Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0G14322g8.847ON55055027230.0
TDEL0B005108.847ON55055710061e-130
SAKL0D01298g8.847ON5515078511e-107
KLTH0C03718g8.847ON5515126984e-84
Kpol_1068.38.847ON5664936891e-82
Kwal_27.102248.847ON5465056722e-80
TPHA0I002908.847ON5694725327e-60
Smik_13.4958.847ON5764694942e-54
Skud_13.4548.847ON5804434821e-52
YMR282C (AEP2)8.847ON5804824425e-47
Suva_13.4718.847ON5814534382e-46
Ecym_46188.847ON5274444081e-42
NCAS0C003708.847ON4954283972e-41
NDAI0K003408.847ON6244833713e-37
KAFR0B039708.847ON4744433646e-37
CAGL0M03069g8.847ON5485203632e-36
KLLA0D01408g8.847ON5185093472e-34
TBLA0B033108.847ON6134203404e-33
KNAG0J002308.847ON4744493038e-29
ABL119C8.847ON5373882152e-17
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0G14322g
         (550 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]...  1053   0.0  
TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847...   392   e-130
SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly s...   332   e-107
KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly...   273   4e-84
Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..599...   270   1e-82
Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282...   263   2e-80
TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}...   209   7e-60
Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {...   194   2e-54
Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {...   190   1e-52
YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON} ...   174   5e-47
Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {...   173   2e-46
Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {O...   161   1e-42
NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847...   157   2e-41
NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON...   147   3e-37
KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {O...   144   6e-37
CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa] ...   144   2e-36
KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly...   138   2e-34
TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {O...   135   4e-33
KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.84...   121   8e-29
ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON} S...    87   2e-17

>ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282C AEP2 Mitochondrial protein likely
           involved in translation of the mitochondrial OLI1 mRNA
           exhibits genetic interaction with the OLI1 mRNA 5'-
           untranslated leader
          Length = 550

 Score = 1053 bits (2723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/550 (93%), Positives = 514/550 (93%)

Query: 1   MLRTACSRSHVFKAFSSSLMLEHXXXXXXXXXXXXXXXXXXXXXXHDSTLKSELPLRTLN 60
           MLRTACSRSHVFKAFSSSLMLEH                      HDSTLKSELPLRTLN
Sbjct: 1   MLRTACSRSHVFKAFSSSLMLEHALAAANSSGAAAPTNAASTGNSHDSTLKSELPLRTLN 60

Query: 61  DELHNAERKYIKPLTNAPEWSSTRTGPNSKIREYLKNGQYTKLLIRLSVDNHLNNEYISG 120
           DELHNAERKYIKPLTNAPEWSSTRTGPNSKIREYLKNGQYTKLLIRLSVDNHLNNEYISG
Sbjct: 61  DELHNAERKYIKPLTNAPEWSSTRTGPNSKIREYLKNGQYTKLLIRLSVDNHLNNEYISG 120

Query: 121 LFTTGGLTKSEYSLFINKLLSEEELDVKLSNVIPDTPHTELIYKLYEFYCDHIVDQHNLT 180
           LFTTGGLTKSEYSLFINKLLSEEELDVKLSNVIPDTPHTELIYKLYEFYCDHIVDQHNLT
Sbjct: 121 LFTTGGLTKSEYSLFINKLLSEEELDVKLSNVIPDTPHTELIYKLYEFYCDHIVDQHNLT 180

Query: 181 PLQLYDLNLFLKTFIAEAQLSKAHNVLDFILLRRPLNDLLANTDVEILIQFLRLKCGALS 240
           PLQLYDLNLFLKTFIAEAQLSKAHNVLDFILLRRPLNDLLANTDVEILIQFLRLKCGALS
Sbjct: 181 PLQLYDLNLFLKTFIAEAQLSKAHNVLDFILLRRPLNDLLANTDVEILIQFLRLKCGALS 240

Query: 241 KFWKIQPASQRNSTAITLGEKASDCHLAKSYKFQNEKVLLQIINSVLGEHNWKNRRSPKL 300
           KFWKIQPASQRNSTAITLGEKASDCHLAKSYKFQNEKVLLQIINSVLGEHNWKNRRSPKL
Sbjct: 241 KFWKIQPASQRNSTAITLGEKASDCHLAKSYKFQNEKVLLQIINSVLGEHNWKNRRSPKL 300

Query: 301 DAAIIYSLGYLGQTDLIEKYVNRTWSPSKDEGVKTNPNSDLLVAVLTSYCVKEGNMRKGL 360
           DAAIIYSLGYLGQTDLIEKYVNRTWSPSKDEGVKTNPNSDLLVAVLTSYCVKEGNMRKGL
Sbjct: 301 DAAIIYSLGYLGQTDLIEKYVNRTWSPSKDEGVKTNPNSDLLVAVLTSYCVKEGNMRKGL 360

Query: 361 EVLDRFIRDYPEVELDPXXXXXXXXXXXXXXDKKRDRKATLSHGCWTIMKQWHAQRQRKI 420
           EVLDRFIRDYPEVELDP              DKKRDRKATLSHGCWTIMKQWHAQRQRKI
Sbjct: 361 EVLDRFIRDYPEVELDPLFWRRLLQLSSLLWDKKRDRKATLSHGCWTIMKQWHAQRQRKI 420

Query: 421 PYDYGIMKELYPIFVRTKNKNGALEVITKSFFGAFIQPEFTIRPNELSLLCKYQRFILKM 480
           PYDYGIMKELYPIFVRTKNKNGALEVITKSFFGAFIQPEFTIRPNELSLLCKYQRFILKM
Sbjct: 421 PYDYGIMKELYPIFVRTKNKNGALEVITKSFFGAFIQPEFTIRPNELSLLCKYQRFILKM 480

Query: 481 IALKGNYHKGFEFCQEWSFSSTNKFELQSYFMKWRGIHEQRRTSQSKQKAALQEKYDEME 540
           IALKGNYHKGFEFCQEWSFSSTNKFELQSYFMKWRGIHEQRRTSQSKQKAALQEKYDEME
Sbjct: 481 IALKGNYHKGFEFCQEWSFSSTNKFELQSYFMKWRGIHEQRRTSQSKQKAALQEKYDEME 540

Query: 541 EDDMLLGRLW 550
           EDDMLLGRLW
Sbjct: 541 EDDMLLGRLW 550

>TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847
           YMR282C
          Length = 550

 Score =  392 bits (1006), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 218/557 (39%), Positives = 327/557 (58%), Gaps = 14/557 (2%)

Query: 1   MLRTACSRSHVFKAFSSSLMLEHXXXXXXXXXXXXXXXXXXXXXXHDSTLKSELPLRTLN 60
           MLR   S   VFKAF+S+L +++                        S++ +   +  + 
Sbjct: 1   MLRRNHSIQQVFKAFNSTLSVDYAAAQASIVGAPVKHEERHTQTLTSSSINACRSISNVR 60

Query: 61  DELHNAERKYIKPLTNAPEWSSTR-TGPNSKIREYLKNGQYTKLLIRLSVDNHLNNEYIS 119
           D L   E  Y  P        STR T   +++REYL+  +Y   LI + V NHLN  YI 
Sbjct: 61  DTLRGLESLYALP--GVEYGRSTRDTVSTNQLREYLRRKEYVDFLIHVMVQNHLNRNYIK 118

Query: 120 GLFTTGGLTKSEYSLFINKLLSEEELDVKLSNVIPDTPHTELIYKLYEFYCDHIV--DQH 177
            LF T  L+ SE+S FIN+LL E++LD+KLSN+IPDT HTE+I+ LY+ YC +++   Q+
Sbjct: 119 SLFETKELSTSEFSTFINRLLLEKDLDLKLSNIIPDTVHTEIIFNLYQIYCTYVIKDSQN 178

Query: 178 NLTPLQLYDLNLFLKTFIAEAQLSKAHNVLDFILLRRPLNDLLANTDVEILIQFLRLKCG 237
            LTPLQ++D+N F+K FI EAQL KA   L F++ ++ L+++L + DVE + QFL+L+CG
Sbjct: 179 GLTPLQVHDINRFIKRFIDEAQLKKAQECLQFLIDKQGLHNILQSGDVETITQFLQLRCG 238

Query: 238 ALSKFWKIQPASQRNSTAITLGEKASDCHLAKSYKFQNEKVLLQIINSVLGEHNWKNRRS 297
           AL KFW++      NST + LGE +      KSY    E+  L+I+N +L + +W+ R S
Sbjct: 239 ALQKFWRVDS----NSTKV-LGEDSKHFKSPKSYNLLKEQPFLEIVNFLLKDKSWRLRSS 293

Query: 298 PKLDAAIIYSLGYLGQTDLIEKYVNRTWSPSKDEGVKTN----PNSDLLVAVLTSYCVKE 353
           P +D+AI+YSL  LGQT LI++Y+   W  S+D  V       P  ++L+ ++++YC+K 
Sbjct: 294 PIIDSAIVYSLSNLGQTKLIDQYIQLKWGISEDGHVAVKNEAVPGHEVLINIVSAYCLKN 353

