Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0G14300g8.846ON28028014860.0
TDEL0B005208.846ON2682756791e-88
YMR281W (GPI12)8.846ON3042866003e-76
Suva_13.4708.846ON3032875925e-75
KAFR0B039608.846ON2782775871e-74
Skud_13.4538.846ON3002845831e-73
Smik_13.4948.846ON3042935822e-73
KNAG0J002408.846ON2862835515e-69
TPHA0I002808.846ON3013055465e-68
Kpol_1068.48.846ON2912845377e-67
NDAI0K003308.846ON3133005372e-66
NCAS0C003808.846ON2762544923e-60
TBLA0B033008.846ON3193184946e-60
Ecym_46178.846ON2492674712e-57
Kwal_27.102278.846ON2542724703e-57
SAKL0D01320g8.846ON2602764704e-57
CAGL0M03047g8.846ON3042814622e-55
KLTH0C03740g8.846ON2542684416e-53
ABL120W8.846ON2492664284e-51
KLLA0D01430g8.846ON2632724156e-49
NDAI0J017204.139ON25957692.5
CAGL0L00297g1.76ON138547659.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0G14300g
         (280 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} simil...   577   0.0  
TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON} ...   266   1e-88
YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER me...   235   3e-76
Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W...   232   5e-75
KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.84...   230   1e-74
Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W...   229   1e-73
Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W...   228   2e-73
KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}...   216   5e-69
TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846 ...   214   5e-68
Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON} c...   211   7e-67
NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846...   211   2e-66
NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON} ...   194   3e-60
TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.84...   194   6e-60
Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar ...   186   2e-57
Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {O...   185   3e-57
SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON...   185   4e-57
CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly...   182   2e-55
KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {O...   174   6e-53
ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic hom...   169   4e-51
KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {O...   164   6e-49
NDAI0J01720 Chr10 (420228..421007) [780 bp, 259 aa] {ON} Anc_4.1...    31   2.5  
CAGL0L00297g Chr12 (32461..36618) [4158 bp, 1385 aa] {ON} simila...    30   9.7  

>ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} similar
           to uniprot|P23797 Saccharomyces cerevisiae YMR281W GPI12
           ER membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 280

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/280 (100%), Positives = 280/280 (100%)

Query: 1   MVVAIKFPKVYFLLWVLFIAFSVRIKSRNGSVFNDNLKFLDEIDSLSLVVAHPDDEVMFF 60
           MVVAIKFPKVYFLLWVLFIAFSVRIKSRNGSVFNDNLKFLDEIDSLSLVVAHPDDEVMFF
Sbjct: 1   MVVAIKFPKVYFLLWVLFIAFSVRIKSRNGSVFNDNLKFLDEIDSLSLVVAHPDDEVMFF 60

Query: 61  APTILELDSRLPPNVEFNVVCLSKGGADELGDTRVQELKESVNLLLANSKRQYQLQQHDY 120
           APTILELDSRLPPNVEFNVVCLSKGGADELGDTRVQELKESVNLLLANSKRQYQLQQHDY
Sbjct: 61  APTILELDSRLPPNVEFNVVCLSKGGADELGDTRVQELKESVNLLLANSKRQYQLQQHDY 120

Query: 121 PDGHEETWDQESVQSTIKDSVLQGRRSSVLLTFDDKGVSKHVNHIACHEAVSNLVQDESN 180
           PDGHEETWDQESVQSTIKDSVLQGRRSSVLLTFDDKGVSKHVNHIACHEAVSNLVQDESN
Sbjct: 121 PDGHEETWDQESVQSTIKDSVLQGRRSSVLLTFDDKGVSKHVNHIACHEAVSNLVQDESN 180

Query: 181 VKAALYLDSYGDNIVLKYSAFFWEIWKLTRDWFLHRVLPTSSYNENKPATEITLMSDYSS 240
           VKAALYLDSYGDNIVLKYSAFFWEIWKLTRDWFLHRVLPTSSYNENKPATEITLMSDYSS
Sbjct: 181 VKAALYLDSYGDNIVLKYSAFFWEIWKLTRDWFLHRVLPTSSYNENKPATEITLMSDYSS 240

Query: 241 YILSFASMLHSHKSQMVWFRYGWWTFSRFVFVNDLKVVNK 280
           YILSFASMLHSHKSQMVWFRYGWWTFSRFVFVNDLKVVNK
Sbjct: 241 YILSFASMLHSHKSQMVWFRYGWWTFSRFVFVNDLKVVNK 280

>TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON}
           Anc_8.846 YMR281W
          Length = 268

 Score =  266 bits (679), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 131/275 (47%), Positives = 184/275 (66%), Gaps = 14/275 (5%)

Query: 4   AIKFPKVYFLLWVLFIAFSVRIKSRNGSVFNDNLKFLDEIDSLSLVVAHPDDEVMFFAPT 63
           A+K  K+ F L +L++A + RI  RN   +  +   +   +SL+L++AHPDDEVMFF+P+
Sbjct: 7   AVKVFKLLFFLSILYVALTARINGRNEVQWQQHAAAIGTPESLTLLIAHPDDEVMFFSPS 66

Query: 64  ILELDSRLPPNVEFNVVCLSKGGADELGDTRVQELKESVNLLLANSKRQYQLQQHDYPDG 123
           +L+LD  LP +V FN VCLSKG AD LG+TR  EL+ S+NLL +NS+R+ QL Q DYPDG
Sbjct: 67  LLQLDRLLPQSVRFNFVCLSKGDADHLGETRELELQRSLNLLTSNSQRKTQLYQFDYPDG 126

Query: 124 HEETWDQESVQSTIKDSVLQGRRSSVLLTFDDKGVSKHVNHIACHEAVSNLVQDESNVKA 183
            +E W+ ESV S ++  V  G   ++LLTFD  GVS H NH+ACH AV+ L++       
Sbjct: 127 FDEKWEIESVVSIVESKVFIGSGFNLLLTFDAHGVSNHPNHVACHNAVARLIEKG---HK 183

