Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0G14344g8.848ON47247225160.0
Kpol_1068.28.848ON49148514030.0
TDEL0A079708.848ON48948513800.0
Suva_13.4728.848ON51049013640.0
Ecym_46238.848ON48047813460.0
YMR283C (RIT1)8.848ON51349813480.0
NCAS0C003508.848ON48648913410.0
Skud_13.4558.848ON49449613310.0
KAFR0B039808.848ON48348113281e-180
KLTH0C03696g8.848ON47447113241e-180
Smik_13.4968.848ON49449613251e-180
TPHA0I003008.848ON49349013231e-180
Kwal_27.102198.848ON50048113201e-179
SAKL0D01276g8.848ON50248113171e-179
NDAI0K003508.848ON50451413031e-176
KNAG0J002208.848ON49949213011e-176
KLLA0D01386g8.848ON48949212821e-173
AFR451C8.848ON40841310101e-134
KLTH0E07634g4.104ON544165870.049
NDAI0D034804.121ON708105820.19
Kwal_56.234428.228ON1435137705.8
TBLA0E049104.375ON1679113706.2
AGR204W8.560ON83495697.5
KLTH0F04334g1.162ON63477689.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0G14344g
         (472 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0G14344g Chr7 complement(1148368..1149786) [1419 bp, 472 aa]...   973   0.0  
Kpol_1068.2 s1068 (2343..3818) [1476 bp, 491 aa] {ON} (2343..381...   545   0.0  
TDEL0A07970 Chr1 (1391841..1393310) [1470 bp, 489 aa] {ON} Anc_8...   536   0.0  
Suva_13.472 Chr13 complement(818023..819555) [1533 bp, 510 aa] {...   530   0.0  
Ecym_4623 Chr4 (1219438..1220880) [1443 bp, 480 aa] {ON} similar...   523   0.0  
YMR283C Chr13 complement(835326..836867) [1542 bp, 513 aa] {ON} ...   523   0.0  
NCAS0C00350 Chr3 (51842..53302) [1461 bp, 486 aa] {ON} Anc_8.848...   521   0.0  
Skud_13.455 Chr13 complement(808556..810040) [1485 bp, 494 aa] {...   517   0.0  
KAFR0B03980 Chr2 complement(832133..833584) [1452 bp, 483 aa] {O...   516   e-180
KLTH0C03696g Chr3 (320129..321553) [1425 bp, 474 aa] {ON} simila...   514   e-180
Smik_13.496 Chr13 complement(818336..819820) [1485 bp, 494 aa] {...   514   e-180
TPHA0I00300 Chr9 complement(57211..58692) [1482 bp, 493 aa] {ON}...   514   e-180
Kwal_27.10219 s27 (246213..247715) [1503 bp, 500 aa] {ON} YMR283...   513   e-179
SAKL0D01276g Chr4 (96411..97919) [1509 bp, 502 aa] {ON} similar ...   511   e-179
NDAI0K00350 Chr11 complement(66993..68507) [1515 bp, 504 aa] {ON...   506   e-176
KNAG0J00220 Chr10 (29017..30516) [1500 bp, 499 aa] {ON} Anc_8.84...   505   e-176
KLLA0D01386g Chr4 (118965..120434) [1470 bp, 489 aa] {ON} simila...   498   e-173
AFR451C Chr6 complement(1248648..1249874) [1227 bp, 408 aa] {ON}...   393   e-134
KLTH0E07634g Chr5 (697160..698794) [1635 bp, 544 aa] {ON} simila...    38   0.049
NDAI0D03480 Chr4 complement(818292..820418) [2127 bp, 708 aa] {O...    36   0.19 
Kwal_56.23442 s56 (536368..540675) [4308 bp, 1435 aa] {ON} YER16...    32   5.8  
TBLA0E04910 Chr5 complement(1255397..1260436) [5040 bp, 1679 aa]...    32   6.2  
AGR204W Chr7 (1140088..1142592) [2505 bp, 834 aa] {ON} Syntenic ...    31   7.5  
KLTH0F04334g Chr6 complement(382773..384677) [1905 bp, 634 aa] {...    31   9.8  

>ZYRO0G14344g Chr7 complement(1148368..1149786) [1419 bp, 472 aa]
           {ON} similar to uniprot|P23796 Saccharomyces cerevisiae
           YMR283C RIT1 Modifies initiator methionine tRNA to
           distinguish it from elongator methionine tRNA Initiator
           methionine tRNA 2'-O-ribosyl phosphate transferase
          Length = 472

 Score =  973 bits (2516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/472 (100%), Positives = 472/472 (100%)

Query: 1   MDPDLAFSLNQINRDIKKEYTSLRNRIQSILFDNAFIAQRVIPRFPNYPLIPNERCGLWY 60
           MDPDLAFSLNQINRDIKKEYTSLRNRIQSILFDNAFIAQRVIPRFPNYPLIPNERCGLWY
Sbjct: 1   MDPDLAFSLNQINRDIKKEYTSLRNRIQSILFDNAFIAQRVIPRFPNYPLIPNERCGLWY 60

Query: 61  CDPKDFDQTSYFKSTDGHTNQWDFSTRRLNLHLLPILQEKNGIIIVDSTRRGKLMPDALS 120
           CDPKDFDQTSYFKSTDGHTNQWDFSTRRLNLHLLPILQEKNGIIIVDSTRRGKLMPDALS
Sbjct: 61  CDPKDFDQTSYFKSTDGHTNQWDFSTRRLNLHLLPILQEKNGIIIVDSTRRGKLMPDALS 120

Query: 121 KTIPIWCAVLNSLMQPDKSEVLFTPPKCVSQSEHDSIKTRIPSLVDRLEKLDILDAQDLR 180
           KTIPIWCAVLNSLMQPDKSEVLFTPPKCVSQSEHDSIKTRIPSLVDRLEKLDILDAQDLR
Sbjct: 121 KTIPIWCAVLNSLMQPDKSEVLFTPPKCVSQSEHDSIKTRIPSLVDRLEKLDILDAQDLR 180

Query: 181 NKFQGKILRPFWVYPGSDMLRSSTDPFTGEIIEIQWEPGPNEQIIPIILCTASYRAQDGV 240
           NKFQGKILRPFWVYPGSDMLRSSTDPFTGEIIEIQWEPGPNEQIIPIILCTASYRAQDGV
Sbjct: 181 NKFQGKILRPFWVYPGSDMLRSSTDPFTGEIIEIQWEPGPNEQIIPIILCTASYRAQDGV 240

Query: 241 DKRHGFTYVQGAADDHELWSCGLDPKLLWNNWHYFHDLDRNDKELESHVKTLIELAETTD 300
           DKRHGFTYVQGAADDHELWSCGLDPKLLWNNWHYFHDLDRNDKELESHVKTLIELAETTD
Sbjct: 241 DKRHGFTYVQGAADDHELWSCGLDPKLLWNNWHYFHDLDRNDKELESHVKTLIELAETTD 300

Query: 301 HRNHLADIVEMDPITKELSLGKLKDHTAITPNIARELDSQFSLVIILSQSVTLSKPFDFI 360
           HRNHLADIVEMDPITKELSLGKLKDHTAITPNIARELDSQFSLVIILSQSVTLSKPFDFI
Sbjct: 301 HRNHLADIVEMDPITKELSLGKLKDHTAITPNIARELDSQFSLVIILSQSVTLSKPFDFI 360

Query: 361 KTYNLQSGSKRSSKDLRAALIEIDHIVSAHLNKDVVKRKPIMVCCNSGTDISVGVILMIL 420
           KTYNLQSGSKRSSKDLRAALIEIDHIVSAHLNKDVVKRKPIMVCCNSGTDISVGVILMIL
Sbjct: 361 KTYNLQSGSKRSSKDLRAALIEIDHIVSAHLNKDVVKRKPIMVCCNSGTDISVGVILMIL 420

Query: 421 CKYYSQDWLLGKPDSVNKFVIRRHLVQIINKIKRRNVNPSRATLNSINSFLM 472
           CKYYSQDWLLGKPDSVNKFVIRRHLVQIINKIKRRNVNPSRATLNSINSFLM
Sbjct: 421 CKYYSQDWLLGKPDSVNKFVIRRHLVQIINKIKRRNVNPSRATLNSINSFLM 472

>Kpol_1068.2 s1068 (2343..3818) [1476 bp, 491 aa] {ON} (2343..3818)
           [1476 nt, 492 aa]
          Length = 491

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/485 (56%), Positives = 346/485 (71%), Gaps = 23/485 (4%)

Query: 7   FSLNQINRDIKKEYTSLRNRIQSILFDNAFIAQRVIPRFPNYPLIPNERCGLWYCDPKDF 66
           +S+NQI++DIKKEY SL+NRIQSIL D  F+   VIP FP +P+IPNERCGLWYC+PK F
Sbjct: 9   YSINQIHKDIKKEYKSLKNRIQSILLDARFLEDTVIPFFPEFPVIPNERCGLWYCNPKLF 68

Query: 67  DQTSYFKSTDGHTNQWDFSTRRLNLHLLPILQEKNGIIIVDSTRRGKLMPDALSKTIPIW 126
           +QTSYFKSTDGH NQWDFSTRRLN HLLP L +  GI+IVDSTRRGK +PDALSKT+PIW
Sbjct: 69  EQTSYFKSTDGHINQWDFSTRRLNFHLLPTLAQNGGIVIVDSTRRGKKIPDALSKTVPIW 128

Query: 127 CAVLNSLM-------QPDKSEVLFTPPKCVSQSEHDSIKTRIPSLVDRLEKLDILDAQDL 179
           CAVLNSLM         D S+VLF PP  V  SE+  I  ++P L++RL KL I+D  DL
Sbjct: 129 CAVLNSLMLESVDQLNDDYSKVLFVPPSTVPNSEYQRILKKLPLLIERLNKLAIIDGSDL 188