Query: 354 GNMRKGLEVLDRFIRDYPEVELDPXXXXXXXXXXXXXXDKKRDRKATLSHGCWTIMKQWH 413
           G+  KGL +LD+F++ YP+ EL+               DK++D+KA + HGCW IMKQWH
Sbjct: 354 GDTGKGLRILDQFMKKYPQTELEKLFWRRLLQLSFHNWDKQKDKKALVCHGCWNIMKQWH 413

Query: 414 AQRQRKIPYDYGIMKELYPIFVRTKNKNGALEVITKSFFGAFIQPEFTIRPNELSLLCKY 473
            Q+   I YD G ++ LY +F  T+N  GA EV+   F   + +  + I  +E+ LL  +
Sbjct: 414 EQKGVSITYDSGTLRLLYQLFKFTRNGRGAAEVVRTCFSSVYAKQPYQISKDEMDLLLMF 473

Query: 474 QRFILKMIALKGNYHKGFEFCQEWSFSSTNKFELQSYFMKWRGIHEQRRTSQSKQKAALQ 533
           Q+  LK +ALKG Y++  +  +EW+    N+  L  YFM+ R  ++  R     ++   Q
Sbjct: 474 QKLALKTMALKGRYNEPLQLIKEWNVDKINQHYLLDYFMRHRRKYDLTRDKARAKQQQQQ 533

Query: 534 EKYDEMEEDDMLLGRLW 550
            +YD MEE+DMLLGRLW
Sbjct: 534 AQYDNMEEEDMLLGRLW 550

>SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  332 bits (851), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 186/507 (36%), Positives = 296/507 (58%), Gaps = 25/507 (4%)

Query: 57  RTLNDELHNAERKYIKPLTNAPEWSSTR-----TGPNSKIREYLKNGQYTKLLIRLSVDN 111
           R+L  +L   E KY K L    +W +T      + P + +R++L++ ++ K L+ L ++ 
Sbjct: 57  RSLKIKLLLKEEKYSKQLH---KWGTTAEQIKPSLPRNNLRQHLQDNEHAKFLVELLLEC 113

Query: 112 HLNNEYISGLFTTGGLTKSEYSLFINKLLSEEELDVKLSNVIPDTPHTELIYKLYEFYCD 171
             +  + + +F+   +TK EYS+F+NKLLS   L  +L+N+IP T HTE+++KLYE Y D
Sbjct: 114 KSDEGFANRMFSEKLITKLEYSVFVNKLLSNTNLKSELTNLIPGTVHTEVLFKLYEIYRD 173

Query: 172 HIVDQHNLTPLQLYDLNLFLKTFIAEAQLSKAHNVLDFILLRRPLNDLLANTDVEILIQF 231
            +V    LTP+QLYDLN F+K F  +AQL+KA  VL F+L     N      D + LI +
Sbjct: 174 SVVGNATLTPVQLYDLNQFIKRFTGDAQLAKAQQVLGFVL----ENYGSIPRDPQTLINY 229

Query: 232 LRLKCGALSKFWKIQPASQRNSTAITLGEKASDCHLAKSYKFQNEKVLLQIINSVLGEHN 291
           L LKCGA+ + W I P S R     TLG ++   +LA SYK    + LL +I+ ++ +  
Sbjct: 230 LELKCGAMPRNWSI-PLS-RPELGKTLGSQSFMSNLAHSYKVLETEALLPLIDEMMKDRA 287

Query: 292 WKNRRSPKLDAAIIYSLGYLGQTDLIEKYVNRTWSPSKDEGVKTN--------PNSDLLV 343
           W  +R+  L+AA+IYSLGY+GQ  L+E+Y+  TW  S      T         P S+LL+
Sbjct: 288 WHYKRNCDLEAAVIYSLGYMGQFALLERYIKHTWGVSVSSNTSTEVEVPKNLYPTSNLLI 347

Query: 344 AVLTSYCVKEGNMRKGLEVLDRFIRDYPEVELDPXXXXXXXXXXXXXXDKKRDRKATLSH 403
           ++++ Y +K GN+ + L+++D F+  +P++EL+P              ++K D K  LS+
Sbjct: 348 SIVSCYAMK-GNLHQALQIIDSFLSKFPQIELEPLFWRRLFQWSTRLWNQKTDPKGELSN 406

Query: 404 GCWTIMKQWHAQRQRKIPYDYGIMKELYPIFVRTKNKNGALEVITKSFFGAFIQPEFTIR 463
           GCW +MKQWH +++R +P D GI+ E Y +  RT N   AL +  ++  G +++    I 
Sbjct: 407 GCWQVMKQWHNKQKRSLPIDLGILNERYYVLKRTNNFTEALRIHDEALAGLYMKRNL-ID 465

Query: 464 PNELSLLCKYQRFILKMIALKGNYHKGFEFCQEWSFSSTNKFELQSYFMKWRGIHEQRRT 523
           P E+ ++ K+Q+ ILK +A +G YHK  ++  EW  +  N+ E++ YF + R  +  R  
Sbjct: 466 P-EVDVIKKFQKLILKKMAGRGYYHKPLKYISEWCLNKRNELEMREYFDRHRKAYITRIE 524

Query: 524 SQSKQKAALQEKYDEMEEDDMLLGRLW 550
            + +++   Q  +D  EEDDMLLGRLW
Sbjct: 525 QRKQKQETAQVTFDAEEEDDMLLGRLW 551

>KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  273 bits (698), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 173/512 (33%), Positives = 281/512 (54%), Gaps = 26/512 (5%)

Query: 55  PLRTLNDELHNAERKYIK-------PLTNAPEWSSTRTGPNSKIREYLKNGQYTKLLIRL 107
           P +TLND +     ++         P  +  + SS  + P +K+R +L +  Y   L+ L
Sbjct: 50  PAKTLNDAVRERSERFRSRVYTAKIPKLHEEQVSSGFSSPCNKLRSFLHSRDYMAFLVEL 109

Query: 108 SVDNHLNNEYISGLFTTGGLTKSEYSLFINKLLSEEELDVKLSNVIPDTPHTELIYKLYE 167
           ++ + ++  + + +F    L+ +E+S FI  LLS   L  KLS  +P+   TE+++ LY+
Sbjct: 110 TLQSRMDENFGAKMFQNNDLSIAEFSAFIEGLLSVNNLLHKLSATLPNVSGTEMVFSLYQ 169

Query: 168 FYCDHIVDQHNLTPLQLYDLNLFLKTFIAEAQLSKAHNVLDFILLRRPLNDLLANTDVEI 227
            Y    V    L+PLQL+D N F++ FI  AQL KA  VLD IL  +  N+ L   D   
Sbjct: 170 LYLK-TVTPGPLSPLQLHDFNKFIRFFIRSAQLRKAQTVLDCIL--KSNNNQLP-CDSAT 225

Query: 228 LIQFLRLKCGALSKFWKIQPASQRNSTAITLGEKASDCHL-AKSYKFQNEKVLLQIINSV 286
              +L+L+CGAL + WK+   +   ST   LG + +   L + SYK  + K +L  + S+
Sbjct: 226 ATHYLQLRCGALPRNWKVLDENLGRST--RLGARKNRYQLVSHSYKALDHKSVLTFM-SL 282

Query: 287 LGEHN--WKNRRSPKLDAAIIYSLGYLGQTDLIEKYVNRTWSPSKDEGVK------TNPN 338
           L +    W +R+S  L++A++YSLG++GQ  L+E++V R W  S  E  +      T+P+
Sbjct: 283 LSDPKSVWFHRKSAALESAVVYSLGFMGQLKLLEEHVWRNWGISLQEHNQVTDASFTSPS 342

Query: 339 SDLLVAVLTSYCVKEGNMRKGLEVLDRFIRDYPEVELDPXXXXXXXXXXXXXXDKKRDRK 398
           S++LVAVLTSY   + N+   L ++D F+  YP +ELD                +K D +
Sbjct: 343 SEVLVAVLTSYASNK-NISSALHLIDGFMAKYPTLELDHVFWRRLFQWSTRVWSEKTDPR 401

Query: 399 ATLSHGCWTIMKQWHAQRQRKIPYDYGIMKELYPIFVRTKNKNGALEVITKSFFGAFIQP 458
             LS GCW +M++WHA R R++P D  ++ E + +  RT N   A+EV+ + +  +F Q 
Sbjct: 402 GELSRGCWRVMREWHAARNRQLPADAVLLNERFVVLSRTNNYRDAIEVVEQCY-SSFFQ- 459

Query: 459 EFTIRPNELSLLCKYQRFILKMIALKGNYHKGFEFCQEWSFSSTNKFELQSYFMKWRGIH 518
           +  +  +E  L  K+ + ILK +A  G YHK  +F +EWS +   +  L++YF K R  +
Sbjct: 460 KANLSRHEAVLFQKFAKLILKNMAHLGYYHKPLKFIKEWSPNKLLEHTLRAYFEKHRNAY 519

Query: 519 EQRRTSQSKQKAALQEKYDEMEEDDMLLGRLW 550
             R+  +++     Q+++D+ EED MLLGRLW
Sbjct: 520 SARKQRRTEAAQKAQKRFDDEEEDSMLLGRLW 551

>Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..5995)
           [1701 nt, 567 aa]
          Length = 566

 Score =  270 bits (689), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 162/493 (32%), Positives = 260/493 (52%), Gaps = 35/493 (7%)

