Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0G14278g8.845ON1250125053280.0
TDEL0B005308.845ON1301123327450.0
SAKL0D01342g8.845ON1270117223870.0
KLTH0C03762g8.845ON1206111721630.0
Kwal_27.102328.845ON1209112520910.0
ABL121C8.845ON128589619740.0
Suva_13.4688.845ON141888318190.0
YMR280C (CAT8)8.845ON143390318200.0
Smik_13.4938.845ON143386018000.0
Skud_13.4528.845ON143286917930.0
KLLA0D01452g8.845ON144569017240.0
NCAS0C003908.845ON116483916770.0
KNAG0J002508.845ON1237110016010.0
KAFR0B039508.845ON124670415650.0
Ecym_46168.845ON157747314541e-176
CAGL0M03025g8.845ON125487214031e-172
NDAI0K003908.845ON149573514161e-171
Kpol_1016.201.277ON10861142194e-17
ZYRO0G15136g1.277ON1027542161e-16
TPHA0I028201.277ON1044502132e-16
KLTH0D03564g1.277ON862652089e-16
AFR096W1.277ON852482071e-15
SAKL0D05654g1.277ON919652071e-15
KAFR0A014801.277ON725492042e-15
KLLA0F14322g1.277ON717542033e-15
Kwal_26.7397singletonOFF201651884e-15
Ecym_63401.277ON952482016e-15
Smik_10.1531.277ON829492007e-15
YJL089W (SIP4)1.277ON829751999e-15
TDEL0D014501.277ON9451012009e-15
Skud_10.1251.277ON833891972e-14
Suva_6.1611.277ON832591972e-14
CAGL0L03377g1.277ON1209481892e-13
NDAI0G055301.277ON1186481873e-13
KNAG0B018401.277ON1072491821e-12
TBLA0D054201.277ON757481765e-12
NCAS0A094101.277ON932721641e-10
KLLA0E13993gsingletonON678441255e-06
TBLA0G026102.231ON1000511255e-06
NCAS0D025405.235ON890871239e-06
Kpol_495.213.109ON1085791249e-06
Ecym_7440na 1ON898601239e-06
SAKL0A09856g2.547ON1020791221e-05
SAKL0C02024gsingletonON898481202e-05
KLLA0F04609g2.231ON916331202e-05
SAKL0G11902g5.235ON906481202e-05
NDAI0F012206.279ON960451202e-05
YGL013C (PDR1)4.113ON1068651203e-05
KLLA0C10923g5.235ON775481193e-05
TBLA0G018006.279ON11541061193e-05
TPHA0F013802.231ON8901261183e-05
YPL248C (GAL4)6.279ON881471184e-05
KAFR0J017102.231ON848331184e-05
Kpol_1018.306.279ON881501184e-05
Smik_6.4526.279ON878471184e-05
NCAS0B065502.231ON906331184e-05
KNAG0D006906.279ON875451174e-05
SAKL0E08998g2.231ON823371174e-05
TPHA0H019806.279ON993471175e-05
Smik_9.392.231ON1012331175e-05
NDAI0B038502.231ON930331175e-05
YIL130W (ASG1)2.231ON964331175e-05
Skud_9.372.231ON954331175e-05
KLTH0D02222gna 2ON847571176e-05
NCAS0A047502.547ON1141911176e-05
KNAG0B051205.235ON888611176e-05
NCAS0D041906.279ON890451166e-05
Suva_9.592.231ON926331166e-05
TDEL0C044802.231ON852331167e-05
ZYRO0E08272g6.279ON794471157e-05
KLTH0G09108g2.231ON782331158e-05
Kwal_23.47542.231ON812331158e-05
KLTH0D07260g2.547ON979831158e-05
CAGL0G08844g2.231ON847411159e-05
KNAG0E017602.231ON902331151e-04
KAFR0C049807.17ON951771151e-04
KAFR0F014901.128ON658491141e-04
NCAS0G011006.279ON935451141e-04
Kpol_1039.112.231ON992331141e-04
SAKL0C03938g1.128ON780361131e-04
Smik_12.3271.380ON1503801141e-04
SAKL0A02860g6.279ON745451131e-04
CAGL0M12298g7.17ON994631131e-04
ZYRO0C00726g7.17ON1035721132e-04
TDEL0E00160singletonON631431122e-04
ZYRO0E06270g2.565ON912471132e-04
NDAI0I023505.235ON889441132e-04
TDEL0E039105.235ON862651122e-04
KLTH0E14454gna 1ON902451122e-04
YJL206C1.128ON7581581122e-04
ZYRO0C18150g1.128ON571411112e-04
NDAI0A087907.17ON1059331122e-04
KAFR0J006905.235ON864441122e-04
KAFR0F010406.279ON834471122e-04
KLLA0A09119g4.113ON1082761112e-04
Kwal_23.29055.235ON881481112e-04
Suva_16.596.279ON895451113e-04
Suva_10.945.235ON906441113e-04
YOR162C (YRR1)6.60ON810641113e-04
KLTH0G07898g5.235ON866481103e-04
KNAG0E002107.17ON948331103e-04
Smik_7.2774.113ON1069651103e-04
ZYRO0A10956g5.235ON855441104e-04
KAFR0F034104.113ON995381104e-04
KLLA0F09559gsingletonON658641094e-04
TPHA0N002307.17ON1232331094e-04
Suva_15.773.109ON1029491094e-04
AER370W2.231ON801381094e-04
Kpol_538.427.17ON1088721095e-04
KNAG0K008203.109ON1050781095e-04
SAKL0H24860gna 3ON971651095e-04
KLTH0H16170gna 4ON619331085e-04
NDAI0I007406.279ON1033451085e-04
SAKL0D14542gna 5ON946431086e-04
SAKL0B06732gna 1ON878491086e-04
ADR405Cna 6ON807541076e-04
Smik_1.137.17ON1046461077e-04
NCAS0A088401.380ON1478631087e-04
KLLA0A02585gna 7ON370371067e-04
Smik_2.438na 8ON469421067e-04
KLLA0F25630g2.547ON10071051077e-04
Smik_12.775.235ON903441077e-04
YOR380W (RDR1)na 9ON546491068e-04
YBR297W (MAL33)na 8ON468411068e-04
KLLA0C18953gna 10ON7031541068e-04
CAGL0I07755g3.109ON1053811078e-04
Skud_15.546na 9ON542601068e-04
TBLA0A012101.380ON1422301079e-04
YLR256W (HAP1)1.380ON1502821079e-04
Smik_18.8singletonON775531069e-04
TPHA0A06090singletonON847401069e-04
Skud_10.101.128ON8331571069e-04
KAFR0A021302.565ON707571060.001
Smik_10.251.128ON7721601060.001
Skud_7.2744.113ON1080641060.001
KLTH0B00352gsingletonON934431060.001
CAGL0A00451g4.113ON1107511060.001
Skud_12.825.235ON899561060.001
Ecym_53972.231ON826331050.001
YLR014C (PPR1)5.235ON904441050.001
TBLA0C040504.113ON1207361050.001
SAKL0D14520g7.17ON983381050.001
NDAI0D00900singletonON865331050.001
AER183Cna 1ON879421050.001
KAFR0I002307.17ON1045331050.001
NCAS0A076107.17ON1022681050.001
SAKL0B04620gna 7ON362371030.002
Suva_1.147.17ON1045461040.002
TPHA0H012405.59ON877481040.002
Smik_13.1832.565ON911561040.002
YAL051W (OAF1)7.17ON1047991040.002
Smik_15.561na 9ON546471030.002
Ecym_50177.17ON978521040.002
SAKL0D01100g4.113ON940381040.002
YOR363C (PIP2)7.17ON996601040.002