Query: 180 RNKFQGKILRPFWVYPGSDMLRSSTDPFTGEIIEIQWEPGPNEQIIPIILCTASYRAQDG 239
             +F GK+LRP W++PGS +L+S+TD FTGE     WE   +E+IIPIILCT SYRAQDG
Sbjct: 189 YKQFNGKLLRPIWIHPGSSLLQSTTDIFTGESTNDVWETPEDEEIIPIILCTVSYRAQDG 248

Query: 240 VDKRHGFTYVQGAADDHELWSCGLDPKLLWNNWHYFHDLDRNDKELESHVKTLI-----E 294
           VDKRHGFTYVQGAADDHELWS GL+P + W+N   F+DLDR++  L+S V+ L+     E
Sbjct: 249 VDKRHGFTYVQGAADDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTVEDLLAAKQKE 308

Query: 295 LAETTDHRNHLADIVEMDPITKELSLGKLKDHTAITPNIARELDSQFSLVIILSQSVTLS 354
           ++ET      L     +D IT ++ LGK+ D   I  ++  EL S+FS+VI+ S+S  LS
Sbjct: 309 VSET----ETLEAFNPLDMITTDIFLGKIADGLIIGDSLTSELLSKFSMVIVFSESCKLS 364

Query: 355 ------KPFDFIKTYNLQSGSKRSSKDLRAALIEIDHIVSAHLNKDVVKRK-PIMVCCNS 407
                 K    I    LQSGSK+SSK LR  L E+   +    + D  K + PI++CCNS
Sbjct: 365 VSKNEEKITQRIVINQLQSGSKKSSKALRKTLPELHSRIEPFFSTDKAKSELPILICCNS 424

Query: 408 GTDISVGVILMILCKYYSQDWLLGKPDSVNKFVIRRHLVQIINKIKRRNVNPSRATLNSI 467
           GTD+S+ ++LM+LCK+Y  DW   KP+ VNK +IR+HL ++I+ +K RNVNPSRATLNS+
Sbjct: 425 GTDMSIALVLMLLCKHYDLDWNTSKPNEVNKIIIRKHLTKLISHLKGRNVNPSRATLNSV 484

Query: 468 NSFLM 472
           N +LM
Sbjct: 485 NEYLM 489

>TDEL0A07970 Chr1 (1391841..1393310) [1470 bp, 489 aa] {ON}
           Anc_8.848 YMR283C
          Length = 489

 Score =  536 bits (1380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/485 (54%), Positives = 347/485 (71%), Gaps = 14/485 (2%)

Query: 1   MDPDLAFSLNQINRDIKKEYTSLRNRIQSILFDNAFIAQRVIPRFPNYPLIPNERCGLWY 60
           MD +   SL  IN+DIKKEY SLRNR+QSIL D  F+   V+P FP YPL+PNERCGLWY
Sbjct: 6   MDNNFIDSLRCINKDIKKEYKSLRNRLQSILLDYTFLCTEVLPCFPEYPLVPNERCGLWY 65

Query: 61  CDPKDFDQTSYFKSTDGHTNQWDFSTRRLNLHLLPILQEKNGIIIVDSTRRGKLMPDALS 120
           C+PKDF QTSYFKSTDGHTNQWDFS+RRLN H++P + + NGIIIVDSTRRGK +PDALS
Sbjct: 66  CNPKDFTQTSYFKSTDGHTNQWDFSSRRLNFHIIPTIAKSNGIIIVDSTRRGKKVPDALS 125

Query: 121 KTIPIWCAVLNSLMQPD-----KSEVLFTPPKCVSQSEHDSIKTRIPSLVDRLEKLDILD 175
           KTIPIWCAVLN LM        K E L+ PP+ VS+SE  SIK+RIP LV++L+ L++++
Sbjct: 126 KTIPIWCAVLNHLMLESQGGSVKQETLYVPPETVSESEFYSIKSRIPELVEKLKSLEVIN 185

Query: 176 AQDLRNKFQGKILRPFWVYPGSDMLRSSTDPFTGEIIEIQWEPGPNEQIIPIILCTASYR 235
            ++L  +  GK+LRPFW+YPGS +L+S+TD FTGE+   +W P  N  IIPIILCT SY+
Sbjct: 186 GKELHKQLGGKLLRPFWIYPGSSILQSTTDIFTGEVTSDKWIPVDN-SIIPIILCTVSYQ 244

Query: 236 AQDGVDKRHGFTYVQGAADDHELWSCGLDPKLLWNNWHYFHDLDRNDKELESHVKTLIEL 295
           AQDGVDKR GFTYVQGAADDHELWS GL+ K+ W+N     + + +++ELE  V  L   
Sbjct: 245 AQDGVDKRRGFTYVQGAADDHELWSHGLNAKIFWSNIDILGNQESSEEELERFVSQLSLR 304

Query: 296 AETTDHRNHLADIV-EMDPITKELSLGKLKDHTAITPNIARELDSQFSLVIILSQSVTLS 354
                     +D   ++D +T ELSLG + D+    P +  E+    SLVI+LSQSV   
Sbjct: 305 GCDLSKEIQFSDAFPQIDLVTPELSLGLVIDNLEFNPKLIGEIRQAHSLVIVLSQSVNFP 364

Query: 355 KPF-------DFIKTYNLQSGSKRSSKDLRAALIEIDHIVSAHLNKDVVKRKPIMVCCNS 407
           +         +FI  + LQSGSK SS++L+  L++I  ++  H+     +RKP+++CCNS
Sbjct: 365 QKVAEMENASEFISIHKLQSGSKVSSRNLKTELLKIVPLIEKHILDLDKQRKPVLICCNS 424

Query: 408 GTDISVGVILMILCKYYSQDWLLGKPDSVNKFVIRRHLVQIINKIKRRNVNPSRATLNSI 467
           GTD+S+G++L++LC+ Y+ DW L  P SV+K V+++HL ++I+ +K RNVNP RATLNS+
Sbjct: 425 GTDMSIGLLLVVLCRNYNMDWQLNTPTSVSKIVVKKHLAKLISHLKGRNVNPPRATLNSV 484

Query: 468 NSFLM 472
           NS+LM
Sbjct: 485 NSYLM 489

>Suva_13.472 Chr13 complement(818023..819555) [1533 bp, 510 aa] {ON}
           YMR283C (REAL)
          Length = 510

 Score =  530 bits (1364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/490 (54%), Positives = 344/490 (70%), Gaps = 22/490 (4%)

Query: 5   LAFSLNQINRDIKKEYTSLRNRIQSILFDNAFIAQRVIPRFPNYPLIPNERCGLWYCDPK 64
           L+ SL+QIN+D++KE  S+RNR+QSIL DN F+  RV+P FP +P++PNERCGLWYC+P 
Sbjct: 21  LSLSLSQINKDVRKENKSVRNRLQSILLDNRFLRDRVLPIFPRFPIVPNERCGLWYCEPS 80

Query: 65  DFDQTSYFKSTDGHTNQWDFSTRRLNLHLLPILQEKNGIIIVDSTRRGKLMPDALSKTIP 124
            F+QTSYFKSTDGH NQWDFSTRRLN HLL I+QE  GIIIVDSTRRGK +PDALSKT+P
Sbjct: 81  SFEQTSYFKSTDGHVNQWDFSTRRLNFHLLEIIQENKGIIIVDSTRRGKKIPDALSKTVP 140

Query: 125 IWCAVLNSLMQPDKSE------VLFTPPKCVSQSEHDSIKTRIPSLVDRLEKLDILDAQD 178
           IWCAVLN++M  +  E      VL+ PP+ V +SE+D IK +IP LVD+L+KL+ +D++ 
Sbjct: 141 IWCAVLNTIMLQETEENVDIDKVLYVPPETVPKSEYDMIKRKIPELVDKLQKLNAIDSKT 200

Query: 179 LRNKFQGKILRPFWVYPGSDMLRSSTDPFTGEIIEIQ-WEPGPNEQIIPIILCTASYRAQ 237
           L   F+GKILRP WV+PGS +L  S D FTGEI E + WE   ++ IIPIILCT SY+AQ
Sbjct: 201 LNKLFKGKILRPIWVHPGSSLLNHSVDCFTGEIEEQEIWESPEDQNIIPIILCTVSYQAQ 260

Query: 238 DGVDKRHGFTYVQGAADDHELWSCGLDPKLLWNNWHYFHDLDRNDKELESHVKTLI---- 293
           DG+DKR+GFTYVQGAADDHELWS GLD K+ W++  Y  D + +D +L +++  LI    
Sbjct: 261 DGMDKRYGFTYVQGAADDHELWSFGLDSKMFWSHIDYLGDTNNSDDQLCAYITDLIGKKL 320

Query: 294 ELAETTDHRNHLADIVE-MDPITKELSLGKLKDHTAITPNIARELDSQFSLVIILSQSVT 352
           E   +   + +L DI E +D IT E+SLGK+     I   + +EL   +  VII S SV 
Sbjct: 321 EYQLSIQDKGNLDDIFENIDKITNEISLGKVIQGLTINEKLEKELKVHYEKVIIFSNSVA 380

Query: 353 LSKPFD---------FIKTYNLQSGSKRSSKDLRAALIEIDHIVSAHLNKDVVKRKPIMV 403
           ++   D         FI  Y LQSG K+SSK LR+    I   V           KPI+V
Sbjct: 381 IAAHADSVEESRTDSFISVYKLQSGDKKSSKALRSTFPMIHQEVQPVFANPAKGMKPILV 440

Query: 404 CCNSGTDISVGVILMILCKYYSQDWLL-GKPDSVNKFVIRRHLVQIINKIKRRNVNPSRA 462
           CCN+GTD+S+GVIL ILC  Y+++W+L  +   VNK +IR+HL ++I+ +  RNVNPSRA
Sbjct: 441 CCNTGTDMSIGVILSILCAKYNEEWILTSELPVVNKIIIRKHLTKLISHLHGRNVNPSRA 500

Query: 463 TLNSINSFLM 472
           TLNS+NSFLM
Sbjct: 501 TLNSVNSFLM 510

>Ecym_4623 Chr4 (1219438..1220880) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR451C
          Length = 480

 Score =  523 bits (1346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/478 (52%), Positives = 341/478 (71%), Gaps = 19/478 (3%)