Query: 184 ALYLDSYGDNIVLKYSAFFWEIWKLTRDWFLHRVLPTSSYNENKPATEITLMSDYSSYIL 243
           ALYL+S+  N+ LKYS F WE+ ++  D  +               T +T M+ +  YIL
Sbjct: 184 ALYLNSHSRNLPLKYSGFIWELIRMLSDSVM-----------KLERTGLTFMNSFPQYIL 232

Query: 244 SFASMLHSHKSQMVWFRYGWWTFSRFVFVNDLKVV 278
           +FA+M ++H+SQ+VWFRYGWW+ SRFVFVNDL++V
Sbjct: 233 AFAAMANAHESQLVWFRYGWWSLSRFVFVNDLEIV 267

>YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER
           membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly, the
           de-N-acetylation of the
           N-acetylglucosaminylphosphatidylinositol intermediate;
           functional homolog of human PIG-Lp
          Length = 304

 Score =  235 bits (600), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 124/286 (43%), Positives = 179/286 (62%), Gaps = 15/286 (5%)

Query: 6   KFPKVYFLLWVLFIAFSVRIKSRNGSVFNDNLKFLDEIDSLSLVVAHPDDEVMFFAPTIL 65
           K  K+  +L +L+I F+ +I SRN +              ++LV+AHPDDEVMFF+P I 
Sbjct: 17  KITKLAIVLTILYIYFTPKIVSRNNASLQHIFPHKYGDYEINLVIAHPDDEVMFFSPIIS 76

Query: 66  ELDSRLPPNVEFNVVCLSKGGADELGDTRVQELKESVNLLLANSKRQYQLQQHDYPDGHE 125
           +L+S  P  V FN++CLSKG A+ LG+TRV+EL ES  LLL N +R   +Q  D+ DG +
Sbjct: 77  QLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAALLLHN-ERAVSVQVMDFQDGMD 135

Query: 126 ETWDQESVQSTI--KDSVLQGRRSSVLLTFDDKGVSKHVNHIACHEAVSNLVQDESNVK- 182
           E WD +S+ S++  K  +     + +++TFD  GVS H+NH +C+ AV  LV D +  K 
Sbjct: 136 EIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHINHKSCYAAVKKLVDDYAQPKT 195

Query: 183 ---------AALYLDSYGDNIVLKYSAFFWEIWKLTRDWF--LHRVLPTSSYNENKPATE 231
                     ALYL SY +NIVLKY++F WEI K+  D      R++     N      +
Sbjct: 196 KRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRRIIQALPPNTAAEKDK 255

Query: 232 ITLMSDYSSYILSFASMLHSHKSQMVWFRYGWWTFSRFVFVNDLKV 277
           ++LM+ ++ Y+L+FA+ML++H+SQ+VWFRYGWW FSRFVFVN+  V
Sbjct: 256 LSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEFDV 301

>Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W
           (REAL)
          Length = 303

 Score =  232 bits (592), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 124/287 (43%), Positives = 174/287 (60%), Gaps = 16/287 (5%)

Query: 6   KFPKVYFLLWVLFIAFSVRIKSRNGSVFNDNLKFLDEIDSLSLVVAHPDDEVMFFAPTIL 65
           K  K+  +L VL+I F+ +I SRN           D    ++LV+AHPDDEVMFF+P I 
Sbjct: 15  KITKLAIVLTVLYIYFTPKILSRNTDSLQHVFPHRDRNSQINLVIAHPDDEVMFFSPVIS 74

Query: 66  ELDSRLPPNVEFNVVCLSKGGADELGDTRVQELKESVNLLLANSKRQYQLQQHDYPDGHE 125
           +L +  P  V FN++CLSKG A+ LG+TR +EL +S  LLL N +R   +Q  D+ DG +
Sbjct: 75  QLHAYFPDTVPFNILCLSKGDAEGLGETRAKELNDSAVLLLRN-ERPVSVQVMDFEDGMD 133

Query: 126 ETWDQESVQSTIKDS--VLQGRRSSVLLTFDDKGVSKHVNHIACHEAVSNLVQDESNVK- 182
           E WD +S+ ST+  +  V   + S +++TFD  GVS H+NH +CH AV   + D    K 
Sbjct: 134 EVWDIDSITSTLSQTIDVNNEKVSQIIVTFDSYGVSNHINHKSCHIAVEKFIDDYVGSKT 193

Query: 183 ---------AALYLDSYGDNIVLKYSAFFWEIWKL---TRDWFLHRVLPTSSYNENKPAT 230
                     ALYL SY +NI LKY++F WEI K+   T   F   + P ++ +      
Sbjct: 194 KEKAENAHITALYLRSYKNNIFLKYNSFIWEILKMLYRTVSPFGRSIQPLAAPSTTTEKN 253

Query: 231 EITLMSDYSSYILSFASMLHSHKSQMVWFRYGWWTFSRFVFVNDLKV 277
            + LM+ +S YIL+FA+ML++HKSQ+VWFRYGWW  SRFVFVN+  +
Sbjct: 254 GLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDI 300

>KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.846
           YMR281W
          Length = 278

 Score =  230 bits (587), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 117/277 (42%), Positives = 176/277 (63%), Gaps = 16/277 (5%)

Query: 6   KFPKVYFLLWVLFIAFSVRIKSRNGSVFNDNLKFL----DEIDSLSLVVAHPDDEVMFFA 61
           K  K+  + W L+I  S +I+  N  + N  +  L        SL+LVVAHPDDEVMFF+
Sbjct: 10  KITKLTLIFWCLYIVLSPKIQLSNDQILNTFIPSLIKDRSNDPSLTLVVAHPDDEVMFFS 69

Query: 62  PTILELDSRLPPNVEFNVVCLSKGGADELGDTRVQELKESVNLLLANSKRQYQLQQHDYP 121
           PT+L+LDS LPPN +FN++  S G A+ LG  R  EL  S+++L+   +R  ++   ++ 
Sbjct: 70  PTLLQLDSHLPPNCKFNIISYSDGDAEGLGSLRSNELAHSIDMLIP--RRNKEIFIFNHT 127