NCAS0I002707.17ON944691040.002
TBLA0E007007.17ON1274531040.002
KLLA0D12672g6.279ON865451040.002
Skud_1.107.17ON1040461040.002
NDAI0B015402.565ON803461030.002
ADR403C7.17ON970501030.002
NDAI0F00110singletonON508331030.002
CAGL0J07150g7.17ON1022431030.002
CAGL0B03421g1.380ON1355391030.002
Skud_15.3266.60ON818651030.002
TPHA0A045403.109ON1178371030.002
SAKL0C09944g3.109ON1061421030.002
TBLA0A097606.75ON1530431030.003
Suva_6.2851.128ON7861571020.003
SAKL0D00264g8.879ON848291020.003
KLTH0H02684g6.279ON749451020.003
SAKL0D13464g2.565ON687641020.003
ADR404Cna 5ON875461020.003
NCAS0D04860singletonON701391020.003
Smik_11.2402.654ON9761511020.003
Skud_15.643.109ON1032581020.003
Suva_8.436na 9ON545521010.003
CAGL0D02904g5.235ON887651010.003
Skud_12.3351.380ON1479821020.003
Kwal_26.81092.547ON970501010.004
TDEL0C056801.128ON691301010.004
NDAI0G041403.109ON1001841010.004
Skud_9.220singletonON793361010.004
TBLA0C062306.60ON795331010.004
KAFR0B014502.547ON1088641010.004
NCAS0A035804.113ON1113371010.004
SAKL0H00682gna 11ON922461010.004
Suva_7.2684.113ON1000551010.004
Ecym_27321.380ON1198431010.004
KNAG0A071002.547ON1286551010.004
SAKL0A00704gna 12ON718461000.004
KLLA0F22990g1.380ON1253301010.004
TDEL0H043407.17ON989331000.004
Smik_2.3836.154ON44858990.004
ACL058Wna 3ON817811000.005
Kpol_260.25.59ON756411000.005
TBLA0G011308.879ON1132341000.005
YKL038W (RGT1)2.547ON1170831000.005
Suva_4.4996.154ON45060990.005
NDAI0H019907.17ON1161331000.005
Smik_17.27singletonON68833990.005
KLLA0C14212gna 11ON1040361000.006
Skud_11.1902.547ON1171831000.006
Suva_11.1872.547ON1171861000.006
Kwal_34.15751na 4ON62843990.006
CAGL0K05841g1.380ON137230990.006
Kpol_467.11.380ON128944990.007
Ecym_22636.154ON50873980.007
Skud_15.5327.17ON100047990.007
Skud_2.427na 8ON46838980.007
Kpol_1002.52.547ON95883990.007
TBLA0G005106.60ON93577990.007
TDEL0D051503.109ON99647990.007
Ecym_2522na 12ON92634990.007
Smik_12.6na 13ON84541990.007
KNAG0E041507.17ON113633990.007
NCAS0A03070singletonON65633980.008
TBLA0G00490singletonON91863980.008
KLLA0A10329gna 14ON63939980.008
NCAS0C002208.879ON83929980.009
TBLA0A058601.128aON81073980.009
CAGL0F07909g3.109ON104936980.009
Kwal_47.175064.113ON924183980.010
KAFR0I020301.380ON123330980.010
KNAG0A02300singletonON72952970.010
KNAG0I014501.380ON147630980.010
Smik_4.2693.264ON77884970.010
ZYRO0E05676g2.547ON106672980.010
KNAG0C059804.113ON96875970.010
TBLA0D006307.389ON107747970.010
Suva_16.25singletonON14342910.011
KAFR0E023305.59ON70438970.011
KLLA0F19602g8.283ON60338970.011
Suva_10.3511.380ON32482950.011
YKL015W (PUT3)2.654ON979151970.012
CAGL0F09229gna 15ON83533970.012
ZYRO0G22550gsingletonON72437970.012
YBR240C (THI2)6.154ON45067960.012
NDAI0D035504.113ON111842970.012
NDAI0A057503.264ON75976970.012
Suva_8.4217.17ON100252970.012
NDAI0G052601.380ON158130970.012
Suva_10.18na 13ON84241970.012
KLLA0F02750g3.109ON114850970.013
Smik_11.2102.547ON116956970.013
Suva_13.1862.565ON89453960.013
Skud_5.331singletonON17041910.014
YMR019W (STB4)2.565ON94951960.014
ZYRO0E05412g1.380ON124449960.014
SAKL0D07898g1.380ON124430960.014
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0G14278g
         (1250 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa...  2056   0.0  
TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.84...  1061   0.0  
SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} simil...   924   0.0  
KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} simil...   837   0.0  
Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR28...   810   0.0  
ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON} ...   764   0.0  
Suva_13.468 Chr13 complement(809712..812654,812694..814007) [425...   705   0.0  
YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}...   705   0.0  
Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa] ...   697   0.0  
Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa] ...   695   0.0  
KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} simil...   668   0.0  
NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845     650   0.0  
KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.8...   621   0.0  
KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa] {...   607   0.0  
Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {...   564   e-176
CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]...   545   e-172
NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845    550   e-171
Kpol_1016.20 s1016 (51828..55088) [3261 bp, 1086 aa] {ON} (51828...    89   4e-17
ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa...    88   1e-16
TPHA0I02820 Chr9 complement(620925..624059) [3135 bp, 1044 aa] {...    87   2e-16
KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly...    85   9e-16
AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic ho...    84   1e-15
SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly...    84   1e-15
KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.2...    83   2e-15
KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON} unip...    83   3e-15
Kwal_26.7397 s26 complement(342483..343085) [603 bp, 201 aa] {OF...    77   4e-15
Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}...    82   6e-15
Smik_10.153 Chr10 (257677..260166) [2490 bp, 829 aa] {ON} YJL089...    82   7e-15
YJL089W Chr10 (265926..268415) [2490 bp, 829 aa] {ON}  SIP4C6 zi...    81   9e-15
TDEL0D01450 Chr4 (284869..287706) [2838 bp, 945 aa] {ON} Anc_1.2...    82   9e-15
Skud_10.125 Chr10 (233921..236422) [2502 bp, 833 aa] {ON} YJL089...    80   2e-14
Suva_6.161 Chr6 complement(283370..284500,284547..284764,284948....    80   2e-14
CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]...    77   2e-13
NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON}            77   3e-13
KNAG0B01840 Chr2 (345204..348422) [3219 bp, 1072 aa] {ON} Anc_1....    75   1e-12
TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa] ...    72   5e-12
NCAS0A09410 Chr1 complement(1865924..1868722) [2799 bp, 932 aa] ...    68   1e-10
KLLA0E13993g Chr5 complement(1239566..1241602) [2037 bp, 678 aa]...    53   5e-06
TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {...    53   5e-06
NCAS0D02540 Chr4 complement(484060..486732) [2673 bp, 890 aa] {O...    52   9e-06
Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON} (71447.....    52   9e-06
Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}...    52   9e-06
SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa] ...    52   1e-05
SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {...    51   2e-05
KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {...    51   2e-05
SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} simi...    51   2e-05
NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {O...    51   2e-05
YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON} ...    51   3e-05
KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa] {...    50   3e-05
TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa] {...    50   3e-05
TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {O...    50   3e-05
YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}  G...    50   4e-05
KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {...    50   4e-05
Kpol_1018.30 s1018 complement(81534..83840,83842..84180) [2646 b...    50   4e-05
Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C ...    50   4e-05
NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa] ...    50   4e-05
KNAG0D00690 Chr4 (105640..108267) [2628 bp, 875 aa] {ON} Anc_6.2...    50   4e-05
SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {...    50   4e-05
TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.2...    50   5e-05
Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W (R...    50   5e-05
NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {O...    50   5e-05
YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc c...    50   5e-05
Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)    50   5e-05
KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly...    50   6e-05
NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2....    50   6e-05
KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON}               50   6e-05
NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279     49   6e-05
Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W (R...    49   6e-05
TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.2...    49   7e-05
ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} simila...    49   7e-05
KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly...    49   8e-05
Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W...    49   8e-05
KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {...    49   8e-05
CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {...    49   9e-05
KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.2...    49   1e-04
KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.1...    49   1e-04
KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {O...    49   1e-04
NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {O...    49   1e-04
Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON} (29727....    49   1e-04
SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {...    48   1e-04
Smik_12.327 Chr12 (590984..595495) [4512 bp, 1503 aa] {ON} YLR25...    49   1e-04
SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {...    48   1e-04
CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa...    48   1e-04
ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar...    48   2e-04
TDEL0E00160 Chr5 (16083..17978) [1896 bp, 631 aa] {ON}                 48   2e-04
ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly...    48   2e-04
NDAI0I02350 Chr9 (536448..539117) [2670 bp, 889 aa] {ON} Anc_5.235     48   2e-04
TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.2...    48   2e-04
KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]...    48   2e-04
YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON} Pu...    48   2e-04
ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some...    47   2e-04
NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]...    48   2e-04
KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5....    48   2e-04
KAFR0F01040 Chr6 complement(195192..197696) [2505 bp, 834 aa] {O...    48   2e-04
KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa] ...    47   2e-04
Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C (...    47   2e-04
Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}...    47   3e-04
Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {O...    47   3e-04
YOR162C Chr15 complement(639560..641992) [2433 bp, 810 aa] {ON} ...    47   3e-04
KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} simila...    47   3e-04
KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17 ...    47   3e-04
Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {O...    47   3e-04
ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} simila...    47   4e-04
KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {O...    47   4e-04
KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {...    47   4e-04
TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.1...    47   4e-04
Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {...    47   4e-04
AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic ...    47   4e-04
Kpol_538.42 s538 complement(89752..93018) [3267 bp, 1088 aa] {ON...    47   5e-04
KNAG0K00820 Chr11 complement(153470..156622) [3153 bp, 1050 aa] ...    47   5e-04
SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]...    47   5e-04
KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]...    46   5e-04
NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {...    46   5e-04
SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]...    46   6e-04
SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa] {...    46   6e-04
ADR405C Chr4 complement(1435702..1438125) [2424 bp, 807 aa] {ON}...    46   6e-04
Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W (R...    46   7e-04
NCAS0A08840 Chr1 (1746841..1751277) [4437 bp, 1478 aa] {ON} Anc_...    46   7e-04
KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {...    45   7e-04
Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W ...    45   7e-04
KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} som...    46   7e-04
Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa] {O...    46   7e-04
YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}  RDR1Tra...    45   8e-04
YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}  MAL33MAL-a...    45   8e-04
KLLA0C18953g Chr3 (1682246..1684357) [2112 bp, 703 aa] {ON} some...    45   8e-04
CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa] ...    46   8e-04
Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380...    45   8e-04
TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1....    46   9e-04
YLR256W Chr12 (646415..650923) [4509 bp, 1502 aa] {ON}  HAP1Zinc...    46   9e-04
Smik_18.8 Chr18 (12069..14396) [2328 bp, 775 aa] {ON} YOR172W (R...    45   9e-04
TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa] ...    45   9e-04
Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}...    45   9e-04
KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON} Anc_2.5...    45   0.001
Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}...    45   0.001
Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {O...    45   0.001
KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON...    45   0.001
CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar...    45   0.001
Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {O...    45   0.001
Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar t...    45   0.001
YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON} ...    45   0.001
TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {...    45   0.001
SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]...    45   0.001
NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON}               45   0.001
AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON} N...    45   0.001
KAFR0I00230 Chr9 (48095..51232) [3138 bp, 1045 aa] {ON} Anc_7.17...    45   0.001
NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]...    45   0.001
SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {...    44   0.002
Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W (R...    45   0.002
TPHA0H01240 Chr8 (274496..277129) [2634 bp, 877 aa] {ON} Anc_5.5...    45   0.002
Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 ...    45   0.002
YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}  OAF1Oleate-...    45   0.002
Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380...    44   0.002
Ecym_5017 Chr5 (36647..39583) [2937 bp, 978 aa] {ON} similar to ...    45   0.002
SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON...    45   0.002
YOR363C Chr15 complement(1020222..1023212) [2991 bp, 996 aa] {ON...    45   0.002
NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}...    45   0.002
TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {...    45   0.002
KLLA0D12672g Chr4 complement(1076011..1078608) [2598 bp, 865 aa]...    45   0.002
Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W (R...    45   0.002
NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa] {O...    44   0.002
ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}...    44   0.002
NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON}                 44   0.002
CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]...    44   0.002
CAGL0B03421g Chr2 complement(336071..340138) [4068 bp, 1355 aa] ...    44   0.002
Skud_15.326 Chr15 complement(588275..590731) [2457 bp, 818 aa] {...    44   0.002
TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON} Anc_...    44   0.002
SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa] ...    44   0.002
TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]...    44   0.003
Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C ...    44   0.003
SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON...    44   0.003
KLTH0H02684g Chr8 complement(235527..237776) [2250 bp, 749 aa] {...    44   0.003
SAKL0D13464g Chr4 (1116277..1118340) [2064 bp, 687 aa] {ON} weak...    44   0.003
ADR404C Chr4 complement(1432320..1434947) [2628 bp, 875 aa] {ON}...    44   0.003
NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON}               44   0.003
Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976 ...    44   0.003
Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {...    44   0.003
Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W ...    44   0.003
CAGL0D02904g Chr4 complement(302952..305615) [2664 bp, 887 aa] {...    44   0.003
Skud_12.335 Chr12 (592952..597391) [4440 bp, 1479 aa] {ON} YLR25...    44   0.003
Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {O...    44   0.004
TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa] ...    44   0.004
NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3....    44   0.004
Skud_9.220 Chr9 complement(396576..398957) [2382 bp, 793 aa] {ON...    44   0.004
TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6...    44   0.004
KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2....    44   0.004
NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {...    44   0.004
SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON...    44   0.004
Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {O...    44   0.004
Ecym_2732 Chr2 (1410290..1413886) [3597 bp, 1198 aa] {ON} simila...    44   0.004
KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]...    44   0.004
SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON...    43   0.004
KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON} uni...    44   0.004
TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa] {O...    43   0.004
Smik_2.383 Chr2 complement(686676..688022) [1347 bp, 448 aa] {ON...    43   0.004
ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; N...    43   0.005
Kpol_260.2 s260 complement(3488..5758) [2271 bp, 756 aa] {ON} co...    43   0.005
TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON} Anc_8....    43   0.005
YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}  RGT1Gluc...    43   0.005
Suva_4.499 Chr4 complement(871565..872917) [1353 bp, 450 aa] {ON...    43   0.005
NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {...    43   0.005
Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}...    43   0.005
KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa...    43   0.006
Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL03...    43   0.006
Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL03...    43   0.006
Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig ...    43   0.006
CAGL0K05841g Chr11 (573144..577262) [4119 bp, 1372 aa] {ON} simi...    43   0.006
Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340) ...    43   0.007
Ecym_2263 Chr2 (518089..519615) [1527 bp, 508 aa] {ON} similar t...    42   0.007
Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa] ...    43   0.007
Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W ...    42   0.007
Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON} (11943.....    43   0.007
TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.6...    43   0.007
TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.1...    43   0.007
Ecym_2522 Chr2 (1017930..1020710) [2781 bp, 926 aa] {ON} similar...    43   0.007
Smik_12.6 Chr12 complement(17429..19966) [2538 bp, 845 aa] {ON} ...    43   0.007
KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {...    43   0.007
NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON}               42   0.008
TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON}                42   0.008
KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON} conser...    42   0.008
NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879       42   0.009
TBLA0A05860 Chr1 (1449582..1452014) [2433 bp, 810 aa] {ON}             42   0.009
CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some ...    42   0.009
Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013...    42   0.010
KAFR0I02030 Chr9 complement(416471..420172) [3702 bp, 1233 aa] {...    42   0.010
KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene e...    42   0.010
KNAG0I01450 Chr9 (277513..281943) [4431 bp, 1476 aa] {ON}              42   0.010
Smik_4.269 Chr4 complement(491110..493446) [2337 bp, 778 aa] {ON...    42   0.010
ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa] ...    42   0.010
KNAG0C05980 Chr3 complement(1164771..1167677) [2907 bp, 968 aa] ...    42   0.010
TBLA0D00630 Chr4 complement(164651..167884) [3234 bp, 1077 aa] {...    42   0.010
Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON} ...    40   0.011
KAFR0E02330 Chr5 (468300..470414) [2115 bp, 704 aa] {ON} Anc_5.5...    42   0.011
KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]...    42   0.011
Suva_10.351 Chr10 (613486..614460) [975 bp, 324 aa] {ON} YLR256W...    41   0.011
YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}  PUT3Trans...    42   0.012
CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {...    42   0.012
ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]...    42   0.012
YBR240C Chr2 complement(700490..701842) [1353 bp, 450 aa] {ON}  ...    42   0.012
NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa] {...    42   0.012
NDAI0A05750 Chr1 complement(1302180..1304459) [2280 bp, 759 aa] ...    42   0.012
Suva_8.421 Chr8 complement(757924..760932) [3009 bp, 1002 aa] {O...    42   0.012
NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON} Anc_...    42   0.012
Suva_10.18 Chr10 complement(36048..38576) [2529 bp, 842 aa] {ON}...    42   0.012
KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa] ...    42   0.013
Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL03...    42   0.013
Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019...    42   0.013
Skud_5.331 Chr5 complement(543439..543951) [513 bp, 170 aa] {ON}...    40   0.014
YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putat...    42   0.014
ZYRO0E05412g Chr5 (410945..414679) [3735 bp, 1244 aa] {ON} simil...    42   0.014
SAKL0D07898g Chr4 complement(653332..657066) [3735 bp, 1244 aa] ...    42   0.014
Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON} (126243...    42   0.014
YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}  MAL13MAL...    41   0.015
Kwal_26.6805 s26 (71596..74430) [2835 bp, 944 aa] {ON} YAL051W (...    42   0.015
TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa] {...    42   0.015
Kwal_YGOB_0.139 s0 complement(61752..63560,63594..65507) [3723 b...    42   0.016
TPHA0B03630 Chr2 (844571..848860) [4290 bp, 1429 aa] {ON} Anc_1....    42   0.016
Skud_3.181 Chr3 (293773..296268) [2496 bp, 831 aa] {ON} YCR106W ...    42   0.016
SAKL0B01870g Chr2 (185897..188926) [3030 bp, 1009 aa] {ON} weakl...    42   0.016
AFR117C Chr6 complement(646829..650287) [3459 bp, 1152 aa] {ON} ...    42   0.016
KLLA0D05038g Chr4 (433653..435674) [2022 bp, 673 aa] {ON} simila...    41   0.017
KLTH0H11572g Chr8 complement(989095..992808) [3714 bp, 1237 aa] ...    42   0.017
KAFR0E01250 Chr5 complement(249538..251748) [2211 bp, 736 aa] {O...    41   0.017
TPHA0F02540 Chr6 (556797..559178) [2382 bp, 793 aa] {ON} Anc_6.6...    41   0.018
CAGL0A04455g Chr1 (437546..440842) [3297 bp, 1098 aa] {ON} simil...    41   0.018
CAGL0E05434g Chr5 (532814..535264) [2451 bp, 816 aa] {ON} simila...    41   0.018
Klac_YGOB_3960 Chr3 (291786..293297,293300..294220) [2433 bp, 81...    41   0.018
AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON} S...    41   0.018
KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa] {O...    41   0.019
KLLA0A03443g Chr1 (311628..314555) [2928 bp, 975 aa] {ON} simila...    41   0.019
NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423     41   0.019
TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879...    41   0.019
Skud_2.372 Chr2 complement(669194..670552) [1359 bp, 452 aa] {ON...    41   0.019
KNAG0I00560 Chr9 complement(93785..95776) [1992 bp, 663 aa] {ON}...    41   0.019
TDEL0D00260 Chr4 complement(44685..46628) [1944 bp, 647 aa] {ON}       41   0.020
YOL089C Chr15 complement(150398..153490) [3093 bp, 1030 aa] {ON}...    41   0.020
NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {...    41   0.022
KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON} Anc_8....    41   0.022
NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa] {...    41   0.023
ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]...    41   0.023
Ecym_8404 Chr8 complement(834988..837645) [2658 bp, 885 aa] {ON}...    41   0.024
KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}      41   0.025
NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON...    41   0.026
ZYRO0A13596g Chr1 complement(1080653..1082599) [1947 bp, 648 aa]...    41   0.026
KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some s...    41   0.026
TDEL0G03970 Chr7 (720080..723187) [3108 bp, 1035 aa] {ON} Anc_6....    41   0.026
CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa] {...    41   0.026
NCAS0A12720 Chr1 (2510574..2512853) [2280 bp, 759 aa] {ON} Anc_2...    41   0.027
Smik_15.547 Chr15 complement(966368..969355) [2988 bp, 995 aa] {...    41   0.027
Kwal_0.142 s0 complement(63621..65507) [1887 bp, 629 aa] {OFF} Y...    40   0.027
YDR034C Chr4 complement(509737..512109) [2373 bp, 790 aa] {ON}  ...    40   0.029
KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON}               40   0.029
Ecym_5015 Chr5 (29616..32099) [2484 bp, 827 aa] {ON} similar to ...    40   0.029
ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON...    40   0.030
TDEL0A02690 Chr1 (485785..487953) [2169 bp, 722 aa] {ON}               40   0.030
Kwal_23.6425 s23 (1574518..1576725) [2208 bp, 735 aa] {ON} YKL22...    40   0.030
CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON} simi...    41   0.030
TBLA0B04800 Chr2 complement(1127000..1129333) [2334 bp, 777 aa] ...    40   0.031
Kwal_23.3122 s23 complement(166388..168754) [2367 bp, 788 aa] {O...    40   0.031
Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 ...    40   0.031
Smik_3.209 Chr3 (306620..309118) [2499 bp, 832 aa] {ON} YCR106W ...    40   0.031
Smik_16.20 Chr16 complement(26236..27657) [1422 bp, 473 aa] {ON}...    40   0.031
AGL233C Chr7 complement(260414..263032) [2619 bp, 872 aa] {ON} N...    40   0.031
SAKL0B10538g Chr2 (910662..912767) [2106 bp, 701 aa] {ON} simila...    40   0.031
Smik_15.342 Chr15 complement(595611..595820,595851..598070) [243...    40   0.031
KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly...    40   0.032
Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}...    40   0.032
Suva_10.323 Chr10 complement(566314..568755) [2442 bp, 813 aa] {...    40   0.032
TDEL0B06260 Chr2 (1104557..1108300) [3744 bp, 1247 aa] {ON} Anc_...    40   0.032
NDAI0C04840 Chr3 (1117201..1120047) [2847 bp, 948 aa] {ON} Anc_8...    40   0.033
Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C...    40   0.034
Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343 ...    40   0.034
KAFR0A03180 Chr1 complement(655176..657716) [2541 bp, 846 aa] {O...    40   0.034
SAKL0H01958g Chr8 complement(193079..195055) [1977 bp, 658 aa] {...    40   0.034
TBLA0B07920 Chr2 complement(1877300..1879603) [2304 bp, 767 aa] ...    40   0.035
Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {...    40   0.036
YLR278C Chr12 complement(699999..704024) [4026 bp, 1341 aa] {ON}...    40   0.037
Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052...    40   0.037
Suva_10.376 Chr10 complement(660780..664688) [3909 bp, 1302 aa] ...    40   0.037
KLLA0F10373g Chr6 (957948..958994) [1047 bp, 348 aa] {ON} some s...    40   0.038
NDAI0E03460 Chr5 (742144..744993) [2850 bp, 949 aa] {ON} Anc_8.423     40   0.039
TDEL0H00590 Chr8 complement(101024..103477) [2454 bp, 817 aa] {O...    40   0.040
Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar t...    40   0.040
Skud_12.361 Chr12 complement(641047..645075) [4029 bp, 1342 aa] ...    40   0.040
Smik_12.357 Chr12 complement(638342..642208) [3867 bp, 1288 aa] ...    40   0.041
Kpol_1008.13 s1008 (21147..23855) [2709 bp, 902 aa] {ON} (21147....    40   0.041
KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly...    40   0.041
KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly...    40   0.042
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    40   0.044
KAFR0G02450 Chr7 (508147..511353) [3207 bp, 1068 aa] {ON} Anc_6....    40   0.044
Kwal_23.6537 s23 complement(1632048..1633706) [1659 bp, 552 aa] ...    40   0.045
KNAG0H01260 Chr8 (220201..222426) [2226 bp, 741 aa] {ON} Anc_3.2...    40   0.045
Ecym_3392 Chr3 (741359..743902) [2544 bp, 847 aa] {ON} similar t...    40   0.047
TBLA0G01100 Chr7 complement(279553..281454) [1902 bp, 633 aa] {O...    40   0.047
KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {...    40   0.047
NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON}               40   0.048
KNAG0E00450 Chr5 complement(74721..76853) [2133 bp, 710 aa] {ON}...    40   0.048
KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON} simi...    40   0.049
KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa] {O...    40   0.049
TBLA0C01120 Chr3 complement(233451..237911) [4461 bp, 1486 aa] {...    40   0.050
NDAI0G03660 Chr7 complement(881936..883471) [1536 bp, 511 aa] {O...    40   0.050
Suva_10.364 Chr10 complement(637047..639170) [2124 bp, 707 aa] {...    40   0.051
TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON} Anc_8...    40   0.051
ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON} simil...    40   0.055
Kwal_23.4370 s23 complement(689686..691764) [2079 bp, 692 aa] {O...    40   0.056
YDR213W Chr4 (889751..892492) [2742 bp, 913 aa] {ON}  UPC2Sterol...    40   0.056
KLTH0B08580g Chr2 (697066..698970) [1905 bp, 634 aa] {ON} simila...    40   0.057
Suva_8.387 Chr8 (696078..698357) [2280 bp, 759 aa] {ON} YOR337W ...    40   0.057
Kpol_1061.26 s1061 (69833..73657) [3825 bp, 1274 aa] {ON} (69833...    40   0.058
Ecym_2345 Chr2 (676841..678754) [1914 bp, 637 aa] {ON} similar t...    40   0.059
KLLA0A04169g Chr1 complement(376273..378600) [2328 bp, 775 aa] {...    40   0.060
TDEL0G04090 Chr7 complement(744499..746730) [2232 bp, 743 aa] {O...    40   0.060
TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa] ...    40   0.060
KLLA0D11286g Chr4 complement(964642..966678) [2037 bp, 678 aa] {...    40   0.061
ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} simila...    40   0.061
Smik_4.460 Chr4 (833609..836365) [2757 bp, 918 aa] {ON} YDR213W ...    40   0.063
ACL093C Chr3 complement(178239..181271) [3033 bp, 1010 aa] {ON} ...    40   0.063