Query: 8   SLNQINRDIKKEYTSLRNRIQSILFDNAFIAQRVIPRFPNYPLIPNERCGLWYCDPKDFD 67
           +L QI ++I+++ TSLRNR+QS+ +D+ FIA  V+P FPNYPL+PNERCGLWYC+P  ++
Sbjct: 9   TLKQIKKEIRRDCTSLRNRLQSVFYDSKFIANEVLPMFPNYPLVPNERCGLWYCNPGKYE 68

Query: 68  QTSYFKSTDGHTNQWDFSTRRLNLHLLPILQEKNGIIIVDSTRRGKLMPDALSKTIPIWC 127
           QT YFKSTDGHTNQWDFSTRRLN H+L  + E  GIIIVDSTRRGK MPDALSKTIPIWC
Sbjct: 69  QTCYFKSTDGHTNQWDFSTRRLNFHILSKMAEAGGIIIVDSTRRGKKMPDALSKTIPIWC 128

Query: 128 AVLNSLM-----QPDKSEVLFTPPKCVSQSEHDSIKTRIPSLVDRLEKLDILDAQDLRNK 182
           AVLN+LM     + D    LF PP  VS+ E D I +++P LV++L+KL+I+  ++L N 
Sbjct: 129 AVLNNLMLDYKGKEDSIPSLFCPPGTVSKLEFDGIHSKVPDLVEKLKKLNIISGEELYNM 188

Query: 183 FQGKILRPFWVYPGSDMLRSSTDPFTGEIIEIQWEPGPNEQIIPIILCTASYRAQDGVDK 242
           FQGK+LRPFWVYPGS +L +S D FTGE++   W+   N   IP+ILCTASY+ QDG DK
Sbjct: 189 FQGKVLRPFWVYPGSPLLDTSRDIFTGEVLGNVWQSEQNS--IPVILCTASYQCQDGEDK 246

Query: 243 RHGFTYVQGAADDHELWSCGLDPKLLWNNWHYFHDLDRNDKELESHVKTLIELAETTDHR 302
            HGFTYVQGAADDHELW+ GL+P++ W N  +  D D+++ ELE  V+ +    + T   
Sbjct: 247 HHGFTYVQGAADDHELWANGLNPEIFWKNIEFLGDPDKSEFELEDFVQRIGRTEKLTAQS 306

Query: 303 NHLAD------IVEMDPITKELSLGKLKDHTAITPNIARELDSQFSLVIILSQSVTLSKP 356
           N  +D       +++D ITK L LG + +  A+T NI +EL S++SL II SQSVT    
Sbjct: 307 NKQSDRESSSSFIKVDEITKNLYLGTVAEGIALTENIEKELKSKYSLCIICSQSVTAKAD 366

Query: 357 FDF--IKTYNLQSGSKRSSKDLRAALIEIDHIVSAHLNKDVVKRKPIMVCCNSGTDISVG 414
            +   IK Y + + SK+SS+DLR ALIEI  ++  H+   +    PI++CCN+G DIS+G
Sbjct: 367 CNCERIKVYPINNNSKKSSRDLRVALIEISGLIKQHITDQL----PILICCNTGKDISIG 422

Query: 415 VILMILCKYYSQDWLLGKPDSVNKFVIRRHLVQIINKIKRRNVNPSRATLNSINSFLM 472
           ++L  LC++Y   W L + ++VNK ++++HL +II K+   N+NPSR+TL ++N+FL+
Sbjct: 423 IMLTALCQHYDLQWHLEEQETVNKTIVKKHLARIITKLSGININPSRSTLKNVNAFLL 480

>YMR283C Chr13 complement(835326..836867) [1542 bp, 513 aa] {ON}
           RIT12'-O-ribosyl phosphate transferase, modifies the
           initiator methionine tRNA at position 64 to distinguish
           it from elongator methionine tRNA
          Length = 513

 Score =  523 bits (1348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/498 (53%), Positives = 349/498 (70%), Gaps = 30/498 (6%)

Query: 1   MDPDLAFSLNQINRDIKKEYTSLRNRIQSILFDNAFIAQRVIPRFPNYPLIPNERCGLWY 60
           MD ++  SL+QIN+DI+KE  S+RNR+QSIL DN F+  RVIP FP+YPLIPNERCGLWY
Sbjct: 20  MDENIYLSLSQINKDIRKENKSVRNRLQSILLDNKFLQDRVIPIFPHYPLIPNERCGLWY 79

Query: 61  CDPKDFDQTSYFKSTDGHTNQWDFSTRRLNLHLLPILQEKNGIIIVDSTRRGKLMPDALS 120
           C+P  F QTSYFKSTDGH NQWDFSTRRLN HLL  +++  GIIIVDSTRRGK +PDALS
Sbjct: 80  CNPSSFKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS 139

Query: 121 KTIPIWCAVLNSLMQPDKS------EVLFTPPKCVSQSEHDSIKTRIPSLVDRLEKLDIL 174
           KT+PIWCAVLN+LM  +        +VL+ PP+ V +SE+D IK +IP LV +L+KL+I+
Sbjct: 140 KTVPIWCAVLNTLMLQETEKNVAIDKVLYLPPETVPKSEYDMIKRKIPELVAKLQKLNII 199

Query: 175 DAQDLRNKFQGKILRPFWVYPGSDMLRSSTDPFTGEIIEIQ-WEPGPNEQIIPIILCTAS 233
           D++ L   F GK+LRP WV+PGS +L  S D FTGE+ E + WE   ++ IIPIILCT S
Sbjct: 200 DSKKLNELFMGKLLRPIWVHPGSSLLDHSVDYFTGEVQEYEAWETPEDQNIIPIILCTVS 259

Query: 234 YRAQDGVDKRHGFTYVQGAADDHELWSCGLDPKLLWNNWHYFHDLDRNDKELESHVKTLI 293
           Y+AQDG+DKR+GFTYVQGAADDHELWS GLD  + W +  Y  D   +D +L  ++  L 
Sbjct: 260 YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSNMFWAHIEYLGDASYSDDQLHDYIMDLA 319

Query: 294 ELAETTDHRNHLAD-------IVEMDPITKELSLGKLKDHTAITPNIARELDSQFSLVII 346
             A    ++ ++ D          +D IT E+SLGK+     I  N+ ++L S++  VII
Sbjct: 320 --AAKLRNQCYIQDKGSLDEVFGNIDKITNEISLGKVSSGLTINKNLKQKLKSEYGKVII 377

Query: 347 LSQSVTLSKPFD---------FIKTYNLQSGSKRSSKDLRAALIEI-DHIVSAHLNKDVV 396
            S SVT+++  D         FI  Y LQSG K+SSK LR+    I   I S   N+D  
Sbjct: 378 FSNSVTVAEDTDDEEESGTDPFISIYKLQSGDKKSSKALRSTFPRIHGEIQSLFTNRD-E 436

Query: 397 KRKPIMVCCNSGTDISVGVILMILCKYYSQDWLLGK--PDSVNKFVIRRHLVQIINKIKR 454
           K KP+++CCN+GTD+S+GVIL ILC  Y+++W+L    PD ++K ++R+HL ++I+ +K 
Sbjct: 437 KIKPMLICCNTGTDMSIGVILSILCTKYTEEWMLTSELPD-ISKLIVRKHLTKLISHLKG 495

Query: 455 RNVNPSRATLNSINSFLM 472
           RNVNPSRATLNS+NSFLM
Sbjct: 496 RNVNPSRATLNSVNSFLM 513

>NCAS0C00350 Chr3 (51842..53302) [1461 bp, 486 aa] {ON} Anc_8.848
           YMR283C
          Length = 486

 Score =  521 bits (1341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/489 (53%), Positives = 351/489 (71%), Gaps = 20/489 (4%)

Query: 1   MDPDLAFSLNQINRDIKKEYTSLRNRIQSILFDNAFIAQRVIPRFPNYPLIPNERCGLWY 60
           MDP L  SL QIN+DI+KE  S+RNR+QSIL DN F+   V+P FP++P+IPNERCGLWY
Sbjct: 1   MDPLLLESLGQINKDIRKENKSIRNRLQSILLDNKFLNDEVLPCFPDFPIIPNERCGLWY 60

Query: 61  CDPKDFDQTSYFKSTDGHTNQWDFSTRRLNLHLLPILQEKNGIIIVDSTRRGKLMPDALS 120
             P+DF QTSYFKSTDGHTNQWDFSTRRLN HL P L+   GIIIVDSTRRGK +PDALS
Sbjct: 61  VPPEDFKQTSYFKSTDGHTNQWDFSTRRLNFHLFPTLRSSGGIIIVDSTRRGKKIPDALS 120

Query: 121 KTIPIWCAVLNSLM--------QPDKSEVLFTPPKCVSQSEHDSIKTRIPSLVDRLEKLD 172
           KTIPIWCAVLN +M          D ++VLFTPP+ +S++E+D I  RIP LV +L KLD
Sbjct: 121 KTIPIWCAVLNYIMLLSQRGSDDIDITDVLFTPPETISKTEYDMIARRIPDLVGKLVKLD 180

Query: 173 ILDAQDLRNKFQGKILRPFWVYPGSDMLRSSTDPFTGEIIEIQWEPGPNEQIIPIILCTA 232
           I+D  +L    QGK+LRPFWVYPGS +L+SS D FTGEI    W    +  IIPIILCT 
Sbjct: 181 IVDGNELFILLQGKLLRPFWVYPGSSLLQSSRDVFTGEITGDSWNVPQHANIIPIILCTI 240

Query: 233 SYRAQDGVDKRHGFTYVQGAADDHELWSCGLDPKLLWNNWHYFHDLDRNDKELESHVKTL 292
           SYRAQDG DKRHGFTYVQGAADDHELWS GL P L W++ ++F +++  ++++   V+TL
Sbjct: 241 SYRAQDGHDKRHGFTYVQGAADDHELWSEGLTPTLFWSHINFFRNMNHTEEQINQFVETL 300