Query: 87  PNSKIREYLKNGQYTKLLIRLSVDNHLNNEYISGLFTTGGLTKSEYSLFINKLLSEEELD 146
           P +  R YLKN +  K  + L      +++++  LF +G LT +E S+FIN++      D
Sbjct: 80  PENIWRNYLKNNEIDKFTLHLLASLRGDDDFVKNLFKSGDLTYNELSIFINRIYKSNGHD 139

Query: 147 VKLSNVIPD---TPHTELIYKLYEFYCDHIVDQHN---LTPLQLYDLNLFLKTFIAEAQL 200
           +K   VI +     +TELIY+++E Y   I  +     L  L L DLNLF+  FI EAQL
Sbjct: 140 IK--RVIQNHHSLSYTELIYEIFELYTSTIPKESGIIKLNALHLKDLNLFITIFIKEAQL 197

Query: 201 SKAHNVLDFILLRRPLNDLLANTDVEILIQFLRLKCGALSKFWKIQPAS----QRNSTAI 256
           SKA NVL +I+       +   TD + ++ FLRL+CG L KFW +  AS    ++     
Sbjct: 198 SKAQNVLQYII--DAEGSIEKITDHDTMVNFLRLRCGGLPKFWLVPQASYAVTKQTKKNS 255

Query: 257 TLGEKASDCHLAKSYKFQ-NEKVLLQIINSVLGEHNWKNRRSPKLDAAIIYSLGYLGQTD 315
            L   + +     SYK      VL ++IN +L +  WK++ S  LD+ I+YSL +  Q  
Sbjct: 256 RLSSNSPNTRFPSSYKSTVPNTVLFEVINMILNKKVWKSKHSGILDSTIVYSLAHTFQKQ 315

Query: 316 LIEKYVNRTWSPS----------KDEGVKTNPNSDLLVAVLTSYCVKEGNMRKGLEVLDR 365
           +++ ++   W  S          K + V + P++++L+A+++SY  K+ N+   +++LD+
Sbjct: 316 MMDGFIKEHWGISSHGDPLDLFIKKKKVASAPSNEILIAIMSSYIYKDRNIDGAMKILDK 375

Query: 366 FIRDYPEVELDPXXXXXXXXXXXXXXDKKRDRKATLSHGCWTIMKQWHAQRQRK---IPY 422
           FIR YP++ LD               D K DR+ T  +GCW +MK W+     K   +PY
Sbjct: 376 FIRMYPDISLDNMFWRRLIQWCNRLWDPKIDRQGTFGYGCWNMMKNWNGAGTGKDVVLPY 435

Query: 423 DYGIMKELYPIFVRTKNKNGALEVITKSFFGAFIQPEFTIRPNELSLLCKYQRFILKMIA 482
           D+ I +E Y +F RT N   A E+++        +    ++  EL+LL KYQ   +  + 
Sbjct: 436 DFQIYEEFYRLFKRTNNGKIAAEIVSNVLIPHLSEKNVAVKKAELNLLNKYQTLAMNWLI 495

Query: 483 LKGNYHKGFEFCQEWSFSSTNKFELQSYFMK-----WRGIHEQRRTSQSKQKAALQEKYD 537
            +  + K   F +EWS    N+ +L+  F K      R +  + + SQS++K   Q++YD
Sbjct: 496 ERRQFKKAAFFIEEWSIDRNNRIQLREAFKKRKQLMLRKLSTRDKKSQSQKKR--QDRYD 553

Query: 538 EMEEDDMLLGRLW 550
           EMEE+DM++GRLW
Sbjct: 554 EMEEEDMIIGRLW 566

>Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282C
           (AEP2) - basic, hydrophilic 67.5 kDa protein [contig 39]
           FULL
          Length = 546

 Score =  263 bits (672), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 168/505 (33%), Positives = 268/505 (53%), Gaps = 21/505 (4%)

Query: 57  RTLNDELHNAERKYI--KPLTNAPEWSSTRTGPNSKIREYLKNGQYTKLLIRLSVDNHLN 114
           RT+ D   +  +  I    +  A   SS  T   +++R  L    Y K +I L++ + LN
Sbjct: 52  RTMADAFQDKTKGLICATNIHQAESPSSDTTQGMNRLRSLLNTKDYIKFMIELTIQSKLN 111

Query: 115 NEYISGLFTTGGLTKSEYSLFINKLLSEEELDVKLSNVIPDTPHTELIYKLYEFYCDHIV 174
           + +   +F    LT +E+S  +N LL+E  L  KL  V+P    TE+I+ LY+ Y    +
Sbjct: 112 SNFSHKIFEDNLLTPNEFSTLLNGLLTERNLSTKLETVLPSVQSTEMIFGLYQTYL-MTI 170

Query: 175 DQHNLTPLQLYDLNLFLKTFIAEAQLSKAHNVLDFILLRRPLNDLLANTDVEILIQFLRL 234
              +L PLQL+DLN F++ FI  AQL KA  VLD IL     ND L   D    I +L+L
Sbjct: 171 PAGSLNPLQLHDLNSFVQYFIETAQLGKAQIVLDRILASN--NDQLP-CDTTTGIHYLQL 227

Query: 235 KCGALSKFWKIQPASQRNSTAITLGEKASDCH-LAKSYKFQNEKVLLQIINSVLGEHN-- 291
           +CGAL + WK+     R   +  LG   +    ++ +YK  ++  +L+ +N VL + N  
Sbjct: 228 RCGALPRNWKV--FDSRVGHSCRLGSHRNKSQPVSHTYKALDQSSVLEFVN-VLNDENSE 284

Query: 292 WKNRRSPKLDAAIIYSLGYLGQTDLIEKYVNRTWSPSK------DEGVKTNPNSDLLVAV 345
           W +++SP L+AA+IYSLG++GQ  L+++++   W  ++       E  +  P+ ++L+A+
Sbjct: 285 WFHKKSPTLEAAVIYSLGFMGQLTLLKEHIAVRWGITELGASLATEVNEVPPSPEVLIAI 344

Query: 346 LTSYCVKEGNMRKGLEVLDRFIRDYPEVELDPXXXXXXXXXXXXXXDKKRDRKATLSHGC 405
            TS+   +  +  GL ++D FI  Y E+ LD               D K D +  LS GC
Sbjct: 345 FTSFASHQ-EVTLGLRLMDAFITKYSEINLDIVFWRRLFQWTNLVWDVKTDPRGDLSRGC 403

Query: 406 WTIMKQWHAQRQRKIPYDYGIMKELYPIFVRTKNKNGALEVITKSFFGAFIQPEFTIRPN 465
           W +M +WH +  +K+  D  ++ E Y +  +T N   AL VI++SF   + +P  T+   
Sbjct: 404 WRVMTEWHEKGSKKLQPDTTLLNERYFVLAQTNNYKEALTVISQSFPQLYEKP--TLSSK 461

Query: 466 ELSLLCKYQRFILKMIALKGNYHKGFEFCQEWSFSSTNKFELQSYFMKWRGIHEQRRTSQ 525
           E++++ KY + +LK +A  G YHK   F  EWS +   +  L+ YF K R    +R+   
Sbjct: 462 EMAIVQKYSKLVLKSMAELGYYHKPLTFITEWSPNKAVEDSLRVYFKKHRDGFTKRKERL 521

Query: 526 SKQKAALQEKYDEMEEDDMLLGRLW 550
            ++    Q  YD+ EED+MLLGRLW
Sbjct: 522 REESRRKQNTYDDEEEDNMLLGRLW 546

>TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}
           Anc_8.847 YMR282C
          Length = 569

 Score =  209 bits (532), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 144/472 (30%), Positives = 237/472 (50%), Gaps = 41/472 (8%)

Query: 112 HLNNEY--ISGLFTTGGLTKSEYSLFINKLLSEEEL--DVKLSNVIPDTPHTELIYKLYE 167
           H +N Y  +  L  +  LT +E+S+F+N+L+  +    D  +    P+  H+E+++KL++
Sbjct: 106 HNDNSYMFLRELLESKQLTFNEFSIFLNRLIDRKGFIYDSIVLKEFPNGKHSEMVFKLFQ 165

Query: 168 FYCDHIVDQHNLTPLQLYDLNLFLKTFIAEAQLSKAHNVLDFILLR-RPLNDLLANTDVE 226
            Y + I     L+ L L D+NLF++ FI E  L +A  VL F+L + R + DL    DV+
Sbjct: 166 LYGNAI-GSDKLSLLSLRDMNLFIEFFINEGHLGRAEIVLTFVLNKTRSILDLY---DVD 221

Query: 227 ILIQFLRLKCGALSKFWKIQPASQR-----------NSTAITLGEKASDCHLAKSYKFQN 275
            +  +L+L+CGAL ++W  Q  S             +     LG K     L   YK  +
Sbjct: 222 TVTHYLQLRCGALPRYWMFQNKSAELAYKDKFGNRLSKYKTRLGRKNFAVKLTNRYKILD 281

Query: 276 EKVLLQIINSVLGEHNWKNRRSPKLDAAIIYSLGYLGQTDLIEKYVNRTWSPS------- 328
              +L+I N ++ +  WK+  S KLDA ++YSL Y GQ   I  Y+N  W+         
Sbjct: 282 PLGVLKIANKIITDDKWKSNHSAKLDATVVYSLCYSGQLSNIPSYINSRWNVDISMSDGN 341