Query: 122 DGHEETWDQESVQSTIKDSVLQGRRSSVLLTFDDKGVSKHVNHIACHEAVSNLVQDESNV 181
           DG  E WD + +   + +S+L   ++++LLTFD  GVS H+NH ACH+ V++ +Q  +  
Sbjct: 128 DGMNEVWDNKLMLHQL-ESILSDSQTNILLTFDQFGVSNHINHKACHQVVTSYIQSHAKN 186

Query: 182 KAALYLDSYGDNIVLKYSAFFWEIWKLTRDWFLH-RVLPTSSYNENKPATEITLMSDYSS 240
             AL LDSY  N++ KY+ F W++  L +++++H + LP   +        + L + YS 
Sbjct: 187 NFALLLDSYSSNLLKKYTGFAWQLVFLAKNYWIHGKTLPNLDH--------LALFNPYSD 238

Query: 241 YILSFASMLHSHKSQMVWFRYGWWTFSRFVFVNDLKV 277
           YI ++A+ML +HKSQMVWFRYGWW FSRFV+VNDLK+
Sbjct: 239 YITAYATMLKAHKSQMVWFRYGWWFFSRFVYVNDLKL 275

>Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W
           (REAL)
          Length = 300

 Score =  229 bits (583), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 120/284 (42%), Positives = 173/284 (60%), Gaps = 13/284 (4%)

Query: 6   KFPKVYFLLWVLFIAFSVRIKSRNGSVFNDNLKFLDEIDSLSLVVAHPDDEVMFFAPTIL 65
           K  K+  +L +L+I F+ +I SRN  +        +    ++LV+AHPDDEVMFF+P I 
Sbjct: 15  KITKLAIVLTILYIFFTPKIISRNDELLQHVFPHKNRDSQINLVIAHPDDEVMFFSPVIS 74

Query: 66  ELDSRLPPNVEFNVVCLSKGGADELGDTRVQELKESVNLLLANSKRQYQLQQHDYPDGHE 125
           +L S  P  V FN++CLSKG AD LG++RV+EL  S  LLL N +R   +Q  D+ DG +
Sbjct: 75  QLHSYFPITVPFNIICLSKGNADGLGESRVKELNGSAALLLQN-ERPVSVQVMDFEDGMD 133

Query: 126 ETWDQESVQSTIKDSV--LQGRRSSVLLTFDDKGVSKHVNHIACHEAVSNLVQDESNVKA 183
           E WD  S+ STI  ++     + + +++TFD  GVS H+NH +CH AV  L+   +  KA
Sbjct: 134 EVWDINSIVSTISQTIDLSNEQLNQIIVTFDSYGVSDHINHKSCHTAVKRLIDRYAESKA 193

Query: 184 ----------ALYLDSYGDNIVLKYSAFFWEIWKLTRDWFLHRVLPTSSYNENKPATEIT 233
                     ALYL SY +NIVLKY++F WEI K+     +               +++ 
Sbjct: 194 ETNEETPHITALYLKSYKNNIVLKYNSFIWEILKILYSVIVPFPKTIQPPTTTTQRSKLL 253

Query: 234 LMSDYSSYILSFASMLHSHKSQMVWFRYGWWTFSRFVFVNDLKV 277
           LM+ ++ Y+L++A+ML++HKSQ+VWFRYGWW  SRFVFVN+  V
Sbjct: 254 LMNTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDV 297

>Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W
           (REAL)
          Length = 304

 Score =  228 bits (582), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 128/293 (43%), Positives = 180/293 (61%), Gaps = 29/293 (9%)

Query: 6   KFPKVYFLLWVLFIAFSVRIKSRNGS----VFNDNLKFLDEIDSLSLVVAHPDDEVMFFA 61
           K  K+  +L +L+I F+ +I SRN      VF +  K+ D    ++L++AHPDDEVMFF+
Sbjct: 17  KITKLSIVLTILYIYFTPKIISRNNESLQHVFPN--KYSDY--QINLIIAHPDDEVMFFS 72

Query: 62  PTILELDSRLPPNVEFNVVCLSKGGADELGDTRVQELKESVNLLLANSKRQYQLQQHDYP 121
           P I +L S  P  V FN++CLSKG A+ LG TRV+EL +S  LLL N +R   +Q  D+ 
Sbjct: 73  PMISQLHSYFPNTVPFNIICLSKGNAEGLGQTRVRELNDSAALLLHN-ERAVSVQVMDFQ 131

Query: 122 DGHEETWDQESVQSTIKDSVL--QGRRSSVLLTFDDKGVSKHVNHIACHEAVSNLVQD-- 177
           DG  E WD +S+ ST+  ++       + +++TFD  GVS H+NH +CH AV  L+ D  
Sbjct: 132 DGMNEVWDIDSITSTLSQTIGINNNELNQIIVTFDSYGVSGHINHKSCHTAVRKLIADYT 191

Query: 178 ESNVK--------AALYLDSYGDNIVLKYSAFFWEIWKLTRDWF-----LHRVLPTSSYN 224
            SNV+         ALYL SY +NIVLKY++F WEI ++            + LP+    
Sbjct: 192 RSNVRKEVKTPLITALYLRSYKNNIVLKYNSFIWEILRMLYGLISPFRKTTQALPSDVVA 251

Query: 225 ENKPATEITLMSDYSSYILSFASMLHSHKSQMVWFRYGWWTFSRFVFVNDLKV 277
           E      + LM+ ++ YIL+FA+ML++HKSQ+VWFRYGWW  SRFVFVN+  V
Sbjct: 252 EKN---SLLLMNTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDV 301

>KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}
           Anc_8.846 YMR281W
          Length = 286

 Score =  216 bits (551), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 127/283 (44%), Positives = 178/283 (62%), Gaps = 18/283 (6%)

Query: 6   KFPKVYFLLWVLFIAFSVRIKSRNGSVFNDNLKFLDE--IDSLSLVVAHPDDEVMFFAPT 63
           K  K+  LL +L+I  S    S+ GS    NL+ L E  I+S++LV+AHPDDEVMFFAP+
Sbjct: 12  KVTKLSLLLGILYIYAST---SKIGSFNYTNLETLGEHDINSVNLVIAHPDDEVMFFAPS 68