Query: 293 IELAETTDHRNHLADIVE-MDPITKELSLGKLKDHTAITPNIARELDSQFSLVIILSQSV 351
           ++  +    ++ + D  + +D +T +L LGK+KD+  I   +  +L  +F+L IILS++V
Sbjct: 301 VQEQDDAGEQSDINDAFDYIDNVTPQLELGKIKDNVVIGKVLREKLSDRFALSIILSENV 360

Query: 352 TLSKPFD------FIKTYNLQSGSKRSSKDLRAALIEIDHIVSAHLNKDVVKRKPIMVCC 405
            L  P D          + LQSGSK+SSK LR  + EI  +V + +N  +   KPI++CC
Sbjct: 361 ELD-PVDNENLPISTHIFKLQSGSKKSSKLLRNKIEEIIGLVESQMNNAL--NKPILICC 417

Query: 406 NSGTDISVGVILMILCKYYSQDWLLGKPDS--VNKFVIRRHLVQIINKIKRRNVNPSRAT 463
           N+GTD+S+G++L +LC+ YS+ W+LG+ ++  ++K +IR+ L ++I+ ++ R +N SRAT
Sbjct: 418 NTGTDMSIGILLALLCRNYSERWVLGEVEAKRLDKIMIRKQLTRLISHLEGRTINTSRAT 477

Query: 464 LNSINSFLM 472
           LNS+N++LM
Sbjct: 478 LNSVNNYLM 486

>Skud_13.455 Chr13 complement(808556..810040) [1485 bp, 494 aa] {ON}
           YMR283C (REAL)
          Length = 494

 Score =  517 bits (1331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/496 (52%), Positives = 352/496 (70%), Gaps = 26/496 (5%)

Query: 1   MDPDLAFSLNQINRDIKKEYTSLRNRIQSILFDNAFIAQRVIPRFPNYPLIPNERCGLWY 60
           MD ++  SL+QIN+D+++E  S+RNR+QSIL DN F+ +RV+  FP++P++PNERCGLWY
Sbjct: 1   MDKEILLSLSQINKDVRRENKSVRNRLQSILLDNKFLQERVVSIFPHFPIVPNERCGLWY 60

Query: 61  CDPKDFDQTSYFKSTDGHTNQWDFSTRRLNLHLLPILQEKNGIIIVDSTRRGKLMPDALS 120
           C+P  F +TSYFKSTDGH NQWDFSTRRLN HLL  +++K GIII+DSTRRGK +PD+LS
Sbjct: 61  CEPSTFKRTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDKKGIIIIDSTRRGKKIPDSLS 120

Query: 121 KTIPIWCAVLNSLMQPDKSE------VLFTPPKCVSQSEHDSIKTRIPSLVDRLEKLDIL 174
           KT+PIWCAVLN++M   + E      VL+ PP+ V +SE+D IK +IP LV +L+KL+++
Sbjct: 121 KTVPIWCAVLNTIMLQKEKEDVDIDKVLYVPPETVPKSEYDMIKRKIPELVAKLKKLNVV 180

Query: 175 DAQDLRNKFQGKILRPFWVYPGSDMLRSSTDPFTGEIIEIQ-WEPGPNEQIIPIILCTAS 233
           D++ L + F GKILRP WV+PGS +L  S D FTGE+ E + WE   ++ IIPIILCT S
Sbjct: 181 DSEKLNDLFMGKILRPIWVHPGSSLLNHSVDYFTGELKEQETWEAPKDQNIIPIILCTVS 240

Query: 234 YRAQDGVDKRHGFTYVQGAADDHELWSCGLDPKLLWNNWHYFHDLDRNDKELESHVKTLI 293
           Y+AQDG+DKR+GFTYVQGAADDHELWS GLD ++ W++  Y  D D++D +L  ++  L+
Sbjct: 241 YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSEMFWSHVDYLGDTDKSDDQLHDYITDLV 300

Query: 294 ----ELAETTDHRNHLADIV-EMDPITKELSLGKLKDHTAITPNIARELDSQFSLVIILS 348
               E   +   +  L +I   +D IT E+SLGK+     I+  + +EL  ++  VI+ S
Sbjct: 301 AKKLENQLSIKDKGSLDEIFGNIDIITNEISLGKVIQGLTISVKLKQELKLRYDKVIVFS 360

Query: 349 QSVTL---------SKPFDFIKTYNLQSGSKRSSKDLRAALIEI-DHIVSAHLNKDVVKR 398
            SV +         S P  FI  + LQSG K+SSK LR     I + + SA  N+D    
Sbjct: 361 DSVAITEDTDHEEESSPNSFISVFKLQSGDKKSSKTLRTIFPRIHEELQSAFANRD-GGT 419

Query: 399 KPIMVCCNSGTDISVGVILMILCKYYSQDWLLGKPD--SVNKFVIRRHLVQIINKIKRRN 456
           KPI++CCN+GTD+S+GVIL ILC  Y++DW L  P+   VNK +IRRHL ++I+ ++ RN
Sbjct: 420 KPILICCNTGTDMSIGVILSILCTKYTEDWKL-TPELPEVNKIIIRRHLTKLISHLRGRN 478

Query: 457 VNPSRATLNSINSFLM 472
           VNPSRATLNS+NSFLM
Sbjct: 479 VNPSRATLNSVNSFLM 494

>KAFR0B03980 Chr2 complement(832133..833584) [1452 bp, 483 aa] {ON}
           Anc_8.848 YMR283C
          Length = 483

 Score =  516 bits (1328), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 271/481 (56%), Positives = 342/481 (71%), Gaps = 16/481 (3%)

Query: 8   SLNQINRDIKKEYTSLRNRIQSILFDNAFIAQRVIPRFPNYPLIPNERCGLWYCDPKDFD 67
           SL+ I +DIK EY SL+NR+QSI+ DN+F+   V+P FPNYP+IPNERCGLWYCDPK F+
Sbjct: 3   SLSHIKKDIKNEYRSLKNRLQSIILDNSFLENEVVPCFPNYPIIPNERCGLWYCDPKHFE 62

Query: 68  QTSYFKSTDGHTNQWDFSTRRLNLHLLPILQEKNGIIIVDSTRRGKLMPDALSKTIPIWC 127
           QTSYFKSTDGH NQWDFSTRRLN HLLPIL + NGIIIVDSTRRGK +PDALSKTIPIWC
Sbjct: 63  QTSYFKSTDGHINQWDFSTRRLNFHLLPILAKSNGIIIVDSTRRGKKIPDALSKTIPIWC 122

Query: 128 AVLNSLM------QP-DKSEVLFTPPKCVSQSEHDSIKTRIPSLVDRLEKLDILDAQDLR 180
           AVLN L+      +P D  +VLF PP  VS SE+  I  +I  LV +L+ L++L  ++L 
Sbjct: 123 AVLNCLILEHASNEPIDYEKVLFVPPATVSNSEYHRILEKIEELVWKLKALEVLKPKELY 182

Query: 181 NKFQGKILRPFWVYPGSDMLRSSTDPFTGEIIEIQWEPGPNEQIIPIILCTASYRAQDGV 240
           N   GK++RPFWVYPGS +L +  DPFTGE    +W    NE IIPIILCT SY+AQDGV
Sbjct: 183 NMTNGKLIRPFWVYPGSSLLHTIVDPFTGEPTGERWSVPENENIIPIILCTVSYQAQDGV 242

Query: 241 DKRHGFTYVQGAADDHELWSCGLDPKLLWNNWHYFHDLDRNDKELESHVKTL-IELAETT 299
           DKR GF YVQGAADDHELWSCGL+PK  W N  Y +D+ + D  L+  V TL +E     
Sbjct: 243 DKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFVDTLTLEENHEK 302

Query: 300 DHRNHLADIVE-MDPITKELSLGKLKDHTAITPNIARELDSQFSLVIILSQSVTLSK--- 355
              + + DI E ++ +T E+SLGK+ D+  I   +  EL  +FSLVIILS+++ ++K   
Sbjct: 303 KASSSIIDIFESLNRVTPEISLGKIIDNCVIDSKLGGELSGKFSLVIILSETIEITKLEE 362

Query: 356 -PFDFIKTYNLQSGSKRSSKDLRAALIEIDHIVSAHL-NKDVVKRKPIMVCCNSGTDISV 413
                IK + LQSGSK+SSK LR  L EI   ++ +  +   + +KPI++CCNSG D+SV
Sbjct: 363 ATTKIIKLFKLQSGSKKSSKSLRLQLPEIFDTINPYFQDASNLAKKPILICCNSGNDMSV 422

Query: 414 GVILMILCKYYSQDWLLGKPDS--VNKFVIRRHLVQIINKIKRRNVNPSRATLNSINSFL 471
            VIL IL K YS+ W L   D   ++K VIR+HL ++I+ ++ RNVNPSRATLNSINS+L
Sbjct: 423 AVILTILSKKYSEGWQLETSDDLLISKTVIRKHLAKLISSLQGRNVNPSRATLNSINSYL 482

Query: 472 M 472
           M
Sbjct: 483 M 483

>KLTH0C03696g Chr3 (320129..321553) [1425 bp, 474 aa] {ON} similar
           to uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 474

 Score =  514 bits (1324), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 254/471 (53%), Positives = 338/471 (71%), Gaps = 10/471 (2%)

Query: 8   SLNQINRDIKKEYTSLRNRIQSILFDNAFIAQRVIPRFPNYPLIPNERCGLWYCDPKDFD 67
           ++N +NR+IKKEY SLRNR+QSI+FD+ F+ ++V   FP+YP+IPNERCG+WYCDPKD+ 
Sbjct: 8   TINFLNREIKKEYRSLRNRLQSIVFDHKFLDEQVKAVFPDYPIIPNERCGVWYCDPKDYL 67

Query: 68  QTSYFKSTDGHTNQWDFSTRRLNLHLLPILQEKNGIIIVDSTRRGKLMPDALSKTIPIWC 127
           QTSYFKSTDGHTNQWDFS RRLN HLLP L    GI++VDSTRRGK MPDALSKT+PIWC
Sbjct: 68  QTSYFKSTDGHTNQWDFSLRRLNFHLLPALAASGGIVVVDSTRRGKRMPDALSKTVPIWC 127