Query: 329 -------KDEGVKTNPNSDLLVAVLTSYCVKEGNMRKGLEVLDRFIRDYPEVELDPXXXX 381
                   +E  K  P S+++ A+L+SY   + ++ + + ++D+ +  YP +EL+     
Sbjct: 342 SDVGTQISNEASKPLP-SEVMEAILSSYSYDDKSIERAINIIDKIMNSYPNLELNQQFWR 400

Query: 382 XXXXXXXXXXDKKRDRKATLSHGCWTIMKQWHAQRQRKIPYDYGIMKELYPIFVRTKNKN 441
                     D K DRK +L +GC+  +K++H  R  +I +D G+++ELY +   TKN  
Sbjct: 401 RLMQWSVLCWDHKLDRKGSLVYGCFKTLKKYHEMRSIRINFDEGLLQELYTLVYYTKNSR 460

Query: 442 GALEVITKSFFGAFIQPEFTIRPNELSLLCKYQRFILKMIALKGNYHKGFEFCQEWSFSS 501
            A EV+++     F +    I   E  LL  +Q+  +  +  K +Y     F ++WS  +
Sbjct: 461 IAAEVVSEFMPQFFYKRSDEITFGERKLLFYFQKRSIDGMLGKKDYFTASNFIEKWSMDN 520

Query: 502 TNKFELQSYFMK--WRGIHEQRRTS-QSKQKAALQEKYDEMEEDDMLLGRLW 550
            NK EL  Y+     + + + RR S Q K K  L+   D  +EDD LLGRLW
Sbjct: 521 QNKEELFKYYKDSIAKKLQKVRRNSLQQKIKEKLE---DHSDEDDTLLGRLW 569

>Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {ON}
           YMR282C (REAL)
          Length = 576

 Score =  194 bits (494), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 136/469 (28%), Positives = 232/469 (49%), Gaps = 44/469 (9%)

Query: 118 ISGLFTT-------GGLTKSEYSLFINKLLSEEELDVKLSNVIPD--TPHTELIYKLYEF 168
           IS LFT          L+ +E S  +NKL S   L  ++  +  D    ++E  +K++  
Sbjct: 116 ISYLFTKTVDSGPRNSLSLAELSFLLNKLYS---LRFQIRGICRDIKVKYSEFWFKIFSL 172

Query: 169 YCDHIVDQHN--------LTPLQLYDLNLFLKTFIAEAQLSKAHNVLDFILLRRPLNDLL 220
           Y + +  + N        L   +++D+NL ++ FI   QL KA  +L FI+ R P  D+L
Sbjct: 173 YAEKVDAKRNHINLRNTTLDACEIFDINLLIRNFIELGQLGKAQKILTFIIDRNP--DIL 230

Query: 221 A---NTDVEILIQFLRLKCGALSKFWKIQPASQRNST----AITLGEKASDCHLAKSYKF 273
               N D+  ++ FL+L+CGAL+ +WKI   S ++       + LG K +   L+ +YK 
Sbjct: 231 LSPNNADIGTMVHFLKLRCGALAAYWKIPDNSGQDQKQLRKIVRLGAKNTSIRLSSTYKV 290

Query: 274 QNEKVLLQIINSVLGEHNWKNRRSPKLDAAIIYSLGYLGQTDLIEKYVNRTWSPSKDE-- 331
            + + LL+I + VL E  + N  S  L + +I S G+LGQT ++E+ +   W  +  E  
Sbjct: 291 MDHQTLLKIADLVLHEKRFLN--SEDLLSTLIQSFGHLGQTQILERCIEHIWHITTQEFP 348

Query: 332 ---GVKTN---PNSDLLVAVLTSYCVKEGNMRKGLEVLDRFIRDYPEVELDPXXXXXXXX 385
               +K     P+S +L+++L S+   + ++ +GL +LD FI+ YPEV+LD         
Sbjct: 349 SHVAIKPRGCYPSSKILISILVSFHYNDNDLHRGLSILDSFIKHYPEVKLDALFWRRLFQ 408

Query: 386 XXXXXXDKKRDRKATLSHGCWTIMKQWHAQRQRKIPYDYGIMKELYPIFVRTKNKNGALE 445
                    +D+KAT    CW +MKQWH  +   +  DY  +++LY I  +T N    ++
Sbjct: 409 LSNFAWTPAKDKKATSVIRCWHLMKQWHVSKGLSLSVDYETLRQLYDIMKKTGNFPLGID 468

Query: 446 VITKSFFGAFIQPEFTIRPNELSLLCKYQRFILKMIALKGNYHKGFEFCQEWSFSSTNKF 505
           V+ KSF     +   T       +L KYQ++I+K +  +G      EF  ++ F  T   
Sbjct: 469 VL-KSFKSGIERLRETNSDKLNIVLIKYQKYIIKQLVDRGRISAVREFINDFGFDRTITK 527

Query: 506 ELQSYF---MKWRGIHEQRRTSQSKQKAALQ-EKYDEMEEDDMLLGRLW 550
            L  +    +  R    + +    K++  L+   +D+ E+D M++G LW
Sbjct: 528 NLNIFCTNRLLLRSKKNKSKIENKKERNKLEPSGFDDDEDDGMIIGSLW 576

>Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {ON}
           YMR282C (REAL)
          Length = 580

 Score =  190 bits (482), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 133/443 (30%), Positives = 225/443 (50%), Gaps = 37/443 (8%)

Query: 137 NKLLSEEELDVKLSNVIPDTPHTELIYKLYEFYCDHI---VDQHNL--TPL---QLYDLN 188
           NKL S+   +++L     +  ++E  +KL+  Y + +    DQ NL  T L   +++DLN
Sbjct: 146 NKLYSQR-FEIRLICKEINVKYSEFWFKLFSLYAEKVDTRRDQVNLRNTALDSCEIFDLN 204

Query: 189 LFLKTFIAEAQLSKAHNVLDFILLRRPLNDLL---ANTDVEILIQFLRLKCGALSKFWKI 245
           L +K FI   QLSKA  +L FIL R P  D+L    N D+  ++ FL+L+CGAL+ +WKI
Sbjct: 205 LLIKNFIELGQLSKAQKILSFILDRNP--DILLSPRNADIGTIVHFLQLRCGALTAYWKI 262

Query: 246 QPASQRNST----AITLGEKASDCHLAKSYKFQNEKVLLQIINSVLGEHNWKNRRSPKLD 301
              S R        + LG K +   L+ +YK  + + LL+I + VL +  + N  S  L 
Sbjct: 263 PDNSGRKQNQLRRMVRLGAKNTSIRLSSTYKAMDHQTLLKIADLVLQDKRFLN--SEDLL 320

Query: 302 AAIIYSLGYLGQTDLIEKYVNRTWSPSKDE-----GVKTN---PNSDLLVAVLTSYCVKE 353
           + +I S G+LGQT ++E+ +   W  S  E      +K     P+S +L+++L S+ + +
Sbjct: 321 STLIQSFGHLGQTQILERCIEHIWQISSQEFPSHVAIKPRGCYPSSKILISILVSFHLND 380

Query: 354 GNMRKGLEVLDRFIRDYPEVELDPXXXXXXXXXXXXXXDKKRDRKATLSHGCWTIMKQWH 413
            ++ +GL +LD FI+ YPEV+LD                   D++A     CW +MK W+
Sbjct: 381 KDLHRGLSILDSFIKHYPEVKLDALFWRRLLQLSHFAWTPVNDKRAASIVKCWHLMKHWY 440

Query: 414 AQRQRKIPYDYGIMKELYPIFVRTKNKNGALEVITKSFFGAFIQPEFTIRPNEL-SLLCK 472
             ++     DY  +++LY +  +T N +  ++V+    F + I+   T  P +L ++L K
Sbjct: 441 ESKELSPSVDYETLRQLYEVMKKTGNFSLGIDVLKS--FKSGIEKMRTANPEKLEAILIK 498

Query: 473 YQRFILKMIALKGNYHKGFEFCQEWSFS-----STNKFELQSYFMKWRGIHEQRRTSQSK 527
           YQ+ I+K +  +G      +F  ++ F+       N F     F + + I       + +
Sbjct: 499 YQKCIIKQLVNRGKISAARKFIGDFGFNRRAAKDLNIFCSNRIFSRSKKIKNDIENKKKR 558

Query: 528 QKAALQEKYDEMEEDDMLLGRLW 550
              A    YD+ E+D M++G LW
Sbjct: 559 DGLA-PGNYDDDEDDGMIIGSLW 580

>YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON}
           AEP2Mitochondrial protein, likely involved in
           translation of the mitochondrial OLI1 mRNA; exhibits
           genetic interaction with the OLI1 mRNA 5'-untranslated
           leader
          Length = 580

 Score =  174 bits (442), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 132/482 (27%), Positives = 228/482 (47%), Gaps = 58/482 (12%)

Query: 121 LFTTGGLTKSEYSLFINKL------------LSEEELDVKLSNVIP------------DT 156
           + ++ G+ +SE+S  I+ L            LS E+L   LS +              + 
Sbjct: 105 IISSSGMDESEFSKSISYLFAKTVDPEPKDVLSLEDLSFLLSKLYTQRFQIRRICRDINA 164