Query: 64  ILELDSRLP-PNVEFNVVCLSKGGADELGDTRVQELKESVNLLLANSKRQYQLQQHDYPD 122
           ++ L+ ++  P+  FN++C S GGAD LG+ R QEL +S+ +LL    R   +   D+ D
Sbjct: 69  LINLNEQIRDPSTVFNIICFSNGGADGLGNVREQELSDSIAMLLPT--RNTSIVVLDFKD 126

Query: 123 GHEETWDQESVQSTIKDSVLQGRRSSVLLTFDDKGVSKHVNHIACHEAVSNLVQD-ESNV 181
           G +E WD + + + +++ ++     +VLLTFD KGVS H+NHIAC+ A      + +S  
Sbjct: 127 GMKEKWDVKEMIAKLRN-IVPKLGHNVLLTFDGKGVSGHLNHIACYRAALGYYNEFKSKQ 185

Query: 182 K-AALYLDSYGDNIVLKYSAFFWEIWKLT-RDWF---LHRVLPTSSYNENKPATEITLMS 236
           K   L L SY  NIV KYS++ WE+ KL    W    L  VLP    N    A +IT+ S
Sbjct: 186 KLTVLSLQSYSKNIVKKYSSYIWELIKLLYSSWVPSRLGNVLPKRGSN---VARKITIFS 242

Query: 237 DYSSYILSFASMLHSHKSQMVWFRYGWWTFSRFVFVNDLKVVN 279
            Y  Y+LS A+ML++HK+Q+VWFRYGWW FSR VFVNDL V++
Sbjct: 243 TYPQYVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDLDVIS 285

>TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846
           YMR281W
          Length = 301

 Score =  214 bits (546), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 125/305 (40%), Positives = 186/305 (60%), Gaps = 31/305 (10%)

Query: 1   MVVAIKFPKVYFLLWVLFIAFSVRIKSRNGSVFNDNLKF---LDEIDSLSLVVAHPDDEV 57
           M +  K  K Y +L +L+I  +  I+  N   F  N++       + S++L++AHPDDEV
Sbjct: 1   MGILFKLFKCYCILSILYIWLTPHIEDLNLKSFYSNVQLNISQQSLKSVNLIIAHPDDEV 60

Query: 58  MFFAPTILELDSRLPPNVEFNVVCLSKG---GADELGDTRVQELKESVNLLLANSK---- 110
           MFF PT+L+LD  LP +V FNV+CLSKG       +GD R  E+ +S+ +LL + +    
Sbjct: 61  MFFTPTLLQLDDILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGLN 120

Query: 111 RQYQLQQHDYPDGHEETWDQESVQSTIKDSVLQGRRSSV------LLTFDDKGVSKHVNH 164
           R+ +L Q +Y DG ++ WD   V + I++++     S+V      LLTFD +GVS+H NH
Sbjct: 121 REVKLHQFEYEDGMDKQWDISKVVTDIQNTI--SMESNVDGLKHWLLTFDAQGVSEHPNH 178

Query: 165 IACHEAVSNLVQDESNVKAALY--LDSYGDNIVLKYSAFFWEIWKLT--------RDWFL 214
           IAC++A+  L Q  SN    L   L+SYG NI+LKYS+F   ++KL         R + L
Sbjct: 179 IACYDAMMTLKQKSSNPGDYLLMTLNSYGSNIILKYSSFLPVVFKLLINIINDKFRIFEL 238

Query: 215 HRVLPTSSYNENKPATEITLMSDYSSYILSFASMLHSHKSQMVWFRYGWWTFSRFVFVND 274
            +V   S + E+    +I  ++ +  YI++ +SML+SH SQMVWFRYGWW+FSRFVFVND
Sbjct: 239 KQVPFLSMHKEHD---QIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSFSRFVFVND 295

Query: 275 LKVVN 279
           L +++
Sbjct: 296 LHIID 300

>Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON}
           complement(6124..6999) [876 nt, 292 aa]
          Length = 291

 Score =  211 bits (537), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 115/284 (40%), Positives = 176/284 (61%), Gaps = 10/284 (3%)

Query: 1   MVVAIKFPKVYFLLWVLFIAFSVRIKSRNGSVFNDNLKFLDEIDSLSLVVAHPDDEVMFF 60
           M    K  K+YFLLW  ++ F+  I+  N         +     S++LV+AHPDDEVMFF
Sbjct: 4   MSFVFKAIKLYFLLWCGYVWFAGAIRGENARQVR-GPGYFSGSSSVNLVIAHPDDEVMFF 62

Query: 61  APTILELDSRLPPNVEFNVVCLSKG---GADELGDTRVQELKESVNLLLANSKRQYQLQQ 117
           +PT+++LD+ LP +V  NV+C SKG        G++R +ELK+SV++L+ +  R   + Q
Sbjct: 63  SPTLMQLDNWLPNDVAINVICFSKGVNVDGSIAGESRARELKKSVSMLIEHD-RPVTVHQ 121

Query: 118 HDYPDGHEETWDQESV---QSTIKDSVLQGRRSSVLLTFDDKGVSKHVNHIACHEAVSNL 174
            DY DG ++ WD +S+     T+ +     +R  +L+TFD+ GVS H NHIACH AV  L
Sbjct: 122 LDYKDGKDQIWDLDSMVWDLKTLINPSKDYKRKDLLITFDEHGVSDHPNHIACHNAVHRL 181

Query: 175 VQDESNVKAALYLDSYGDNIVLKYSAFFWEIWKLTRDWFLHRVLPTSSYNENKPAT-EIT 233
           +++E  +  A  L+S+  N++LKYS F  EI K   ++   R+   +S N+N     E  
Sbjct: 182 IEEEP-LFMAYQLESHSTNVILKYSFFAREIVKYFYNYCHQRIKGQTSLNKNMDVPYEYV 240