Query: 128 AVLNSLM---QPDKSEVLFTPPKCVSQSEHDSIKTRIPSLVDRLEKLDILDAQDLRNKFQ 184
           AVLNSL+   Q  + EVLF PP+ VS+ E + IK+RIP LV + +K++IL   D+   F+
Sbjct: 128 AVLNSLLLEYQGLEGEVLFCPPQTVSEFEFERIKSRIPDLVAKFKKMNILTGADIDRLFK 187

Query: 185 GKILRPFWVYPGSDMLRSSTDPFTGEIIEIQWEPGPNEQIIPIILCTASYRAQDGVDKRH 244
           GKILRP WV+PG+ +L S  DPFTGE++  +W     E  IP++LCT SY+ QDGVDKRH
Sbjct: 188 GKILRPLWVFPGASLLSSQRDPFTGEVLSQKWHTAELENFIPVVLCTVSYQCQDGVDKRH 247

Query: 245 GFTYVQGAADDHELWSCGLDPKLLWNNWHYFHDLDRNDKELESHVKTLIELAETTDHRNH 304
           GFTYVQGAADDHELW+ GL  +L W +     +++ +D+ELES V+  I   E     N 
Sbjct: 248 GFTYVQGAADDHELWAQGLTAELFWKHISILSNINLSDQELESFVEDKIHPQEPNSAENG 307

Query: 305 LA--DIVEMDPITKELSLGKLKDHTAITPNIARELDSQFSLVIILSQSVTLSKPFDFIKT 362
           L+   I+  D +T+EL LGK+  +  +  ++ +EL  ++SLVIILS +VTLS+    IK 
Sbjct: 308 LSLDQILYTDILTEELHLGKISSNVHLGEHLVKELRLKYSLVIILSNTVTLSEDEAAIKI 367

Query: 363 YNLQSGSKRSSKDLRAALIEIDHIVSAHLNKDVVKRKPIMVCCNSGTDISVGVILMILCK 422
           + LQS  K+SSK LR  LI+I  +  A+L   +    P++VCCN+G D+SV V L ILC+
Sbjct: 368 FKLQSECKKSSKALRTELIKICPLAEAYLPNSL----PMLVCCNTGKDMSVCVSLAILCR 423

Query: 423 YYS-QDWLLGKPDSVNKFVIRRHLVQIINKIKRRNVNPSRATLNSINSFLM 472
            Y+   W L    S++K  I++HL +II K++ RNVNP RA+LNS+N++LM
Sbjct: 424 NYNVGSWDLNVQQSIHKIDIKKHLSKIITKLEGRNVNPPRASLNSVNAYLM 474

>Smik_13.496 Chr13 complement(818336..819820) [1485 bp, 494 aa] {ON}
           YMR283C (REAL)
          Length = 494

 Score =  514 bits (1325), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 258/496 (52%), Positives = 342/496 (68%), Gaps = 26/496 (5%)

Query: 1   MDPDLAFSLNQINRDIKKEYTSLRNRIQSILFDNAFIAQRVIPRFPNYPLIPNERCGLWY 60
           MD ++  SL +INRD++KE  S+RNR+QSIL DN F+  RVIP FP +PL+PNERCG+WY
Sbjct: 1   MDEEICLSLTKINRDVRKENKSVRNRLQSILLDNKFLQDRVIPVFPYFPLVPNERCGIWY 60

Query: 61  CDPKDFDQTSYFKSTDGHTNQWDFSTRRLNLHLLPILQEKNGIIIVDSTRRGKLMPDALS 120
           C P  + QTSYFKSTDGH NQWDFSTRRLN HLL  +++  GIIIVDSTRRGK +PDALS
Sbjct: 61  CKPSTYKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS 120

Query: 121 KTIPIWCAVLNSLMQPDKSE------VLFTPPKCVSQSEHDSIKTRIPSLVDRLEKLDIL 174
           KT+PIWCAVLN++M  +  E       L+ PP+ V +SE+D IK +IP LV +L KL+I+
Sbjct: 121 KTVPIWCAVLNTIMLQETEENFDIDKALYLPPETVPKSEYDMIKRKIPELVTKLRKLNII 180

Query: 175 DAQDLRNKFQGKILRPFWVYPGSDMLRSSTDPFTGEIIEIQ-WEPGPNEQIIPIILCTAS 233
           D++ L   F GKILRP WV+PGS +L  S D FTGEI + + WE   ++ IIPIILCT S
Sbjct: 181 DSKKLNELFMGKILRPIWVHPGSSLLNHSVDYFTGEIQQHETWETPEDQNIIPIILCTVS 240

Query: 234 YRAQDGVDKRHGFTYVQGAADDHELWSCGLDPKLLWNNWHYFHDLDRNDKELESHVKTLI 293
           Y+AQDG+DKR+GFTYVQGAADDHELWS GLD K+ W +  +  D + +D +L  ++  L+
Sbjct: 241 YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSKMFWAHVEFLCDKNNSDDQLHDYITDLV 300

Query: 294 ELAETTDHRNHLAD-------IVEMDPITKELSLGKLKDHTAITPNIARELDSQFSLVII 346
             A+    + ++ D         ++D IT E+SLGK+     I   +  EL S++  V+I
Sbjct: 301 --AKKLKSQMYIQDKGGLDEIFGKVDKITDEISLGKVVQGLFINEKLKEELKSEYGKVLI 358

Query: 347 LSQSVTLS---------KPFDFIKTYNLQSGSKRSSKDLRAALIEIDHIVSAHLNKDVVK 397
           LS SVT++         K   FI  Y LQSG K+SSK LR+ L +I   V         +
Sbjct: 359 LSDSVTVAEDAGVVEATKSNPFITVYKLQSGDKKSSKALRSILPKIHEEVELAFANRAEE 418

Query: 398 RKPIMVCCNSGTDISVGVILMILCKYYSQDWLLGKP-DSVNKFVIRRHLVQIINKIKRRN 456
            +P++VCCN+GTD+S+GVIL ILC  Y+++W+L +    VNK +IR+HL ++I+ +  RN
Sbjct: 419 MRPMLVCCNTGTDMSIGVILSILCTKYTEEWMLTQELPEVNKIIIRKHLTKLISHLHGRN 478

Query: 457 VNPSRATLNSINSFLM 472
           VNPSRATLNS+NSFLM
Sbjct: 479 VNPSRATLNSVNSFLM 494

>TPHA0I00300 Chr9 complement(57211..58692) [1482 bp, 493 aa] {ON}
           Anc_8.848 YMR283C
          Length = 493

 Score =  514 bits (1323), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 258/490 (52%), Positives = 349/490 (71%), Gaps = 27/490 (5%)

Query: 8   SLNQINRDIKKEYTSLRNRIQSILFDNAFIAQRVIPRFPNYPLIPNERCGLWYCDPKDFD 67
           S+NQI +DI+KE  SL+NRI SIL D+ F+ ++VIP FP YPL+PNERCGLWYC   +F 
Sbjct: 6   SVNQITKDIRKENKSLKNRIHSILLDSKFLDEKVIPFFP-YPLVPNERCGLWYCKRANFT 64

Query: 68  QTSYFKSTDGHTNQWDFSTRRLNLHLLPILQEKNGIIIVDSTRRGKLMPDALSKTIPIWC 127
            TSYFKSTDGH NQWDFSTRRLN HL+P+++E+ GIII+DSTRRGK +PDALSKT+PIWC
Sbjct: 65  TTSYFKSTDGHINQWDFSTRRLNFHLIPLIEEQKGIIIIDSTRRGKKIPDALSKTVPIWC 124

Query: 128 AVLNSLM------QPDKS-EVLFTPPKCVSQSEHDSIKTRIPSLVDRLEKLDILDAQDLR 180
           AVLN+++      + DKS EVLF PP  VS+SE++ IK +IP LV++L KLD++D + L 
Sbjct: 125 AVLNTMILQHCENEEDKSREVLFVPPATVSKSEYERIKNKIPELVEKLCKLDVIDGKKLY 184

Query: 181 NKFQGKILRPFWVYPGSDMLRSSTDPFTGEIIE-IQW-EPGPNEQIIPIILCTASYRAQD 238
            +F+G +LRP W++PGS +L+S  DPFTGEI+    W EP   E+IIPI+LCT SY+ QD
Sbjct: 185 EQFEGNLLRPIWIHPGSSILQSQFDPFTGEIVSNSSWEEPSKEEKIIPIVLCTVSYQVQD 244

Query: 239 GVDKRHGFTYVQGAADDHELWSCGLDPKLLWNNWHYFHDLDRNDKELESHVKTLIELAET 298
           GVD R GFTYVQGAADDHELWS GL P+L W+N    ++L+ +++ LE +V+ ++ L+E+
Sbjct: 245 GVDVRDGFTYVQGAADDHELWSHGLSPQLFWDNIELLNNLELSEEMLEDYVEEIL-LSES 303

Query: 299 TDHRNHLADIV--EMDPITKELSLGKLKDHTAITPNIARELDSQFSLVIILSQSVTL--- 353
               N   D V   +D IT+EL LG + D   I  N+    +  +SLVIILS S+ L   
Sbjct: 304 MKITNLEVDGVFKSIDKITEELYLGNIVDGLEIKQNLMEMFNKSYSLVIILSNSIKLASD 363

Query: 354 ----------SKPFDFIKTYNLQSGSKRSSKDLRAALIEIDHIVSAHLNKDVVKRKPIMV 403
                     +   + IK + LQSGSK+SSK+LR+ L EI  +++  L+     +KPI+V
Sbjct: 364 EQNEQSANAKTSKTNIIKLFRLQSGSKKSSKELRSCLPEICDLLTDELSSSGSTKKPILV 423

Query: 404 CCNSGTDISVGVILMILCKYYSQDW-LLGKPDSVNKFVIRRHLVQIINKIKRRNVNPSRA 462
           CCN+G+D+S+ VIL+ L K+Y+Q+W    +   +NK  IR+HL ++I+ +  RNVNPSRA
Sbjct: 424 CCNNGSDMSIAVILVTLSKFYTQEWRRTSEHTEINKITIRKHLTKVISHLGGRNVNPSRA 483