Query: 157 PHTELIYKLYEFYCDHIVDQHN--------LTPLQLYDLNLFLKTFIAEAQLSKAHNVLD 208
            ++E  +KL+  Y + +  + N        L   +++D NL +K FI   QL KA  +L 
Sbjct: 165 KYSEFWFKLFSLYAEKVDAKRNQVNLRNTKLDACEIFDANLMIKNFIELGQLGKAQKILS 224

Query: 209 FILLRRPLNDLL---ANTDVEILIQFLRLKCGALSKFWKIQPASQRNS----TAITLGEK 261
           FIL R P  D+L    N D+  ++ FL+L+CGAL+ +WKI   S++        + LG K
Sbjct: 225 FILDRNP--DILLSPKNADISTIVHFLQLRCGALAPYWKIPDNSEQKQGFLRKMVRLGAK 282

Query: 262 ASDCHLAKSYKFQNEKVLLQIINSVLGEHNWKNRRSPKLDAAIIYSLGYLGQTDLIEKYV 321
            +   L+ +YK  + + LL+I +  L E    N  S  L + +I S G+LGQT ++E+ +
Sbjct: 283 NTSIRLSSTYKAMDHQTLLKIADLALQEKKLLN--SEDLLSTLIQSFGHLGQTQILERCI 340

Query: 322 NRTWSPSKDEGVK--------TNPNSDLLVAVLTSYCVKEGNMRKGLEVLDRFIRDYPEV 373
              W  S  E             P+S +LV++L S+   + ++ +GL +LD FI+ YP+V
Sbjct: 341 EHIWQISPQEFPSHVVIKHRGCYPSSKILVSILVSFYFNDHDLHRGLSILDSFIKHYPDV 400

Query: 374 ELDPXXXXXXXXXXXXXXDKKRDRKATLSHGCWTIMKQWHAQRQRKIPYDYGIMKELYPI 433
           +LD                   D+KAT    CW +MKQW+A ++ +   DY  +++LY I
Sbjct: 401 KLDALFWRRLFQLSHFAWTPANDKKATSVVRCWHLMKQWYASKRLRPSVDYETLRQLYDI 460

Query: 434 FVRTKNKNGALEVITKSFFGAFIQPEFTIRPNELSLLCKYQRFILKMIALKGNYHKGFEF 493
             +T N    ++V+ +SF     +          +++ KYQ+ I+K +  +G +    EF
Sbjct: 461 MKKTGNFPLGIDVL-RSFKPGIERTRAENAGKVNNIIIKYQKCIIKELVNRGRFSAVREF 519

Query: 494 CQEWSFS-----STNKFELQSYFMKWRGIHEQRRTSQSKQKAALQEKYDEMEEDDMLLGR 548
              + F        N F     F++ + +  +    + ++K  L     + E+D M++G 
Sbjct: 520 IDSYGFDRKMTKDLNIFCANRMFLRSKKMKNKIENKKEREKVRLDSFD-DDEDDGMIIGS 578

Query: 549 LW 550
           LW
Sbjct: 579 LW 580

>Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {ON}
           YMR282C (REAL)
          Length = 581

 Score =  173 bits (438), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 122/453 (26%), Positives = 227/453 (50%), Gaps = 37/453 (8%)

Query: 127 LTKSEYSLFINKLLSEEELDVKLSNVIPDTPHTELIYKLYEFYCDHIVDQHN-------- 178
           L+  + S  +N L S+     K+   I +  ++E  +KL+  Y + +  + N        
Sbjct: 137 LSLEDLSFLLNNLYSQRFEIKKICKDI-NVRYSEFWFKLFSLYAEKVDVKRNQINLRNTA 195

Query: 179 LTPLQLYDLNLFLKTFIAEAQLSKAHNVLDFILLRRPLNDLL---ANTDVEILIQFLRLK 235
           L   +++D+NL +K FI   QL KA  VL FIL R   +D+L    N D+  +I FL+L+
Sbjct: 196 LDSSEIFDMNLIIKNFIELGQLGKAQKVLSFILDRN--SDILLSPKNADIGTIIHFLQLR 253

Query: 236 CGALSKFWKIQPASQRNST--AITLGEKASDCHLAKSYKFQNEKVLLQIINSVLGEHNWK 293
           CGAL+ +WK+   S++  +   + LG K +   +  SYK  + + LL+I + VL +    
Sbjct: 254 CGALAAYWKMPDNSEQKYSRKMVRLGAKNTSIRITSSYKAMDHQTLLKIADLVLQKERLL 313

Query: 294 NRRSPKLDAAIIYSLGYLGQTDLIEKYVNRTWSPS----------KDEGVKTNPNSDLLV 343
           N  S  L + +I S G+LGQT ++E+ +   W  S          K +     P+S +L+
Sbjct: 314 N--SEDLLSTLIQSFGHLGQTQILERCIEHIWQISLQEFPSHATIKPKTRGCCPSSKILI 371

Query: 344 AVLTSYCVKEGNMRKGLEVLDRFIRDYPEVELDPXXXXXXXXXXXXXXDKKRDRKATLSH 403
           ++L S+ + + ++ +GL +LD FI+ YPEV++D                   D++AT   
Sbjct: 372 SILVSFHLNDNDLHRGLSILDSFIKHYPEVKVDELFWRRLFQLSHFAWTPTHDKRATSIV 431

Query: 404 GCWTIMKQWHAQRQRKIPYDYGIMKELYPIFVRTKNKNGALEVITKSFFGAFIQPEFTIR 463
            CW +MKQWH  +   +  DY  +++LY +  +T N +  ++V+    F   I     ++
Sbjct: 432 RCWHLMKQWHESKGFSLSVDYETLRQLYDLTKKTGNYSLGIDVLQN--FKPGITRTSAMK 489

Query: 464 PNELS-LLCKYQRFILKMIALKGNYHKGFEFCQEWSFS-----STNKFELQSYFMKWRGI 517
             +++ ++ K+Q++I+K +  +G      EF  ++SF        N F      ++ + +
Sbjct: 490 TEKINGIVIKHQKYIIKQLVNRGKTSAAREFINDFSFDIGAVKELNVFCTNRILLRSKKL 549

Query: 518 HEQRRTSQSKQKAALQEKYDEMEEDDMLLGRLW 550
             +    + + ++  Q  +D+ ++D M++G LW
Sbjct: 550 KNKTENRKERNRSG-QGNFDDDDDDGMVIGSLW 581

>Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {ON}
           similar to Ashbya gossypii ABL119C
          Length = 527

 Score =  161 bits (408), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 121/444 (27%), Positives = 207/444 (46%), Gaps = 31/444 (6%)

Query: 113 LNNEYISGLFTTGGL------TKSEYSLFINKLLSEEELDVKLSNVIPDTPHTELIYKLY 166
           L++  +SG    GGL      +  E+S+F N+LL        L   IP+     L  KLY
Sbjct: 77  LDDTKLSGDVHPGGLPACQEMSSEEFSIFFNRLLPTSGSSFSLKEAIPENMVVPLANKLY 136

Query: 167 EFYCDHIVDQHN--LTPLQLYDLNLFLKTFIAEAQLSKAHNVLDFILLRRPLNDLLANTD 224
           +FY   +  +     TP++L+DLN F   F+ E +L  A  VL  IL R+  ++ L   D
Sbjct: 137 QFYMAILEREKKTRFTPMELHDLNKFSNWFLNENKLKLARKVLQQIL-RQTGSEQLPR-D 194

Query: 225 VEILIQFLRLKCGALSKFWKIQPASQRNSTAITLGEKASDCHLAKSYKFQNEKVLLQIIN 284
            + L+ + +L  G+L+  W   P  +  S       + S       Y    E ++  ++ 
Sbjct: 195 HQTLVTYFQLYLGSLASLW---PTPKVQSACYDKLVRGSRRPKYVVYNSLPEGIMYDVLQ 251

Query: 285 SVLGEHNWKNRRSPKLDAAIIYSLGYLGQTDLIEKYVNRTWS----PSK-------DEGV 333
            +L   +WK+ RS +LDA I+YSL +  + DL E ++ R W     P K       D   
Sbjct: 252 KLLENDDWKHLRSSELDAKILYSLCHYNRMDLFEGFMERAWGIVDHPKKVEKEVPVDISS 311

Query: 334 KTNPNSDLLVAVLTSYCVKEGNMRKGLEVLDRFIRDYPEVELDPXXXXXXXXXXXXXXDK 393
            T P S++L+A++TS+  +  ++ K + ++D F+  YP+++L                D+
Sbjct: 312 GTYPGSEVLIAIVTSFSYR-NDLEKAVRLVDAFLNKYPQMDLRTEFWEKLFLWTRVMFDR 370

Query: 394 KRDRKATLSHGCWTIMKQWHAQRQRKIPYDYGIMKELYPIFVRTKNKNGALEVITKSFFG 453
           K D   +L   CW  M  W+  R   +PY   +    Y I  +T N   A+ +    +  
Sbjct: 371 KLDPLGSLQKACWLRMLSWYKSRGESVPYSSYLASCRYEILKQTSNYKDAMAMFP-DYMS 429