Query: 234 LMSDYSSYILSFASMLHSHKSQMVWFRYGWWTFSRFVFVNDLKV 277
           L + +S YI+++A+ML++H+SQ+VWFRYGWW FSR  + N+LK+
Sbjct: 241 LFNTHSEYIMAYATMLNAHESQVVWFRYGWWFFSRLTYANELKL 284

>NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846
           YMR281W
          Length = 313

 Score =  211 bits (537), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 122/300 (40%), Positives = 186/300 (62%), Gaps = 36/300 (12%)

Query: 9   KVYFLLWVLFIAFSVRIKSRN-----GSVFNDNLK-------FLDEIDSLSLVVAHPDDE 56
           K++ LLW+ ++  + +I S N      SV N  L+         + I  LSLV+AHPDDE
Sbjct: 14  KLFLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPITQLSLVIAHPDDE 73

Query: 57  VMFFAPTILELDSRLPPNVEFNVVCLSKGGADELGDTRVQELKESVNLLLANS-KRQYQL 115
           +MFFAPT+L+L+  LP ++ FN++C S G A+ LG  R +EL +S+NLLL++S  R+  +
Sbjct: 74  LMFFAPTLLQLNRFLPTSIPFNIICFSDGDAEGLGYLRRKELHDSINLLLSSSNNRKINI 133

Query: 116 QQHDYPDGHEETWDQESVQSTIKDSVL----QGRRSSVLLTFDDKGVSKHVNHIACHEAV 171
              D+ DG ++ WD + + S++++ +L       ++++LLTFD  G+S H NHIAC++AV
Sbjct: 134 SILDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGISNHPNHIACNKAV 193

Query: 172 SNLV-----QDESNVKAALYLDSYGD------NIVLKYSAFFWEIWKLTRDWFLHRVLPT 220
            +L+     +D+      L L S  D      N++ KY+ F  ++ K+  +      L T
Sbjct: 194 HDLISYDGGKDKEMNIIGLMLSSKSDEYNIVMNLLSKYTFFVIDLVKVYWN------LAT 247

Query: 221 SSYNE--NKPATEITLMSDYSSYILSFASMLHSHKSQMVWFRYGWWTFSRFVFVNDLKVV 278
            ++N   N  + E++ ++ YS YILS+ASML++HKSQMVWFRYGWW FSRFVF NDL VV
Sbjct: 248 GTFNTIPNSASLELSFINTYSQYILSYASMLNTHKSQMVWFRYGWWWFSRFVFSNDLLVV 307

>NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON}
           Anc_8.846 YMR281W
          Length = 276

 Score =  194 bits (492), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 106/254 (41%), Positives = 150/254 (59%), Gaps = 34/254 (13%)

Query: 36  NLKFLDEIDSLSLVVAHPDDEVMFFAPTILELDSRLPPNVEFNVVCLSKGGADELGDTRV 95
           N K   E  +L+LV+AHPDDEVMFFAPT+L+LD+ +P ++  NV+C S G A  LG+ R 
Sbjct: 45  NTKIFHEGTTLNLVIAHPDDEVMFFAPTLLQLDNLMPLSIPINVICFSNGDAQGLGEKRQ 104

Query: 96  QELKESVNLLLANSKRQYQLQQHDYPDGHEETWDQESVQSTIKDSVLQGRRSSVLLTFDD 155
            EL+ S++ L+ N +RQ  +    + DG+++ WD + +   +  +  Q       LTFD 
Sbjct: 105 HELQSSIHALIQN-QRQTNVTVLHFQDGNDQIWDIDQMTQYLPQNDHQA-----FLTFDS 158

Query: 156 KGVSKHVNHIACHEAVSNLVQDESNVKAALYLDSYGDNIVLKYSAF-------FWEIWKL 208
            GVS H NHIACH AV NL    +NV   L LDS   +++ KY+ F       +W +WK 
Sbjct: 159 HGVSGHKNHIACHNAVWNLKNTNNNV-TILTLDSIHHSLLAKYTFFIIDLVKLYWNLWK- 216

Query: 209 TRDWFLHRVLPTSSYNENKPATE----ITLMSDYSSYILSFASMLHSHKSQMVWFRYGWW 264
                          ++ +P  E    IT  + YS YIL++++ML++HKSQ+VWFRYGWW
Sbjct: 217 ---------------DQQQPQWESHDKITFFNAYSQYILAYSTMLNAHKSQVVWFRYGWW 261

Query: 265 TFSRFVFVNDLKVV 278
            FSRFVF N LK+ 
Sbjct: 262 AFSRFVFSNHLKIT 275

>TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.846
           YMR281W
          Length = 319

 Score =  194 bits (494), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 118/318 (37%), Positives = 184/318 (57%), Gaps = 49/318 (15%)

Query: 5   IKFPKVYFLLWVLFIAFSVRIKSRNG---SVFNDNLKFLD-----EIDSLSLVVAHPDDE 56
           I+  K+  + W+++I  S  IK  N    + FN +++ +      +I+SLSL++AHPDDE
Sbjct: 8   IRTVKLILIFWLIYIFNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKINSLSLIIAHPDDE 67

Query: 57  VMFFAPTILELDSRLPPNVEFNVVCLSKGGADELGD----TRVQELKESVNLLLANS--- 109
           +MFF+PT+L+L++ L  ++ FNVVCLS+G  D  G      RV EL +S+NLL       
Sbjct: 68  IMFFSPTLLQLNNYLEKDIMFNVVCLSQG-LDSTGSFKDPQRVHELNDSLNLLFNRGSNN 126

Query: 110 --KRQYQLQQHDYPDGHEETWDQESVQSTIKDSVLQGRRSS-----VLLTFDDKGVSKHV 162
              R ++L Q DY DG +E W+ +     I D +LQ    +     +LLTFD  GVS H 
Sbjct: 127 EHNRNFKLIQLDYTDGMKEIWNMD----LIVDDLLQNLNFTDNGINLLLTFDKSGVSNHK 182