Query: 463 TLNSINSFLM 472
           TLNS+N FLM
Sbjct: 484 TLNSVNDFLM 493

>Kwal_27.10219 s27 (246213..247715) [1503 bp, 500 aa] {ON} YMR283C
           (RIT1) - Initiator methionine tRNA 2'-O-ribosyl
           phosphate transferase [contig 39] FULL
          Length = 500

 Score =  513 bits (1320), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 245/481 (50%), Positives = 347/481 (72%), Gaps = 14/481 (2%)

Query: 1   MDPDLAF--SLNQINRDIKKEYTSLRNRIQSILFDNAFIAQRVIPRFPNYPLIPNERCGL 58
           ++ DL F  +LN +N++IKKE  +LRNR+QSILFD+ F+ ++V+  FPNYPLIPNERCGL
Sbjct: 25  LNMDLTFDQTLNSLNKEIKKENKALRNRLQSILFDHRFLEEQVLALFPNYPLIPNERCGL 84

Query: 59  WYCDPKDFDQTSYFKSTDGHTNQWDFSTRRLNLHLLPILQEKNGIIIVDSTRRGKLMPDA 118
           WYCDP+ + QTSYFKSTDGH+NQWDFS RRLN+HLLP + +K GI+IVDSTRRGK MPDA
Sbjct: 85  WYCDPERYSQTSYFKSTDGHSNQWDFSLRRLNVHLLPTITQKGGIVIVDSTRRGKRMPDA 144

Query: 119 LSKTIPIWCAVLNSLM---QPDKSEVLFTPPKCVSQSEHDSIKTRIPSLVDRLEKLDILD 175
           LSKT+PIWCAVLNS+M   +  + EVLF PP  VS SE + IK+RIPSLV R ++L +  
Sbjct: 145 LSKTVPIWCAVLNSIMLEGRQSEEEVLFCPPNTVSGSEFERIKSRIPSLVARFKELGLFT 204

Query: 176 AQDLRNKFQGKILRPFWVYPGSDMLRSSTDPFTGEIIEIQWEPGPNEQIIPIILCTASYR 235
           + +L     GKILRP WVYPG+ +L S  DPFTG+I+   WE   NE  +P++LCT SY+
Sbjct: 205 SDELFKILDGKILRPIWVYPGASLLNSHRDPFTGDIVTPTWE-AQNENFMPVVLCTVSYQ 263

Query: 236 AQDGVDKRHGFTYVQGAADDHELWSCGLDPKLLWNNWHYFHDLDRNDKELESHVKTLIEL 295
            QDGVDKRHGFTYVQGAADDHELW+ GL  +L W +   F D   +D+EL ++V  L+  
Sbjct: 264 CQDGVDKRHGFTYVQGAADDHELWAEGLTAELFWQHIEIFKDTALSDQELSTYVNNLVTS 323

Query: 296 AETTDHRN---HLADIVEMDPITKELSLGKLKDHTAITPNIARELDSQFSLVIILSQSVT 352
            +  +       L D++  + +T+EL LG++ ++  +  N+  +L  ++SLV++LS S++
Sbjct: 324 GDANNKLTKSLRLDDMLNANELTRELHLGQVAENIELDKNLVDQLKLKYSLVVLLSTSIS 383

Query: 353 LSKPFDFIKTYNLQSGSKRSSKDLRAALIEIDHIVSAHLNKDVVKRKPIMVCCNSGTDIS 412
           + +  + I+ + LQSGSK+SS+ LRAAL +I  ++ A+L   +    P+++CCN+G D+S
Sbjct: 384 VYEEAENIRIFKLQSGSKKSSRALRAALTQICPLIEANLQNSL----PVLICCNNGKDMS 439

Query: 413 VGVILMILCKYYS-QDWLLGKPDSVNKFVIRRHLVQIINKIKRRNVNPSRATLNSINSFL 471
           V V+L +LC+ ++ + W L +  SV+K +I++HL ++I K+  RN+NP R +LNS+N +L
Sbjct: 440 VCVVLSVLCRNFNVESWQLEQRPSVHKSIIKKHLAKMITKLDGRNLNPPRVSLNSVNDYL 499

Query: 472 M 472
           M
Sbjct: 500 M 500

>SAKL0D01276g Chr4 (96411..97919) [1509 bp, 502 aa] {ON} similar to
           uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 502

 Score =  511 bits (1317), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 260/481 (54%), Positives = 345/481 (71%), Gaps = 13/481 (2%)

Query: 1   MDPDLAFSLNQINRDIKKEYTSLRNRIQSILFDNAFIAQRVIPRFPNYPLIPNERCGLWY 60
           MD +   SLN I ++IKKEY SLRNR+QSI++D+ F+   VIP FP+YPL+PNERCGLWY
Sbjct: 26  MDTETLKSLNLIKKEIKKEYKSLRNRLQSIIWDHQFLTTYVIPTFPDYPLVPNERCGLWY 85

Query: 61  CDPKDFDQTSYFKSTDGHTNQWDFSTRRLNLHLLPILQEKNGIIIVDSTRRGKLMPDALS 120
           C+P+ F Q SYFKSTDGH NQWDFSTRRLN HLLP + +  GI+I+DSTRRGK +PDALS
Sbjct: 86  CNPESFSQMSYFKSTDGHINQWDFSTRRLNFHLLPSIAQHGGIVIIDSTRRGKKIPDALS 145

Query: 121 KTIPIWCAVLNSLM---QPDKSEVLFTPPKCVSQSEHDSIKTRIPSLVDRLEKLDILDAQ 177
           KTIPIWCAV+N+L+        EVLF PP  V QSE+D IK RIPSLV++L+ L I+   
Sbjct: 146 KTIPIWCAVINTLILEASNRSEEVLFCPPGTVPQSEYDRIKNRIPSLVEKLKNLGIVSGD 205

Query: 178 DLRNKFQGKILRPFWVYPGSDMLRSSTDPFTGEIIEIQ-WEPGPNEQIIPIILCTASYRA 236
           +L  +F GKILRP WVYPGS +  SSTD FTG+    Q WE   ++  +P+ILCTASY+ 
Sbjct: 206 ELLKQFGGKILRPLWVYPGSSLFSSSTDIFTGKQTRSQKWEKPEDQDFLPVILCTASYQC 265

Query: 237 QDGVDKRHGFTYVQGAADDHELWSCGLDPKLLWNNWHYFHDLDRNDKELESHV-KTLIEL 295
           QDGVDKR+GFTYVQGAADDHELW+ GL P + W+N ++  D  ++++EL  +V K   E 
Sbjct: 266 QDGVDKRYGFTYVQGAADDHELWAEGLTPDMFWDNKNFLGDETKSEQELIEYVNKQKREA 325

Query: 296 AETTDHR--NHLADIVEMDPITKELSLGKLKDHTAITPNIARELDSQFSLVIILSQSVTL 353
            E T     N L     +D ITKEL LG + D   +   +  +LDS+++L ++LS+SV +
Sbjct: 326 TERTKEASGNDLNQCFSVDAITKELHLGTVVDGLELNEKLLSQLDSRYALTVVLSESVKI 385

Query: 354 S--KPFDFIKTYNLQSGSKRSSKDLRAALIEIDHIVSAHLNKDVVKRKPIMVCCNSGTDI 411
           +  +     K + L SG+K+SSK+LR+ LIEI  ++ A LN  +    PI++CCN+G D+
Sbjct: 386 ASIQENPNTKIFPLTSGNKKSSKELRSKLIEICPLIQASLNSPL----PILICCNTGKDM 441

Query: 412 SVGVILMILCKYYSQDWLLGKPDSVNKFVIRRHLVQIINKIKRRNVNPSRATLNSINSFL 471
           SVGV+L  LC+ Y +DW +G P+S NK +IR+HL ++I+ +K RNVNPSRATLNS+N++L
Sbjct: 442 SVGVLLATLCQNYDEDWCIGSPNSFNKTIIRKHLTRLISHLKGRNVNPSRATLNSVNAYL 501

Query: 472 M 472
           M
Sbjct: 502 M 502

>NDAI0K00350 Chr11 complement(66993..68507) [1515 bp, 504 aa] {ON}
           Anc_8.848 YMR283C
          Length = 504

 Score =  506 bits (1303), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 266/514 (51%), Positives = 351/514 (68%), Gaps = 52/514 (10%)

Query: 1   MDPDLAF-SLNQINRDIKKEYTSLRNRIQSILFDNAFIAQRVIPRFPNYPLIPNERCGLW 59
           MD    F SL+QIN+DIKKEY SLRNR+QSIL DN F+   +I  FPNYP+IPNERCGLW
Sbjct: 1   MDQSYFFDSLSQINKDIKKEYKSLRNRLQSILLDNEFLNDEIIATFPNYPIIPNERCGLW 60

Query: 60  YCDPKDFDQTSYFKSTDGHTNQWDFSTRRLNLHLLPILQEKNGIIIVDSTRRGKLMPDAL 119
           Y  P  ++QTSYFKSTDGHTNQWDFSTRRLN HLL  + +  GI I+DSTRRGK +PDAL
Sbjct: 61  YVSPSQYNQTSYFKSTDGHTNQWDFSTRRLNFHLLETIAKSKGITIIDSTRRGKKIPDAL 120

Query: 120 SKTIPIWCAVLNSLMQPD---------KSEVLFTPPKCVSQSEHDSIKTRIPSLVDRLEK 170
           SKTIPIWCAVLN +M  +           + LF PP  V +SE+D I  +IP+LV++L+K
Sbjct: 121 SKTIPIWCAVLNYIMLRELKGGNDIVKVEDCLFVPPATVPKSEYDCILQKIPTLVEKLDK 180

Query: 171 LDILDAQDLRNKFQGKILRPFWVYPGSDMLRSSTDPFTGEIIE-IQWEPGPNEQIIPIIL 229
           L+I++A +L + F GK+LRP W+YPGS +L SS D FTGE  + + WE  P E IIPI+L
Sbjct: 181 LEIINANELISTFHGKLLRPLWIYPGSSILHSSRDVFTGEKTKALAWE-AP-ENIIPIVL 238