Query: 454 AFIQPEFTIRPNELSLLCKYQRFILKMIALKGNYHKGFEFCQEWSFSSTNKFELQSYFM- 512
           A        + N L+++ KYQ+F+++ ++ +G      +F ++W F+  N+ ELQ  F  
Sbjct: 430 AVYAKSAAAKHN-LTVVRKYQKFVIRELSARGKRDACTQFIEQWRFNEENEKELQDTFQR 488

Query: 513 ---KWRGIHEQRRTSQSKQKAALQ 533
              K+    E+RR+S   ++  LQ
Sbjct: 489 HWNKYTIRQEKRRSSARNKQLKLQ 512

>NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847
           YMR282C
          Length = 495

 Score =  157 bits (397), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 121/428 (28%), Positives = 218/428 (50%), Gaps = 36/428 (8%)

Query: 127 LTKSEYSLFINKLLSEEELDVKLSNVIPDTPHTELIYKLYEFYCDHIVDQHNLTPLQLYD 186
            T  EYSLF+ K+LS ++ DV          +  ++++L+E Y      + +L  LQ+YD
Sbjct: 100 FTLEEYSLFLGKVLSMKDSDV----------NVNVVFQLFEIYARMYCGEGSLNALQIYD 149

Query: 187 LNLFLKTFIAEAQLSKAHNVLDFILLR-RPLNDLLANTDVEILIQFLRLKCGALSKFWKI 245
           LN  +K FI   QL +   VLDFI+++   + +++A+ D+  L   L+LK G+L K WK 
Sbjct: 150 LNKLIKYFIKRDQLKQGQIVLDFIIMKYGGIENMIAHRDLISLNNHLKLKNGSLVKDWKF 209

Query: 246 QPASQRNSTAITLGEKASDCHLAKSYKFQNEKVLLQIINSVLGEHNWKNRRSPKLDAAII 305
           +  + R      L  +    +    YKF +   LL+I + VL +     +    L  +II
Sbjct: 210 EGKNLR-----YLQSRQGRLN----YKFLDGWSLLKIADLVLND---PMKCQNVLTNSII 257

Query: 306 YSLGYLGQTDLIEKYVNRTW-SPSKDEGVKTNPNSDLLVAVLTSYCVKEGNMRKGLEVLD 364
           YSLG+L Q +L++ ++++ W   ++       P+++ ++A++TSYC   GNM K  +VLD
Sbjct: 258 YSLGHLRQVELLDHFIDQMWMQETRPRNGLLYPDTNNIIAIITSYCYNYGNMDKSFDVLD 317

Query: 365 RFIRDYPEVELDPXXXXXXXXXXXXXXDKKRDRKATLSHGCWTIMKQWHAQRQRKIPYDY 424
           R +  Y  ++ D                +    K  +   CW++M     ++Q K+ +D 
Sbjct: 318 RILEKYSGLKFDKFFWRRLFQWCILT--EPNANKGFILGQCWSLM-----EKQEKVEFDG 370

Query: 425 GIMKELYPIFVRTKNKNGALEVITKSFFGAFIQPEFTIRPNELSLLCKYQRFILKMIALK 484
            +++ L    V+ ++   AL V+ K       +  F I   ++ LL KYQ+F+   +   
Sbjct: 371 VLLELLREKIVKVRDVPLALRVL-KMIVIELKKVNF-INELDMELLLKYQKFVFSKLGEI 428

Query: 485 GNYHKGFEF--CQEWSFSSTNKFELQSYFMKWRGIHEQRRTSQSKQKAALQEKYDEMEED 542
               K  E   C +++ +  NK  +++Y+ +     ++++  +S Q   LQ KYDEM+E+
Sbjct: 429 NKTVKAMELLSCDDYTINKENKAFMRAYYFE-NKREKRKKNKRSNQYDDLQRKYDEMDEE 487

Query: 543 DMLLGRLW 550
           DM++G+LW
Sbjct: 488 DMIIGKLW 495

>NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON}
           Anc_8.847 YMR282C
          Length = 624

 Score =  147 bits (371), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 137/483 (28%), Positives = 231/483 (47%), Gaps = 65/483 (13%)

Query: 124 TGGLTKSEYSLFINKLL-------SEEELDVKLSNVIPDTPHTELIYKLYEFYCDHIVDQ 176
           T  L+  E S+FI ++L       SE++ ++  +    +    E+I+ L+    D   + 
Sbjct: 151 TTLLSHEEMSIFICRVLKNFPTIISEKKYEILTNEGRYELYKPEVIFSLFNICKDEYCNN 210

Query: 177 HN-LTPLQLYDLNLFLKTFIAEAQLSKAHNVLDFILLR-RPLNDLLANTDVEILIQFLRL 234
            N L PL +YDLN F+K F+ E QL KA  VLD+I+ R   +  L+ + D+  L   L+L
Sbjct: 211 TNQLNPLMVYDLNQFIKYFLREGQLKKAQLVLDYIIDRFGGIEQLIKSKDLTTLDNHLKL 270

Query: 235 KCGALSKFWKIQPASQRNS---TAITLGEKASDCHLAKSYKFQNEKVLLQIINSVLGEHN 291
           K GA+ K WK    S+ N+     ++L +K+ +    K+YKF +   LL+II+ VL +  
Sbjct: 271 KNGAIYKNWKPLTDSESNTFLQYRLSLEDKSHNFKGFKNYKFLDGWSLLKIIDMVLTD-- 328

Query: 292 WKNRRSPKLDAAIIYSLGYLGQTDLIEKYVNRTWSPSKDEGVKTN----------PNSDL 341
            K      L+ +I+YSLG L Q + +E ++ + W    D+ V+            P+++ 
Sbjct: 329 -KTHCLNILNESILYSLGTLRQIEFMEHFIKQIWDVHPDDAVEERNHQLDKYNLPPDTNE 387

Query: 342 LVAVLTSYCVKEGNMRKGLEVLDRFIRDYPEVELDPXXXXXXXXXXXXXXDKKRDRKATL 401
           L+A+LTSYC    +M +   +LD+ I+ YPE                    K  D+    
Sbjct: 388 LIAILTSYCQTYKSMDRAFLLLDKLIQKYPEPMKSRLNDNKFWIKMLQWGIKIADKNGNN 447

Query: 402 SHG-----CWTIMKQWHAQRQR-------KIPYDYG--IMKELYPIFVRTKNKNGALEVI 447
            +G     C  IM++W  + ++       KI  DYG  ++  L+ I    KN +  L+ I
Sbjct: 448 VNGTTIDNCLEIMEEWFLKGKKKTALEHWKIDDDYGSILINLLHNIMKERKNVDIGLKAI 507

Query: 448 TKSFFGAFIQP-------EFTIRPNELSLLCKYQRFILKMIALKGNYHKGFEFCQEWSFS 500
                  F+Q        ++  R N   +L   Q+ I + IA  G+Y+KG       +++
Sbjct: 508 EN-----FVQKLKLGSVNKYYER-NLTHVLYGLQKCIFRKIAESGSYNKGLALIDNGAYT 561

Query: 501 STNKFE--LQSYFM----KWRGIHEQRRTSQSKQK-------AALQEKYDEMEEDDMLLG 547
             +  E  L+ Y++    + R    +R  +QS  +         LQ+KYDE+EE+ M++G
Sbjct: 562 QNSGVESMLREYYITTVKEIRSKRSRRNKAQSNIQDREQDEFEKLQQKYDEIEEEGMIIG 621

Query: 548 RLW 550
           +LW
Sbjct: 622 KLW 624

>KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {ON}
           Anc_8.847 YMR282C
          Length = 474

 Score =  144 bits (364), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 111/443 (25%), Positives = 206/443 (46%), Gaps = 53/443 (11%)

Query: 116 EYISGLFTTGGLTKSEYSLFINKLLSEEELDVKLSNVIPDTPHTELIYKLYEFYCDHIVD 175
           E I+ +  T  L +  ++  IN  LSE+    ++    P     E+I++L+E Y   I  
Sbjct: 77  EIITSMHATIDLNR--FARLINIALSEKYNIQRIKERRP-----EIIFQLFETYVKLISS 129

Query: 176 QHNLTPLQLYDLNLFLKTFIAEAQLSKAHNVLDFILLRRPLNDLLANTDVEILIQFLRLK 235
              LT LQ+ D+N F+  F+   QL KA  V+ +++L+ P   +L   DV     +L+L 
Sbjct: 130 HEELTILQVEDMNKFINYFVEFKQLKKAQLVMKYLILKSP--RVLEKYDVSTTRNYLKLN 187

Query: 236 CGALSKFWKIQPASQRNSTAITLGEKASDCHLAKSYKFQN---EKVLLQIINSVLGEHNW 292
           CGA  + W                         K + F N   +K++   +++ +G   W
Sbjct: 188 CGACHELWYTN---------------------YKIFDFNNTTLDKLVKYSLDNKIGY--W 224

Query: 293 KNRRSPKLDAAIIYSLGYLGQTDLIEKYVNRTWSPSKDEGVKTN-----PNSDLLVAVLT 347
                   D  II+SLGY G+   +E Y+ + W  S  +  + N     P S++L A++ 
Sbjct: 225 --------DVEIIHSLGYSGRIRSLEDYILKKWGISLCDRAQVNTTNEAPESEVLEAIIN 276