Query: 163 NHIACHEAVSNLVQ---DESNVKAALYLDSYGDNIVLKYSAFFWEIWKLTRDWFLHRV-- 217
           NH+AC+EAV+ L++    +SN+   ++L+S+  N  LKYS F  +++ + +  F   +  
Sbjct: 183 NHLACNEAVTKLLKYSNPDSNL-IGIFLNSHSKNFFLKYSFFVSKLFTIIKLKFFRSISL 241

Query: 218 -----LPTSSYNEN-----------KPATEITLMSDYSSYILSFASMLHSHKSQMVWFRY 261
                 P S + ++           K     T  + ++ Y+LS+++ML++H+SQMVWFRY
Sbjct: 242 FYSFCFPNSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTMLNAHESQMVWFRY 301

Query: 262 GWWTFSRFVFVNDLKVVN 279
            WW FSRF F+NDL +VN
Sbjct: 302 LWWIFSRFAFINDLTIVN 319

>Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar to
           Ashbya gossypii ABL120W
          Length = 249

 Score =  186 bits (471), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 102/267 (38%), Positives = 157/267 (58%), Gaps = 27/267 (10%)

Query: 9   KVYFLLWVLFIAFSVRIKSRNGSVFNDNLKFLDEIDSLSLVVAHPDDEVMFFAPTILELD 68
           K+Y +L  ++      +++ N  V+   +       S++L++AHPDDEVMFFAPT+L+LD
Sbjct: 10  KLYLVLLAVYCGSYKHLETHNSKVYEYLVGSHGNYTSVTLIIAHPDDEVMFFAPTLLQLD 69

Query: 69  SRLPPNVEFNVVCLSKGGADELGDTRVQELKESVNLLLANSKRQYQLQQHDYPDGHEETW 128
           +R+  +V F VVCL+ G AD LG+ R +EL +++ LL+   +R  ++Q   + DG +E W
Sbjct: 70  ARMAQSVPFRVVCLTDGDADGLGEVRRRELHKALRLLVL--ERDVEIQMGGFKDGMDEEW 127

Query: 129 DQESVQSTIKDSVLQGRRSSVLLTFDDKGVSKHVNHIACHEAVSNLVQDESNVKAALYLD 188
             E V+  +   V    R  ++LTFD++GVS H NHIAC  A + L          L+LD
Sbjct: 128 KMEVVREELAQVVTD--RRPLVLTFDERGVSGHRNHIACAHAAAKLGHH------TLHLD 179

Query: 189 SYGDNIVLKYSAFFWEIWKLTRDWFLHRVLPTSSYNENKPATEITLMSDYSSYILSFASM 248
           S G N++ KYS FF ++++L   +     +PT              +S +S Y+ S  +M
Sbjct: 180 S-GHNLIRKYSFFFVDLFRLLFGY----PMPT------------VFLSTFSQYLHSLVTM 222

Query: 249 LHSHKSQMVWFRYGWWTFSRFVFVNDL 275
           L +HKSQMVWFR+GWWT SR+V+ N+ 
Sbjct: 223 LVAHKSQMVWFRWGWWTASRYVYANEF 249

>Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {ON}
           YMR281W (GPI12) -
           N-acetylglucosaminylphosphatidylinositol de-N-acetylase
           [contig 39] FULL
          Length = 254

 Score =  185 bits (470), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 105/272 (38%), Positives = 165/272 (60%), Gaps = 32/272 (11%)

Query: 9   KVYFLLWVLFIAFSVRIKSRN----GSVFNDNLKFLDEIDSLSLVVAHPDDEVMFFAPTI 64
           KV  +LW+++I  SV+I+  N    GS+F  +        S++LV+AHPDDEVMFFAPT+
Sbjct: 9   KVSGILWLVYILGSVQIERSNRRALGSLFRGSAP-----TSINLVIAHPDDEVMFFAPTL 63

Query: 65  LELDSRLPPNVEFNVVCLSKGGADELGDTRVQELKESVNLLLANSKRQYQLQQHDYPDGH 124
           L++D  LP ++E NV+ L+ GGAD LGD R +EL++ V LLL   KR+  ++  D+ DG 
Sbjct: 64  LQIDEWLPGSIEVNVISLTDGGADGLGDLRTKELQDCVRLLL--RKRKASVEVLDFLDGM 121

Query: 125 EETWDQESVQSTIKDSVLQGRRSSVLLTFDDKGVSKHVNHIACHEAVSNLVQDESNVKAA 184
           +  WD E     +++ +L    S + LTFD+ G+S HVNHI+C++AV  + +  S  K++
Sbjct: 122 DVEWDLERAVKALQERILD--ESPLFLTFDENGISGHVNHISCYKAVQKVRKHYS--KSS 177

Query: 185 LYLDSYGDNIVLKYSAFFWEIWKLTRDWFLHRVLPTSSYNENKPATEITLMSDYSSYILS 244
            +       +  KYS F   ++               S+  + P+   TL++ +  Y+L+
Sbjct: 178 CFKLVSKRYLFEKYSGFIPALFH--------------SFISSSPS---TLINSFRQYLLA 220

Query: 245 FASMLHSHKSQMVWFRYGWWTFSRFVFVNDLK 276
            +SM+++H SQMVWFRYGWW FS +V+ N+L+
Sbjct: 221 LSSMMNAHVSQMVWFRYGWWLFSYYVYANELQ 252

>SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON}
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281W GPI12 ER membrane protein involved in the second
           step of glycosylphosphatidylinositol (GPI) anchor
           assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 260

 Score =  185 bits (470), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 114/276 (41%), Positives = 152/276 (55%), Gaps = 26/276 (9%)

Query: 3   VAIKFPKVYFLLWVLFIAFSVRIKSRNGSVFNDNLKFLDEIDSLSLVVAHPDDEVMFFAP 62
           V  K  K Y LL VL+I  S RI + N  VF  N+       S++L+VAHPDDE MFF+P
Sbjct: 6   VVAKLLKAYALLSVLYICVSQRIAAHNRQVFR-NVFPSRTPTSVNLIVAHPDDETMFFSP 64