Query: 230 CTASYRAQDGVDKRHGFTYVQGAADDHELWSCGLDPKLLWNNWHYFHDLDRNDKELESHV 289
           CT SY+AQDGVDKR+GFTYVQGAADDHELWSCGL P+L W++ +Y  +   +D EL  +V
Sbjct: 239 CTISYQAQDGVDKRYGFTYVQGAADDHELWSCGLTPELFWSHINYLGNPTHSDDELMEYV 298

Query: 290 KTLIELAETTDHRNHLADIVEM----------DPITKELSLGKLKDHTAITPNIARELDS 339
           + +IE+      ++  A  VE+          DPIT E+SLGK+ ++  IT ++  E   
Sbjct: 299 RHMIEMK----IKDSAAKTVELTMDAIFPNGVDPITPEISLGKIDNNIKITKSMLHEFKK 354

Query: 340 QFSLVIILSQSVTLS------KPFDFIKTYNLQSGSKRSSKDLRAALIEIDHIVSAHLNK 393
            FSLV+ILS++VTL+      +  D +K Y L SGSK+SSK LR  + +I  ++  +L  
Sbjct: 355 GFSLVVILSETVTLNSDDKDEQQSDSVKIYKLTSGSKKSSKRLRTEIPKIYEVMRENLTN 414

Query: 394 DVVKRKPIMVCCNSGTDISVGVILMILCKYYSQD------WLLGKPDS---------VNK 438
                KPI++CCN+GTDIS+G+IL ILCK Y  D      WL  + ++         ++K
Sbjct: 415 G----KPILICCNTGTDISIGIILTILCKNYKLDPDNKKAWLRLEKETQDSNVPVKRLDK 470

Query: 439 FVIRRHLVQIINKIKRRNVNPSRATLNSINSFLM 472
            +IR++L  +I+ ++ RNVNPSRATLNS+N +LM
Sbjct: 471 TIIRKNLTTLISHLEGRNVNPSRATLNSVNDYLM 504

>KNAG0J00220 Chr10 (29017..30516) [1500 bp, 499 aa] {ON} Anc_8.848
           YMR283C
          Length = 499

 Score =  505 bits (1301), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 254/492 (51%), Positives = 342/492 (69%), Gaps = 24/492 (4%)

Query: 1   MDPDLAFSLNQINRDIKKEYTSLRNRIQSILFDNAFIAQRVIPRFPNYPLIPNERCGLWY 60
           MD +L  SL QI++++K++  SLRNR+QSIL DN F+  RV   FP++PLIPNERCGLWY
Sbjct: 12  MDRNLLTSLPQISKELKRDDRSLRNRVQSILLDNEFLETRVHTAFPDFPLIPNERCGLWY 71

Query: 61  CDPKDFDQTSYFKSTDGHTNQWDFSTRRLNLHLLPILQEKNGIIIVDSTRRGKLMPDALS 120
           C+P  F QTSYFKSTDGH NQWDFSTRRLN HLLP LQE  G++IVDSTRRGK +PDALS
Sbjct: 72  CNPSHFAQTSYFKSTDGHANQWDFSTRRLNFHLLPTLQEAGGVVIVDSTRRGKKIPDALS 131

Query: 121 KTIPIWCAVLNSLM------QPDKSEVLFTPPKCVSQSEHDSIKTRIPSLVDRLEKLDIL 174
           KT+P+WCAVLNSLM      + + ++VLF PP+ V +SE D +  ++P LV++L+ L++ 
Sbjct: 132 KTVPLWCAVLNSLMLESVGKKFNVNDVLFVPPETVPESERDQMAKKLPDLVEKLKILNVF 191

Query: 175 DAQDLRNKFQGKILRPFWVYPGSDMLRSSTDPFTGEIIEIQWEPGPNEQIIPIILCTASY 234
           D         GK+LRPFWV+PGS +L+S TD FTGE I+ +WE   +E I+PIILCT SY
Sbjct: 192 DGTKTSRMLDGKLLRPFWVFPGSSLLQSCTDIFTGEQIQNKWEVSRDENIVPIILCTVSY 251

Query: 235 RAQDGVDKRHGFTYVQGAADDHELWSCGLDPKLLWNNWHYFHDLDRNDKELESHVKTLIE 294
           +AQDG+DKR+GFTYVQGAADDHELWS GL+  + W+N   F +L   D EL   V  ++ 
Sbjct: 252 QAQDGIDKRNGFTYVQGAADDHELWSHGLEANIFWSNIDKFKNLSGGDSELYEIVDKMVT 311

Query: 295 LAETTDHRNHLAD-----IVEMDPITKELSLGKLKDHTAITPNIARELDSQFSLVIILSQ 349
                  R+  A      +  +D +T  LSLG++ D+  ++     +L+  +S VI+LS+
Sbjct: 312 QQNNNMQRSAQAGSLDKIMTGIDKVTSLLSLGEIHDNVTLSSEAIADLEKCYSTVIVLSE 371

Query: 350 SVTL----SKPFDFIKTYNLQSGSKRSSKDLRAALIEIDHIVSAHLNKDVVKR--KPIMV 403
           +V L    S+  + +K + L SGSK+SSK+LRA L +I    S  +N  ++ +  KP+++
Sbjct: 372 TVHLDKDASQDNEMVKIFRLTSGSKKSSKNLRAMLPDI----SKTINNAIILQPIKPLLI 427

Query: 404 CCNSGTDISVGVILMILCKYYSQDWLLGKPD---SVNKFVIRRHLVQIINKIKRRNVNPS 460
           CCN+G D+S+GV+L +LC+ Y + W L   D   SV+K VIRRHL ++I  +  RNVNPS
Sbjct: 428 CCNTGKDMSIGVLLAVLCQNYDEVWDLLPEDVKPSVSKIVIRRHLTKLIAHLNGRNVNPS 487

Query: 461 RATLNSINSFLM 472
           RATLNSINSFLM
Sbjct: 488 RATLNSINSFLM 499

>KLLA0D01386g Chr4 (118965..120434) [1470 bp, 489 aa] {ON} similar
           to uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 489

 Score =  498 bits (1282), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 245/492 (49%), Positives = 342/492 (69%), Gaps = 23/492 (4%)

Query: 1   MDPDLAFSLNQINRDIKKEYTSLRNRIQSILFDNAFIAQRVIPRFPNYPLIPNERCGLWY 60
           MD +    + +I+++++KE  SL+NR+QSI+FDN F+ ++V P F  YP++PNERCGLWY
Sbjct: 1   MDKETLREIKEISKELRKEDKSLKNRLQSIIFDNNFLKEQVFPTF-QYPVVPNERCGLWY 59

Query: 61  CDPKDFDQTSYFKSTDGHTNQWDFSTRRLNLHLLPILQEKNGIIIVDSTRRGKLMPDALS 120
           CDPK +D TSYFKSTDGH NQWDFSTRRLN HLLP+L E  G++I+DSTRRGK +PDALS
Sbjct: 60  CDPKIYDTTSYFKSTDGHMNQWDFSTRRLNFHLLPLLGENGGLVILDSTRRGKKIPDALS 119

Query: 121 KTIPIWCAVLNSLMQ-------PDKSEVLFTPPKCVSQSEHDSIKTRIPSLVDRLEKLDI 173
           KT+PIWCAVLN LM        P + E+LF PP  V +SE D +  ++P LV +L+KLDI
Sbjct: 120 KTVPIWCAVLNYLMLEADGKQWPFEEEILFVPPSTVPESEFDRMFAKLPELVQKLKKLDI 179

Query: 174 LDAQDLRNKFQ-----GKILRPFWVYPGSDMLRSSTDPFTGEIIE-IQWEPGPNEQIIPI 227
           +D + LR   Q      K+LRP WVYPGS +L+   D F+GE+IE   WEP  N  IIP+
Sbjct: 180 IDVKKLRKSLQIEEGHDKLLRPIWVYPGSSLLQLKHDLFSGEVIENTHWEPPSN--IIPV 237

Query: 228 ILCTASYRAQDGVDKRHGFTYVQGAADDHELWSCGLDPKLLWNNWHYFHDLDRNDKELES 287
           ILCT SY+ QDG DKR+GFTYVQGAADDHELW+  L P+L W N     D+ ++D EL+ 
Sbjct: 238 ILCTVSYQCQDGTDKRYGFTYVQGAADDHELWAENLTPQLFWENIDELGDISKSDAELKD 297

Query: 288 HVKTLI---ELAETTDHRNHLADIVEMDPITKELSLGKLKDHTAITPNIARELDSQFSLV 344
               +I   ++  + D    ++ ++E+D IT  L LGK+     ITP   + L+ ++S V
Sbjct: 298 SYNAVILRAKVQNSLDISGDISKMLEIDTITARLHLGKITSQFRITPKTVKYLNQKYSAV 357

Query: 345 IILSQSVTLSKPFDF---IKTYNLQSGSKRSSKDLRAALIEIDHIVSAHLNK-DVVKRKP 400
           ++  +++++++  +    I  + L SGSK+SS++LR+ LI+I+ ++   L++ D     P
Sbjct: 358 VLCHEAISVTEITELPRSIHIFPLPSGSKKSSRELRSHLIKINALIEEQLSRPDTAANLP 417

Query: 401 IMVCCNSGTDISVGVILMILCKYYSQDWLLGKPDSVNKFVIRRHLVQIINKIKRRNVNPS 460
           I++ C+SG DISV ++L+ LCKYY+ DW L   DSVNK +I++HL +II  ++ RNVNPS
Sbjct: 418 ILIACDSGKDISVSILLVALCKYYNLDWELQPQDSVNKTIIKKHLAKIIESLQGRNVNPS 477

Query: 461 RATLNSINSFLM 472
           RA+LNS+NSFLM
Sbjct: 478 RASLNSVNSFLM 489

>AFR451C Chr6 complement(1248648..1249874) [1227 bp, 408 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR283C
           (RIT1)
          Length = 408

