMERAQVLEYDLQRQLKPEMSEYKPLPSIYYPDFIAANQDGRADNC 201
            V GWDI+  NL +AM+R  VLEYDLQ +LK +M    P+ S+YYPDFIA NQ  RA+NC
Sbjct: 200 VVDGWDINNANLFEAMQRGHVLEYDLQMKLKSQMENIVPMKSVYYPDFIALNQFDRANNC 259

Query: 202 INRPNNAGPASTKNKWEHLERIRADIREFKQQKDLDKVIVLWTANTERYADIIPGVNDTA 261
           IN        ST  K + LE+IR DIR FK    LDKVIVLWTANTER  DIIP VND+A
Sbjct: 260 INATQGGEGFSTAQKRKDLEQIRKDIRHFKATNKLDKVIVLWTANTERCVDIIPSVNDSA 319

Query: 262 DNLLNAIKQDGEEIAPSTIFAVASILEGSVYINGSPQNTFVPGVIELAEREDSFIAGDDF 321
           D+LL AI+ + EEIAPSTIFA ASILEG  YINGSPQNTFVPG+I+LAER D  IAGDDF
Sbjct: 320 DSLLKAIEDNHEEIAPSTIFAAASILEGVPYINGSPQNTFVPGLIDLAERHDVLIAGDDF 379

Query: 322 KSGQTKIKSVLAQFLVEAGIKPTSIASYNHLGNNDGYNLSSERQFXXXXXXXXXXXXXXX 381
           KSGQTK+KSVL QFLV+AGIKP SIASYNHLGNNDG NLSS+RQF               
Sbjct: 380 KSGQTKLKSVLMQFLVDAGIKPVSIASYNHLGNNDGKNLSSQRQFRSKEISKSSVIDDCI 439

Query: 382 XXNPLLYND-KLGNKIDHCIVIKYMNAVGDSKVAMDEYYSELMLGGHNRISIHNVCEDSL 440
             N +LYND K  +K++HCIVIKY+ AVGDSKVAMDEYYSELMLGGHNRISIHNVCEDSL
Sbjct: 440 QSNKILYNDHKDKSKVNHCIVIKYLPAVGDSKVAMDEYYSELMLGGHNRISIHNVCEDSL 499

Query: 441 LATPLIIDLLVMAEFCTRVSYKRVGDG---STEYGKFYNILSFLSYWLKAPLTRKGYQAI 497
           LA PLIIDLLVM EF +R+ Y+++ DG   S ++  FY IL+FLSYWLKAPLTRKG+Q I
Sbjct: 500 LAAPLIIDLLVMTEFFSRIKYQKIEDGAPPSDKFSDFYPILTFLSYWLKAPLTRKGFQPI 559

Query: 498 NGLNKQRSGLENFMRLLIGLPAQDELRFEERL 529
           N LN+QR  LENF+RLLIGLP  DELRFEERL
Sbjct: 560 NSLNRQRLALENFLRLLIGLPPNDELRFEERL 591

>NDAI0B00120 Chr2 (3784..5487) [1704 bp, 567 aa] {ON} Anc_1.195
           YJL153C
          Length = 567

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/534 (61%), Positives = 404/534 (75%), Gaps = 19/534 (3%)

Query: 15  TDKVHYSETE--LTTKYTYVNSIV--TENAATNTVDVNPIKQEYDFKVDLKLPRVGVMLV 70
           +DK  YS++E  L T YTY  +IV   ++   N ++V+ + ++Y+FKVDLK+P++GVMLV
Sbjct: 33  SDKCKYSQSENALLTNYTYNKTIVDIQQSHNNNNINVSTLTKDYNFKVDLKIPKIGVMLV 92

Query: 71  GIGGNNGTTFLASILANRQKMKFHNKEG---LKE-ANYYGSVTQCSTLKLGVRPDGN-DF 125
           G+GGNNGTTFLAS+LAN+  + F+NK+G   +KE   + GS+TQ STL LG     N D 
Sbjct: 93  GMGGNNGTTFLASLLANKNNLTFNNKDGPYNIKERGGFLGSMTQSSTLYLGKNQQTNEDV 152