Query: 63  TILELDSRLPPNVEFNVVCLSKGGADELGDTRVQELKESVNLLLANSKRQYQLQQHDYPD 122
           T+L+L    PP+V   V+CL+ G AD LG  R QEL+ S+ LLL    R   +    + D
Sbjct: 65  TLLQLHVNYPPSVPLRVICLTNGDADGLGAVREQELRLSMQLLL--PARNTSVIVEGFED 122

Query: 123 GHEETWDQESVQSTIKDSVLQGRRSSVLLTFDDKGVSKHVNHIACHEAVSNLVQDESNVK 182
           G    WD   V +TI   V     S +LLTFD+ GVS HVNH++C+ AVS LV+     +
Sbjct: 123 GMGVEWDTRQVVATINRHVSDA--SPLLLTFDEHGVSGHVNHVSCNTAVSALVEQREQRE 180

Query: 183 ---AALYLDSYGDNIVLKYSAFFWEIWKLTRDWFLHRVLPTSSYNENKPATEITLMSDYS 239
               ALYL+S       KY +F  ++ ++                  +P      MS + 
Sbjct: 181 QRFTALYLNS-KRYFPPKYGSFAVDLARII--------------TGRQPP---VFMSTFP 222

Query: 240 SYILSFASMLHSHKSQMVWFRYGWWTFSRFVFVNDL 275
            Y+LS A+M ++H SQMVWFR+GWW  SRFVFVN+L
Sbjct: 223 QYLLSLAAMCNAHVSQMVWFRWGWWLASRFVFVNEL 258

>CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281w GPI12 N-acetylglucosaminyl phosphatidylinositol
           deacetylase
          Length = 304

 Score =  182 bits (462), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 111/281 (39%), Positives = 157/281 (55%), Gaps = 16/281 (5%)

Query: 6   KFPKVYFLLWVLFIAFSVRIKSRNGSVFNDNLKFLDEIDSLSLVVAHPDDEVMFFAPTIL 65
           K  K+  +  VL+I F+ +++  N       L   D    L+LV+AHPDDE+MFF+PTIL
Sbjct: 24  KLTKLTIIFQVLYIYFTPKVEDLNKENLTKLLPTHDNFGVLNLVIAHPDDEIMFFSPTIL 83

Query: 66  ELDSRLPPNVEFNVVCLSKGGADELGDTRVQELKESVNLLLANSK-RQYQLQQHDYPDGH 124
           +L   +    E NVVCLS G AD LG+ R +ELK+++  L  N   R   L   DY DG 
Sbjct: 84  QLIDHVQ---ELNVVCLSNGDADGLGELRAKELKDAIGYLTVNRNLRNVSLNILDYTDGQ 140

Query: 125 EETWDQESVQSTIKDSVLQG----RRSSVLLTFDDKGVSKHVNHIACHEAV-SNLVQDES 179
            E W    V + +K  +L      ++  ++LTFD +G+S H NHIAC+E V S L   +S
Sbjct: 141 NEVW--SGVATDLKKYILTSEPGVKQKDIILTFDREGISGHRNHIACNEGVISYLKTIKS 198

Query: 180 NVKAALYLDSYGD-NIVLKYSAFFWEIWKLTRDWFLHRVLPTSSYNENKPA----TEITL 234
           N    L L S     I+ KYS    ++ ++  +          SY  N+ +    + +  
Sbjct: 199 NSFVFLELKSLSTWQIISKYSGVVPKLLEIIYNKIRASNKTFVSYLPNRDSIATDSNVCF 258

Query: 235 MSDYSSYILSFASMLHSHKSQMVWFRYGWWTFSRFVFVNDL 275
           +S +  Y LSFA+M ++HKSQMVWFRY WW+FSR+VFVNDL
Sbjct: 259 ISTFDQYALSFAAMCYAHKSQMVWFRYLWWSFSRYVFVNDL 299

>KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {ON}
           weakly similar to uniprot|P23797 Saccharomyces
           cerevisiae YMR281W GPI12 ER membrane protein involved in
           the second step of glycosylphosphatidylinositol (GPI)
           anchor assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 254

 Score =  174 bits (441), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 96/268 (35%), Positives = 152/268 (56%), Gaps = 24/268 (8%)

Query: 9   KVYFLLWVLFIAFSVRIKSRNGSVFNDNLKFLDEIDSLSLVVAHPDDEVMFFAPTILELD 68
           K+  +L +L+ A S RIK+ N   F      L+   S++LV+AHPDDEVMFFAPT+L+LD
Sbjct: 9   KLLAVLCILYFASSARIKASNEQAFTTLFSVLNPT-SINLVIAHPDDEVMFFAPTLLQLD 67

Query: 69  SRLPPNVEFNVVCLSKGGADELGDTRVQELKESVNLLLANSKRQYQLQQHDYPDGHEETW 128
                ++  +V  L+ GGAD LG  R +EL++SV+LL    +R+ ++   ++ DG +  W
Sbjct: 68  HYFDTDIPVSVFSLTDGGADGLGKLREEELRDSVHLLF--RRRKAEVTVLNFEDGMKVEW 125

Query: 129 DQESVQSTIKDSVLQGRRSSVLLTFDDKGVSKHVNHIACHEAVSNLVQDESNVKAALYLD 188
           D +     ++  V+  +   + LTFDD GVS H+NHI+C+E V NL       ++  +  
Sbjct: 126 DLQKTSEALRKQVVGDQ--PLFLTFDDHGVSSHINHISCYETVRNLRAAHPESRS--FSL 181

Query: 189 SYGDNIVLKYSAFFWEIWKLTRDWFLHRVLPTSSYNENKPATEITLMSDYSSYILSFASM 248
           +   +I  KY+AF   +  + R                  + +   MS +  Y+L+ + M
Sbjct: 182 TSKRSIFQKYTAFVPSLITVLRG-----------------SRQAVFMSTFKQYLLALSVM 224

Query: 249 LHSHKSQMVWFRYGWWTFSRFVFVNDLK 276
           +++H SQMVWFRYGWW FS +VF N+++
Sbjct: 225 MNAHTSQMVWFRYGWWFFSCYVFANEVR 252

>ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR281W (GPI12)
          Length = 249

 Score =  169 bits (428), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 96/266 (36%), Positives = 151/266 (56%), Gaps = 27/266 (10%)

Query: 9   KVYFLLWVLFIAFSVRIKSRNGSVFNDNLKFLDEIDSLSLVVAHPDDEVMFFAPTILELD 68
           K+Y LL  ++     R++  N  VF   +    +  SL+LV+AHPDDEVMFFAPT+L+LD
Sbjct: 10  KLYLLLLAVYCWSRRRLERHNTQVFERLVGGDSQHTSLTLVIAHPDDEVMFFAPTLLQLD 69

Query: 69  SRLPPNVEFNVVCLSKGGADELGDTRVQELKESVNLLLANSKRQYQLQQHDYPDGHEETW 128
           +RLP  + F VVCL+ GGA+ LG  R  EL++++ LL+   +    L+  D+ DG +E W
Sbjct: 70  ARLPAWMPFRVVCLTDGGAEGLGQLRRAELQKALRLLVL--EHDVTLEVADFTDGMKEDW 127

Query: 129 DQESVQSTIKDSVLQGRRSSVLLTFDDKGVSKHVNHIACHEAVSNLVQDESNVKAALYLD 188
           D   V++ + + V   +   ++LTFD++GVS H NHI C  A + L          L+L 
Sbjct: 128 DLAEVRTRLGELVTDAK--PLVLTFDERGVSGHRNHIGCALAAARLGHK------TLFLR 179

Query: 189 SYGDNIVLKYSAFFWEIWKLTRDWFLHRVLPTSSYNENKPATEITLMSDYSSYILSFASM 248
           S   N++ KYS F  +++++              +    P      +S  + Y+ +  +M
Sbjct: 180 SE-RNLLRKYSFFVLDVFRVV-------------FGTPPPT---VFVSTLAQYLHALVAM 222

Query: 249 LHSHKSQMVWFRYGWWTFSRFVFVND 274
           + +H+SQMVWFR+GWW  SR+V+ N+
Sbjct: 223 VVAHRSQMVWFRWGWWMASRYVYANE 248

>KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {ON}
           similar to uniprot|Q75DZ3 Ashbya gossypii ABL120W
           ABL120Wp and weakly similar to YMR281W uniprot|P23797
           Saccharomyces cerevisiae YMR281W GPI12 ER membrane
           protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de- N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 263

 Score =  164 bits (415), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 100/272 (36%), Positives = 150/272 (55%), Gaps = 23/272 (8%)

Query: 6   KFPKVYFLLWVLFIAFSVRIKSRNGSVFNDNLK--FLDEIDSLSLVVAHPDDEVMFFAPT 63
           KF   Y +  V++   +  IK  N   F++ +    + ++ S++LVVAHPDDEVMFF+PT
Sbjct: 9   KFVLWYLVFLVIYGCLTKTIKEHNRWYFHELVSESMVSKLTSVTLVVAHPDDEVMFFSPT 68

Query: 64  ILELDSRLPPNVEFNVVCLSKGGADELGDTRVQELKESVNLLLANSKRQYQLQQHDYPDG 123
           + + +  LP ++  NVVC++ G AD LG  R QEL +S+ ++     RQ+     D+ DG
Sbjct: 69  LTQFNELLPISIPINVVCMTAGDADGLGHIRKQELVDSLRIMFHG--RQFGCDVLDFEDG 126

Query: 124 HEETWDQESVQSTIKDSVLQGRRSSVLLTFDDKGVSKHVNHIACHEAVSNLVQDESNVKA 183
            +  WDQ  ++  ++ S+     + ++LTFD  GVS H+NHI+C   V  L         
Sbjct: 127 MDAVWDQVLLEKQLRSSIPDS--NPLVLTFDQFGVSGHINHISCGRLVEKLPYSHK---- 180

Query: 184 ALYLDSYGDNIVLKYSAFFWEIWKLTRDWFLHRVLPTSSYNENKPATEITLMSDYSSYIL 243
            L+L S    I +KYSAF   I++L         + T   +  KP   I   S    Y+L
Sbjct: 181 -LHLRS-DQPIYVKYSAFIAGIFQLG--------ISTVYPDYGKPRCFI---STLPQYLL 227

Query: 244 SFASMLHSHKSQMVWFRYGWWTFSRFVFVNDL 275
           + ++M  +H SQMVWFR GWW FSRF F+N+L
Sbjct: 228 AASAMSLAHTSQMVWFRVGWWLFSRFCFINEL 259

>NDAI0J01720 Chr10 (420228..421007) [780 bp, 259 aa] {ON} Anc_4.139
           YLR323C
          Length = 259

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 189 SYGDNIVLKYSAF-FWEIWKLTRDWFLHRVLPTSSYNENKPATEITLMSDYSSYILS 244
            YGD+    +S   F   WKL +DW ++    +S  NEN P   +   +DY + I++
Sbjct: 151 GYGDSCKFLHSRDDFKAGWKLNQDWKINDDTSSSIINENIPFKCVICKNDYKNPIVT 207

>CAGL0L00297g Chr12 (32461..36618) [4158 bp, 1385 aa] {ON} similar
           to uniprot|P23255 Saccharomyces cerevisiae YCR042c TSM1
          Length = 1385

 Score = 29.6 bits (65), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 26/47 (55%)

Query: 151 LTFDDKGVSKHVNHIACHEAVSNLVQDESNVKAALYLDSYGDNIVLK 197
           +TFD KG+      I    + + +  D+   +  +YL+S+ DN++LK
Sbjct: 60  VTFDSKGLEITDVTIESRRSANYIYDDQQRTQHEVYLNSFNDNLLLK 106

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.135    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,438,350
Number of extensions: 1376764
Number of successful extensions: 4098
Number of sequences better than 10.0: 32
Number of HSP's gapped: 4164
Number of HSP's successfully gapped: 32
Length of query: 280
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 172
Effective length of database: 41,097,471
Effective search space: 7068765012
Effective search space used: 7068765012
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)