Query: 348 SYCVKEGNMRKGLEVLDRFIRDYPEVELDPXXXXXXXXXXXXXXDKKRDRKATLSHGCWT 407
            +  ++  M + +++L+ F+  YP++ L                D+K D+K  +    W 
Sbjct: 277 GFFYRDKRMFRAIKILNEFVNVYPDLNLKITFWKTFMNNCIKEWDEKVDQKGVVIVEYWE 336

Query: 408 IMKQWHAQRQRKIPYDYGIMKELYPIFVRTKNKNGALEVITKSFFGAFIQPEFTIRPNEL 467
            MK+W+    R+IP++   +K +   F +  N   A ++    F   +      +  +EL
Sbjct: 337 TMKRWYTVHNRRIPFNINFLKVMRTCFKKNNNLVLATDIFQNCFHNFYFCAT-RMNDSEL 395

Query: 468 SLLCKYQRFILKMIALKGNYHKGFEFCQEWSFSSTNKFELQSYFMKWRGIHEQRRTSQSK 527
           +++ +YQ FIL  +  K  +     F  +  FS  NK +L +Y+   R  H+ ++ ++++
Sbjct: 396 NVIKEYQNFILSRLIEKKGFSNALTFINDHCFSLENKRQLMNYYHG-RKEHKLKKMTRNE 454

Query: 528 QKAALQEKYDEMEEDDMLLGRLW 550
               L++ YD+M E+D ++G+LW
Sbjct: 455 N---LEKTYDDMVEEDFIIGKLW 474

>CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282c AEP2 required for the expression of
           subunit-9 of atp synthase
          Length = 548

 Score =  144 bits (363), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 137/520 (26%), Positives = 229/520 (44%), Gaps = 44/520 (8%)

Query: 52  SELPLRTLNDELHNAERKYIKPLTNAPEWSSTRTGPNSKIREYLKNGQYTKLLIRLSVDN 111
           S + LR+LN+++H+        LT+  + +  +      +    +N    KLL    +D 
Sbjct: 52  SHVELRSLNEQIHSQ-------LTSLTDLNKRQL---LLVETLSRNNNLEKLLDYYEIDE 101

Query: 112 HLNNEYISGLFTTGGLTKSEYSLFINKLLSEEELDVKLSNVIPDTPHTELIYKLYEFYCD 171
               + I  L     ++  E+S  I  +L+   L  K         H   + KL + Y  
Sbjct: 102 GSVEDAIQ-LLQDSNVSIQEFSSMIQPVLNRTNLVGKY--------HMGYLSKLMQIYIS 152

Query: 172 HIVDQHN---LTPLQLYDLNLFLKTFIAEAQLSKAHNVLDFIL--LRRPLNDLLA-NTDV 225
            +   HN   +  L   D+N F+K FI  +QL +A   L F+L   +    DLL    D 
Sbjct: 153 -LTRTHNGGSVDALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGEDLLGPYGDK 211

Query: 226 EILIQFLRLKCGALSKFWKIQPASQRNSTAITLGEKASDCHLAKSYKFQNEKVLLQIINS 285
           + +  FL L+ GAL   WKI  ++  N          S  ++  +Y   +   L +I+  
Sbjct: 212 QTIAHFLMLRSGALQDLWKIDVSNGNNKKQAFYKINGSHRNVKSTYNVLDSVKLFEIVRY 271

Query: 286 VLGEHNWKNRRSPK-LDAAI----IYSLGYLGQTDLIEKYVNRTW---SPSKDEGVKTNP 337
           +L  ++  N   P   D  I    I  LGY+GQT LIE  +N+ W   S S         
Sbjct: 272 ILRYNDKDNHSQPVYFDEGILKNVILCLGYVGQTTLIEDIINKIWELDSVSVPPKYNITV 331

Query: 338 NSDLLVAVLTSYCVKEGNMRKGLEVLDRFIRDYPEVELDPXXXXXXXXXXXXXXDKKRDR 397
            SDLL A++++Y     +++ GL + D+F    P + +                +K R  
Sbjct: 332 TSDLLTAIVSAYSKCGKSIQPGLVIADKFFGKIPNIIVKDDFWINLQKWNIILPNKWRS- 390

Query: 398 KATLSHGCWTIMKQWHAQRQR------KIPYDYGIMKELYPIFVRTKNKNGALEVITKSF 451
              LS   W +MK W             + +   + K L   +++ K+     ++   S 
Sbjct: 391 TIDLSKRTWELMKSWRNSTNNGGFITANVEFLNLVYKVLSSDYIKLKDLEWIYDIFQHSL 450

Query: 452 FGAFIQPEFTIRPNELSLLCKYQRFILKMIALKGNYHKGFEFCQEWSFSSTNKFELQSYF 511
              + +   T+  +E+ LL K+Q F +K +   G+Y K  +F +EWS+ + NK +L + F
Sbjct: 451 VTLYSKNSLTV--DEIKLLKKFQIFTIKKMVYFGHYSKCLQFIKEWSYDAANKQQLTNLF 508

Query: 512 MKWRGIHEQRRT-SQSKQKAALQEKYDEMEEDDMLLGRLW 550
           +  R  + Q+R  +Q K+   +Q+KYDE E++DMLLG LW
Sbjct: 509 VVLRNRYLQKRGYNQEKEMTKVQKKYDEEEQEDMLLGGLW 548

>KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 518

 Score =  138 bits (347), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 128/509 (25%), Positives = 225/509 (44%), Gaps = 40/509 (7%)

Query: 48  STLKSELPLRTLNDELHNAERKYIKPLTNAPEWSSTRTGPNSKIREYLKNGQYTKLLIRL 107
           ST+ +  P+ TL D L +        L++  + S+  T PN      L + Q  K L  L
Sbjct: 25  STVVTSAPI-TLEDSLQSI-------LSDIQDGSNIVT-PNKPNTNLLTSKQPIKALKHL 75

Query: 108 SVDNHLNNEYISGL--FTTGGLTKSEYSLFINKLLSEEELDVKLSNVIPDTPHTELIYKL 165
               +L  +  + L  ++   LT  +YS+F+N+L+     D++L N    T   + +Y +
Sbjct: 76  QWKTNLRVKKTTRLLKYSNEKLTPEDYSVFVNQLMDVYSKDIELLN---KTEVWKSLYHI 132

Query: 166 YEFYCDHIVDQHNLTPLQLYDLNLFLKTFIAEAQLSKAHNVLDFILLRRPLNDLLANTDV 225
           Y  +  + VD  N   + LYDLN F++ FI    L  A NV   IL      ++    DV
Sbjct: 133 YRVFVVNAVDDGN--AMVLYDLNQFVRMFINLNDLPLARNVFQLILKNSKNGEI--PKDV 188

Query: 226 EILIQFLRLKCGALSKFWKIQPASQ--RNSTAITLGEKASDCHLAKSYKFQNEKV--LLQ 281
           + +  +LRL CGALS+ W  Q +    ++      G  AS   +     +    V     
Sbjct: 189 QTICMYLRLYCGALSELWTTQTSRNFYQDLIGSLSGSNASSIRIPSHIAYPTIGVPQFQL 248

Query: 282 IINSVLGEHNWKNRRSPKLDAAIIYSLGYLGQTDLIEKYV--------NRTWSPSKDEGV 333
           ++  ++ +  +   R+ ++D+ II +LG+  +   +++Y+        N T + +     
Sbjct: 249 LLRKLVEDPEYSKLRNTEMDSLIIQALGHYKEVPFLKQYISIFYGIDENVTITETHPGIK 308

Query: 334 KTNPNSDLLVAVLTSYCVKEGNMRKGLEVLDRFIRDYPEVELDPXXXXXXXXXXXXXXDK 393
           K  P+S LL +V+++Y     N+  G+ V+  F+  YPE+ LD               +K
Sbjct: 309 KLTPDSQLLKSVISAYG-HNNNITSGMTVIGSFMEKYPEMNLDKSFWRTTIYWSLREWNK 367

Query: 394 KRDRKATLSHGCWTIMKQWHAQRQRKIPYDYGIMKELYPIFVRTKNKNGALEVITKSFFG 453
            +D K +     W +M  W+A   + +P+D  IM          K+ N A+  + + F  
Sbjct: 368 YKDSKGSQPKKAWNLMLNWYATIGKAVPFDQKIMLYRLSFLKSRKDHNAAIRDVQQVFKR 427

Query: 454 AFIQPEFTIRPNELSLLCKYQRFILKMIALKGNYHKGFEFCQEWSFSSTNKFELQSYFMK 513
            FI+ E      E  +L  YQRFI+K +  +    K  +F  EW     N   L+ YF  
Sbjct: 428 IFIKTEKNTFIVERLVLYAYQRFIIKNLVNQNENAKCVDFINEWRIDFENGRYLERYF-- 485

Query: 514 WRGIHEQRRTSQSKQKAALQEKYDEMEED 542
                  +  +  K ++  Q+K ++ ++D
Sbjct: 486 -------KELTHPKNESDEQKKLNDEDDD 507

>TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {ON}
           Anc_8.847 YMR282C
          Length = 613

 Score =  135 bits (340), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 111/420 (26%), Positives = 190/420 (45%), Gaps = 45/420 (10%)