Query: 126 YVPFNSLLPFVSPNDFEVTGWDISATNLGDAMERAQVLEYDLQRQLKPEMSEYKPLPSIY 185
           YVPFNS+LP  +PND  ++GWDIS  N+  AM+RA+VLEYDLQ +LKP M  Y PL SIY
Sbjct: 153 YVPFNSILPMCNPNDLIISGWDISGENMFKAMQRAKVLEYDLQEKLKPLMESYTPLKSIY 212

Query: 186 YPDFIAANQDGRADNCIN---RPNNAGPASTKNKWEHLERIRADIREFKQQKDLDKVIVL 242
           YPDFIA NQ  RADNCIN   +  N    S KNKW  L  IR +I++FK    LDKVI+L
Sbjct: 213 YPDFIAMNQLDRADNCINYTTKGTNHDAYSIKNKWNDLLTIRQNIKDFKNDNKLDKVIIL 272

Query: 243 WTANTERYADIIPGVNDTADNLLNAIKQDGEEIAPSTIFAVASILEGSVYINGSPQNTFV 302
           WTA TE++A++IPG+NDT +NLLN+IK + +EIAPSTIFA ASILE   YINGSPQNTFV
Sbjct: 273 WTATTEKFAEVIPGINDTFENLLNSIKANHKEIAPSTIFATASILENCPYINGSPQNTFV 332

Query: 303 PGVIELAEREDSFIAGDDFKSGQTKIKSVLAQFLVEAGIKPTSIASYNHLGNNDGYNLSS 362
           PG+I+LAERE+  IAGDDFK+GQTK+KSVLAQFL++AGIKP SIASYNHLGNNDG NLSS
Sbjct: 333 PGLIDLAERENVLIAGDDFKTGQTKLKSVLAQFLIDAGIKPISIASYNHLGNNDGLNLSS 392

Query: 363 ERQFXXXXXXXXXXXXXXXXXNPLLY--NDKLGNK---IDHCIVIKYMNAVGDSKVAMDE 417
             QF                 N +LY  +DK+  K   +DHCIVIKYM ++GDSKVAMDE
Sbjct: 393 SLQFKSKEITKSNVIDDMIKSNQILYPQSDKMKKKNKDVDHCIVIKYMESIGDSKVAMDE 452

Query: 418 YYSELMLGGHNRISIHNVCEDSLLATPLIIDLLVMAEFCTRVSYKRVGD--GSTEYGKFY 475
           YY+ELMLGGHNRISIHNVCEDSLLA+P+I+DL++M EFC+R++Y   G+  G   Y +FY
Sbjct: 453 YYNELMLGGHNRISIHNVCEDSLLASPIILDLIIMCEFCSRITYIESGNQQGDGNYQQFY 512

Query: 476 NILSFLSYWLKAPLTRKGYQAINGLNKQRSGLENFMRLLIGLPAQDELRFEERL 529
            +LS LSYWLKAPLTR GY+ INGLNKQR  L+NFMRLLIGLP  DELRFEERL
Sbjct: 513 PVLSLLSYWLKAPLTRPGYEPINGLNKQRMALDNFMRLLIGLPPIDELRFEERL 566

>KLLA0F21846g Chr6 complement(2033135..2034265) [1131 bp, 376 aa]
           {ON} similar to uniprot|P38779 Saccharomyces cerevisiae
           YHR052W CIC1 Core interacting component 1 ribosome
           biogenesis protein
          Length = 376

 Score = 31.2 bits (69), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%)

Query: 37  TENAATNTVDVNPIKQEYDFKVDLKLPRVGVMLVGIGG 74
           ++N    T  VN IK+ YD K+ +KLPR   M V +G 
Sbjct: 197 SDNKFNKTTLVNSIKRIYDTKIPVKLPRGNTMNVHLGS 234

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,382,742
Number of extensions: 2540161
Number of successful extensions: 6912
Number of sequences better than 10.0: 20
Number of HSP's gapped: 7049
Number of HSP's successfully gapped: 20
Length of query: 530
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 416
Effective length of database: 40,409,475
Effective search space: 16810341600
Effective search space used: 16810341600
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)