 Score =  393 bits (1010), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 199/413 (48%), Positives = 275/413 (66%), Gaps = 14/413 (3%)

Query: 67  DQTSYFKSTDGHTNQWDFSTRRLNLHLLPILQEKNGIIIVDSTRRGKLMPDALSKTIPIW 126
           + T YFKSTDGH N WDFS RRLN HLLP+L E++G IIVDSTRRGK +PDALSKTIPIW
Sbjct: 3   ETTCYFKSTDGHVNGWDFSVRRLNFHLLPLLAERSGAIIVDSTRRGKKIPDALSKTIPIW 62

Query: 127 CAVLNSLM---QPDKSEVLFTPPKCVSQSEHDSIKTRIPSLVDRLEKLDILDAQDLRNKF 183
           CAVLN+L+        EVLF PP  VSQ E++ I+ ++P LV +L+++D +   +L +  
Sbjct: 63  CAVLNTLILEHTEGSGEVLFCPPGTVSQLEYNRIQAKLPELVQKLKRVDAISGAELCSLL 122

Query: 184 QGKILRPFWVYPGSDMLRSSTDPFTGEIIEIQWEPGPNEQIIPIILCTASYRAQDGVDKR 243
            G++LRPFWVYPG+ ML ++ D FTGE ++  W+P P   +IP+ILCTAS + QDGVDK 
Sbjct: 123 GGRLLRPFWVYPGAAMLGTTRDLFTGESLQEPWQPPPG--VIPLILCTASRQCQDGVDKS 180

Query: 244 HGFTYVQGAADDHELWSCGLDPKLLWNNWHYFHDLDRNDKELESHVKTLIELAET--TDH 301
            G+ YVQGAADDHELW+ GL P L W N     D    ++ L+ HV+ ++EL ++  T+ 
Sbjct: 181 QGYAYVQGAADDHELWANGLTPSLFWANVQLLADDSMPEQLLQGHVERIVELHKSTHTEA 240

Query: 302 RNHLADIVEMDPITKELSLGKLKDHTAITPNIARELDSQFSLVIILSQSVTLS--KPFDF 359
             H     E D +T+ L LG +     I+   A  L+ Q+SLV++   S+ LS   P   
Sbjct: 241 VAHELPCRETDVVTEHLRLGSVAP-CQISDKQAELLEQQYSLVVLCGSSIELSAAAPHPR 299

Query: 360 IKTYNLQSGSKRSSKDLRAALIEIDHIVSAHLNKDVVKRKPIMVCCNSGTDISVGVILMI 419
           I+ Y L SG K+SS+ LR ALIEI  ++S  L + +    P+++CC+SG+DISVG++L  
Sbjct: 300 IRIYPLNSGCKKSSRALRPALIEIIPLISTALCEAL----PVLICCSSGSDISVGIVLAA 355

Query: 420 LCKYYSQDWLLGKPDSVNKFVIRRHLVQIINKIKRRNVNPSRATLNSINSFLM 472
           LCK Y  +W       + K +I++HL+++ +KI  R +NPSR TLNS+N+FLM
Sbjct: 356 LCKNYDLEWRHEDQKDMTKTIIKKHLIKLTSKIHGRIINPSRTTLNSVNAFLM 408

>KLTH0E07634g Chr5 (697160..698794) [1635 bp, 544 aa] {ON} similar
           to uniprot|P16639 Saccharomyces cerevisiae YGL017W ATE1
           Arginyl-tRNA-protein transferase catalyzes
           post-translational conjugation of arginine to the amino
           termini of acceptor proteins which are then subject to
           degradation via the N-end rule pathway
          Length = 544

 Score = 38.1 bits (87), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 70/165 (42%), Gaps = 19/165 (11%)

Query: 37  IAQRVIPRFPNYPLIPNERCGLWYCDPKDFDQTSYFKST--------DGHTNQWDFSTRR 88
           ++ R+I   P Y   PNE+CG  YC  K  ++  YF +         D  + Q++  T  
Sbjct: 3   LSDRLIISKPLYFTEPNEKCG--YCSGKKANKCDYFATESWHKFHALDADSLQFNNCTLG 60

Query: 89  LNLHLLPILQEKNGIIIVDSTRRGKLMPDALSKTIPIWCAVLNSLMQPDKSEVLFTPPKC 148
           L + L+P+    + +  +   R G  +  A    +   C +      P+K ++      C
Sbjct: 61  LQVELMPV-DVYDELCNLGFRRSGNFLYKA--DMLRNCCRLYTIRTTPEKCQMSKEFKSC 117

Query: 149 VSQSEH--DSIKTRIPSLVDRLEKLDILD----AQDLRNKFQGKI 187
           +++      + ++ +P   DR  K D +D    A+ +  KFQ + 
Sbjct: 118 ITRFRKRIGAQRSELPKGQDRKGKFDYIDEIVQAEKVSEKFQARF 162

>NDAI0D03480 Chr4 complement(818292..820418) [2127 bp, 708 aa] {ON}
           Anc_4.121
          Length = 708

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 52/105 (49%), Gaps = 8/105 (7%)

Query: 376 LRAALIEID------HIVSAHLNKDVVKRKPIMV--CCNSGTDISVGVILMILCKYYSQD 427
           L  AL +ID      H +   L++ +V++K I +     SGTD+S+  +L+I+  ++   
Sbjct: 162 LEVALSQIDTYFETIHPIIPVLDRSLVRQKLIGIYNSIQSGTDLSISNLLLIMSIFFCSS 221

Query: 428 WLLGKPDSVNKFVIRRHLVQIINKIKRRNVNPSRATLNSINSFLM 472
           + +     +   ++     Q    +   +V P+R TL S+ SFL+
Sbjct: 222 YSIVASSIIPDLLLCNKYYQSHKYLLELSVFPTRPTLESLQSFLI 266

>Kwal_56.23442 s56 (536368..540675) [4308 bp, 1435 aa] {ON} YER164W
           (CHD1) - transcriptional regulator [contig 177] FULL
          Length = 1435

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 61/137 (44%), Gaps = 5/137 (3%)

Query: 194 YPGSDMLRSSTDPFTGEIIEIQWEPGPNEQIIPIILCTASYRAQDGVDKRHGFTYVQGAA 253
           Y   D+L S T+    ++ E  + P P+ Q    I    ++R +   ++      V    
Sbjct: 130 YSDEDLLESETEQADADMEEYDYTPTPSSQDGQGIDLVITHRLKPDTEESKDIPDVATCK 189

Query: 254 DDHELWSCGLDPKLLWNNWHYFHDLD--RNDKELESHVKTLIELAET--TDHRNHLADIV 309
            ++E     +D   L N+W  + D+   R  K++++++K  I L +   +D      DI 
Sbjct: 190 TNYEFLIKWVDESHLHNSWETYADIGQVRGIKKIDNYIKQFIILDKQIRSDPYTTAEDIE 249

Query: 310 EMDPITKELSLGKLKDH 326
            MD + KE  L + +++
Sbjct: 250 VMD-LEKERRLDEFEEY 265

>TBLA0E04910 Chr5 complement(1255397..1260436) [5040 bp, 1679 aa]
           {ON} Anc_4.375 YJR140C
          Length = 1679

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 56/113 (49%), Gaps = 6/113 (5%)

Query: 84  FSTRRLNLHLLPI-LQEKNGIIIVDSTRRGKLMPDALSKTIPIWCAVLNSLMQPD-KSEV 141
           F +++L   +L   L + N II +   RRG ++P  L  +I  + ++L  L   + KS  
Sbjct: 143 FKSKKLERLILEYELSKSNNIIPLSGRRRGGILP-QLKVSIRQYASLLKKLNDNEAKSYQ 201

Query: 142 LFTPPKCVSQSEHDSIKTRIPSLVDRLEKLDILDAQDLR--NKFQGKILRPFW 192
           L    K +++ + D I T +  L+  ++K+   D Q ++  + F+  I +  W
Sbjct: 202 LLNIKKLITEQDFDDI-TELNPLLKTIQKMKTEDEQTMKELDAFEVTISKLSW 253

>AGR204W Chr7 (1140088..1142592) [2505 bp, 834 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL084W (BRO1)
          Length = 834

 Score = 31.2 bits (69), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 41/95 (43%), Gaps = 22/95 (23%)

Query: 264 DPKLLWNNWHYFH---------DLD-----------RNDKELESHVKTLIELAETTDHRN 303
           +P LLWNN++ F          DLD           R  ++L  ++K L E  E T    
Sbjct: 525 NPTLLWNNFNTFTTSQPTPDLLDLDHSKADEVLAKIRQIRQLYENLKLLKE--ERTSIMK 582

Query: 304 HLADIVEMDPITKELSLGKLKDHTAITPNIARELD 338
            L D+V  D ITK+L L   K  + I      EL+
Sbjct: 583 DLKDLVNQDDITKQLILNNNKSDSQIKTLFQEELE 617

>KLTH0F04334g Chr6 complement(382773..384677) [1905 bp, 634 aa] {ON}
           similar to uniprot|P34237 Saccharomyces cerevisiae
           YKL179C
          Length = 634

 Score = 30.8 bits (68), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 41/77 (53%), Gaps = 3/77 (3%)

Query: 339 SQFSLVIILSQSVTLSK---PFDFIKTYNLQSGSKRSSKDLRAALIEIDHIVSAHLNKDV 395
           S+FS  ++L+    LS+   P   ++  + QS S+     L+  +IE++H VS H + D 
Sbjct: 83  SKFSEEVLLNLYAKLSETPDPQPLLEASSQQSHSEEEIAGLKNTIIELEHKVSKHADYDK 142

Query: 396 VKRKPIMVCCNSGTDIS 412
           ++ + + +  NS   +S
Sbjct: 143 IRARLLDLEQNSAKTLS 159

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,954,833
Number of extensions: 2370989
Number of successful extensions: 6448
Number of sequences better than 10.0: 37
Number of HSP's gapped: 6564
Number of HSP's successfully gapped: 37
Length of query: 472
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 359
Effective length of database: 40,524,141
Effective search space: 14548166619
Effective search space used: 14548166619
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)