Query: 133 SLFINKLLSEEELDVKLSNVIPDTPHTELIYKLYEFYCDHI---------------VDQH 177
           S+ IN L+       K S+ +    H+ELI+K+Y+ Y + I               + +H
Sbjct: 157 SIVINLLVKYNHFQPKDSDRLSFKSHSELIFKVYQIYIERIEHPILNSNNNSHIQSIAEH 216

Query: 178 NLTPL---QLYDLNLFLKTFIAEAQLSKAHNVLDFILLRRPLNDLLANTDVEILIQFLRL 234
           + TPL   QLYDLN  +  FI   QL KA   L +I L+R   ++    D + +I FL+L
Sbjct: 217 SSTPLNPIQLYDLNKVITWFIKAGQLKKATTALMYI-LKRYNAEIFQIPDSKTIINFLKL 275

Query: 235 KCGALSKFWKIQPASQR-----NSTAITLGEKASDCHLAKSYKFQNEKVLLQIINSVLGE 289
            CG L   W+I+P + R        +  LG  +S   L  SYK   EKV +QI+  +   
Sbjct: 276 YCGGLPTNWRIEPINHRFIKNQGKRSFKLGNNSSYYRLPSSYKAVYEKVPIQIVEHIKKN 335

Query: 290 HN--------WKNRRSPKLDAAIIYSLGYLGQTDLIEKYVNRTWSPSKDEGVKTNPNSDL 341
            N        +   R+ + D+ +IYSL  LG+ DL E+Y    W     + V+    SD+
Sbjct: 336 TNDMKLSGKLFHFIRTGEFDSTLIYSLTSLGRFDLAEQYFKDNWLSDSCDDVEL--TSDI 393

Query: 342 LVAVLTSYCV-KEGNMRKGLEVLDRFIRDYPEVELDPXXXXXXXXXXXXXXDKKRDRKAT 400
           ++A+ +SY      N+ K  +++   I+ YP++ L+               D   D    
Sbjct: 394 VIAIFSSYVYNNSNNIEKANKLIQEIIKRYPDLHLNISTWCRIIRWNIQMWDTTTDFNGE 453

Query: 401 LSHGCWTIMKQWHAQ--------RQRKIPYDYGIMKELYPIFVRTKNKNGALEVITKSFF 452
           + +  +  M  +++         +   IPY+  ++ +LY +F    + N  L ++   F 
Sbjct: 454 IPYDSFYTMLTYYSNYCSRNSTFKSCHIPYNKMLLGDLYHLFNTKISLNKCLFIMDNCFK 513

Query: 453 GAFIQPEFTIRPNELSLLCKYQRFILKMIA--LKGNYHKGFEFCQEWSFSSTNKFELQSY 510
            +  +    +   +  +L KYQ+ ILK +    K   +K  +F +++S  + NK +L  Y
Sbjct: 514 KSLFKTPSKVTTKDYQILLKYQKMILKYLINDRKLTSNKPLDFIEKYSLDTNNKEQLLEY 573

>KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.847
           YMR282C
          Length = 474

 Score =  121 bits (303), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 108/449 (24%), Positives = 206/449 (45%), Gaps = 70/449 (15%)

Query: 120 GLFTTGGLTKSEYSLFINKLLSEE---ELDVKLSNVIPDTPHTELIYKLYEFYCDHIVDQ 176
            +F     T  ++S+ +N++L+ +    LD K         + E  + ++  Y   I  Q
Sbjct: 78  NVFNILSPTAMQFSVLLNRVLASQNYRHLDSK--------ENVEKFFAIFMRYKGAIALQ 129

Query: 177 HN-LTPLQLYDLNLFLKTFIAEAQLSKAHNVLDFILLRRPLNDLLANTDVEILIQFLRLK 235
            N LT +QL+D NL    FIA  QL KA  ++DF+L +          DV ++  + +L+
Sbjct: 130 SNKLTQIQLHDFNLMCDYFIACNQLKKAQLIMDFLLQQD------VKFDVFMIKNYTKLR 183

Query: 236 CGALSKFWKIQPASQRNSTAITLGEKASDCHLAKSYKFQNEKVLLQIINSVLGEHNWKNR 295
           CG+                  + G++  +    K+YK  ++  + Q+I  V  +     R
Sbjct: 184 CGS------------------SFGKQTLN---NKAYKVFDQNTVFQLIGKVEAD-----R 217

Query: 296 RSPKLDAAIIYSLGYLGQTDLIEKYVNRTWSPS----KDEGVKTN---------PNSDLL 342
           +    +  I+ SLGY     L+E Y+   W  S      E +K +         P+S +L
Sbjct: 218 KFAFWNNEIVSSLGYTNNITLMEIYIWDLWRISIHDHSTENIKIDHLQQGDAMYPSSKVL 277

Query: 343 VAVLTSYCVKEGNMRKGLEVLDRFIRDYPEVELDPXXXXXXXXXXXXXXDKKRDRKATLS 402
             +++SY   +  M++ +++++RF + YP++ L+                 K D    L+
Sbjct: 278 ATIVSSYARHDQTMKRAVDIVERFAKSYPKLLLNVHFWSTLLNCAIKCGGSK-DPSQFLA 336

Query: 403 HGCWTIMKQWHAQRQRKIPYDYGIMKELYPIFVRTKNKNGALEVITKSFFGAFIQPEFTI 462
             CW +MK+WH QR + +P+   ++  +     +T N +G ++++ + + G        I
Sbjct: 337 --CWNLMKKWHTQRSKLMPFQSALLVTILRYMRQTSNLHGTVDIL-QYWLGPLYLKRGNI 393

Query: 463 RPNELSLLCKYQRFILKMIALKGNYHKGFEFCQEWSFSSTNKFELQSYFMKWRGIHEQRR 522
              E  +L KYQ+ IL+ +  K  Y+    F  +WS  ++NK +L++++        + R
Sbjct: 394 PEFERDVLIKYQKQILRKLVDKRKYNWCTAFIDQWSIDASNKEDLEAFY--------ESR 445

Query: 523 TSQSKQKAALQEKY-DEMEEDDMLLGRLW 550
               + K   ++ Y D  +++DM++GRLW
Sbjct: 446 VDVRESKTRREKAYDDMDDDEDMIIGRLW 474

>ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR282C
           (AEP2)
          Length = 537

 Score = 87.4 bits (215), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 97/388 (25%), Positives = 163/388 (42%), Gaps = 26/388 (6%)

Query: 132 YSLFINKLLSEEELDVKLSNVIPDTPHTELIYKLYEFYCDHIVDQ--HNLTPLQLYDLNL 189
           +S+FI++LL        L +++       L+ KLY FY +   D      +P +L+D N 
Sbjct: 133 FSVFIHRLLPTYTPSSDLKHLVSKDGTIALLQKLYGFYREQFADAPIGRPSPGRLHDANS 192

Query: 190 FLKTFIAEAQLSKAHNVLDFILLRRPLNDLLANTDVEILIQFLRLKCGALSKFWKIQPAS 249
           F + F+AE++L  A  V    L+  P        D E +I  L+L  GA   FW+  P  
Sbjct: 193 FARWFMAESKLRLARTVFAE-LVGNPTELAKLPRDTETIITLLQLHLGAKHIFWR-DPG- 249

Query: 250 QRNSTAITLGEKASDCHLA--KSYKFQNEKVLLQIINSVLGEHNWKNRRSPKLDAAIIYS 307
             NS     G+  +  H+A   +Y    E+ LL+++  +  +  WK+  SP LD  II +
Sbjct: 250 --NSVGRG-GQLFTPAHMAVVTAYNSLGEETLLRLLRLLQSDPQWKSVCSPDLDRNIILA 306

Query: 308 LGYLGQTDLIE-KYVNRTWSPSKDEGVKTN---PNSDLLVAVLTSYCVKEGNMRKGLEV- 362
           L +  + DL+  +        +   G+ +    P+  L+ AV+T++  K   + +GL + 
Sbjct: 307 LAFHNRLDLVHAQAARYYAPAAPGHGLPSTPLLPDGALVGAVVTAFAFKH-QLAQGLAIA 365

Query: 363 ---LDRFIRDYPEVELDPXXXXXXXXXXXXXXDKKRDRKATLSHGCWTIMKQWHAQRQRK 419
              LDRF     E EL                     + A L    W+ M+  +A+  + 
Sbjct: 366 YQFLDRFTHLPNEHEL-----WKIIFTWLARRHPTGSQGAALYDEAWSKMRTRYAEHGQP 420

Query: 420 IPYDYGIMKELYPIFVRTKNKNGALEVITKSFFGAFIQPEFTIRPNELSLLCKYQRFILK 479
            PYDY I +  Y I  R  +      ++       + QP   + P +  LL K Q  I+ 
Sbjct: 421 TPYDYSIARASYRIVRRDSSLRRVRALLNDYMSPLYQQP--AVAPRDRLLLLKCQAHIVG 478

Query: 480 MIALKGNYHKGFEFCQEWSFSSTNKFEL 507
            +          +F  +W+  S  +  L
Sbjct: 479 RLVRARRNSAAADFVDQWALDSEARSHL 506

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,783,691
Number of extensions: 2515845
Number of successful extensions: 7233
Number of sequences better than 10.0: 35
Number of HSP's gapped: 7321
Number of HSP's successfully gapped: 35
Length of query: 550
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 435
Effective length of database: 40,294,809
Effective search space: 17528241915
Effective search space used: 17528241915
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)