Suva_2.381 Chr2 (669136..671892) [2757 bp, 918 aa] {ON} YDR213W ...    40   0.063
TPHA0L01060 Chr12 (220857..223778) [2922 bp, 973 aa] {ON} Anc_8....    40   0.065
Skud_4.475 Chr4 (844018..846759) [2742 bp, 913 aa] {ON} YDR213W ...    39   0.067
KLLA0A09251g Chr1 (808253..810319) [2067 bp, 688 aa] {ON} simila...    39   0.068
KLLA0D10197g Chr4 complement(861726..864296) [2571 bp, 856 aa] {...    39   0.069
SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} simila...    39   0.069
Kpol_1061.42 s1061 complement(116430..119819) [3390 bp, 1129 aa]...    39   0.070
Smik_15.67 Chr15 complement(113506..116598) [3093 bp, 1030 aa] {...    39   0.070
SAKL0H25146g Chr8 complement(2185695..2187632) [1938 bp, 645 aa]...    39   0.072
KNAG0J00210 Chr10 (26132..28717) [2586 bp, 861 aa] {ON} Anc_8.87...    39   0.072
Kpol_1009.5 s1009 complement(10170..13706) [3537 bp, 1178 aa] {O...    39   0.077
TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3....    39   0.077
SAKL0H00660g Chr8 complement(78740..81478) [2739 bp, 912 aa] {ON...    39   0.078
TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2....    39   0.079
Kwal_8.580 s8 (13266..15182) [1917 bp, 638 aa] {ON} [contig 311]...    39   0.081
KLTH0F07854g Chr6 complement(677647..680013) [2367 bp, 788 aa] {...    39   0.081
KNAG0M00970 Chr13 (169393..172926) [3534 bp, 1177 aa] {ON} Anc_6...    39   0.086
ZYRO0G21626g Chr7 complement(1781790..1783031) [1242 bp, 413 aa]...    39   0.087
TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON...    39   0.088
CAGL0L04576g Chr12 (528957..531554) [2598 bp, 865 aa] {ON} simil...    39   0.088
Smik_12.289 Chr12 complement(540824..543262) [2439 bp, 812 aa] {...    39   0.088
YLR228C Chr12 complement(600019..602463) [2445 bp, 814 aa] {ON} ...    39   0.088
YLL054C Chr12 complement(32673..35204) [2532 bp, 843 aa] {ON} Pu...    39   0.091
KLTH0A03498g Chr1 complement(301696..303915) [2220 bp, 739 aa] {...    39   0.092
Skud_12.296 Chr12 complement(540407..542851) [2445 bp, 814 aa] {...    39   0.092
Kwal_47.18089 s47 complement(680481..682718) [2238 bp, 745 aa] {...    39   0.094
KLTH0E08778g Chr5 complement(795841..798462) [2622 bp, 873 aa] {...    39   0.095
NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa] {O...    39   0.096
SAKL0G07634g Chr7 (636596..639364) [2769 bp, 922 aa] {ON} some s...    39   0.099
KAFR0D04590 Chr4 (900318..902840) [2523 bp, 840 aa] {ON} Anc_5.3...    39   0.10 
Kpol_455.10 s455 (12074..14566) [2493 bp, 830 aa] {ON} (12074..1...    39   0.10 
YBR033W Chr2 (301944..304703) [2760 bp, 919 aa] {ON}  EDS1Putati...    39   0.10 
Skud_13.43 Chr13 complement(73880..76522) [2643 bp, 880 aa] {ON}...    39   0.10 
CAGL0I02552g Chr9 (227257..230274) [3018 bp, 1005 aa] {ON} weakl...    39   0.10 
AFR171W Chr6 (752589..754427) [1839 bp, 612 aa] {ON} NOHBY629; N...    39   0.11 
CAGL0F02519g Chr6 (245120..247618) [2499 bp, 832 aa] {ON} weakly...    39   0.11 
NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON} Anc_2...    39   0.11 
KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} simila...    39   0.11 
ZYRO0B02574g Chr2 complement(204817..206541) [1725 bp, 574 aa] {...    39   0.11 
KNAG0B02380 Chr2 complement(466392..469595) [3204 bp, 1067 aa] {...    39   0.11 
Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON} YDR03...    39   0.11 
Suva_2.187 Chr2 complement(320833..323187) [2355 bp, 784 aa] {ON...    39   0.11 
KAFR0H01800 Chr8 complement(333664..336048) [2385 bp, 794 aa] {O...    39   0.11 
KAFR0G02540 Chr7 complement(524919..527486) [2568 bp, 855 aa] {O...    39   0.12 
KNAG0F02830 Chr6 (536483..538723) [2241 bp, 746 aa] {ON}               39   0.12 
ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic ho...    39   0.12 
KAFR0A00220 Chr1 complement(42494..45250) [2757 bp, 918 aa] {ON}...    39   0.12 
Suva_13.49 Chr13 complement(75704..78352) [2649 bp, 882 aa] {ON}...    39   0.12 
YCR106W Chr3 (310958..313456) [2499 bp, 832 aa] {ON}  RDS1Putati...    39   0.12 
TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3....    39   0.13 
Ecym_7235 Chr7 (489574..492405) [2832 bp, 943 aa] {ON} similar t...    39   0.13 
KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {...    39   0.13 
TDEL0F02330 Chr6 complement(429974..433234) [3261 bp, 1086 aa] {...    39   0.13 
KNAG0A02290 Chr1 (211626..214028) [2403 bp, 800 aa] {ON}               39   0.13 
KLLA0E19603g Chr5 complement(1739869..1741914) [2046 bp, 681 aa]...    39   0.13 
SAKL0H13024g Chr8 complement(1119585..1121849) [2265 bp, 754 aa]...    39   0.13 
KNAG0M02120 Chr13 (395195..397021) [1827 bp, 608 aa] {ON} Anc_2....    38   0.14 
KAFR0G02520 Chr7 complement(522206..524722) [2517 bp, 838 aa] {O...    39   0.14 
NCAS0E02620 Chr5 complement(523279..526626) [3348 bp, 1115 aa] {...    39   0.14 
KLTH0C10516g Chr3 (871091..872776) [1686 bp, 561 aa] {ON} simila...    38   0.14 
Ecym_3395 Chr3 complement(750356..753481) [3126 bp, 1041 aa] {ON...    39   0.14 
CAGL0L04400g Chr12 complement(513759..516722) [2964 bp, 987 aa] ...    39   0.14 
TDEL0D03610 Chr4 (664819..666993) [2175 bp, 724 aa] {ON} Anc_3.2...    38   0.15 
KLTH0C00814g Chr3 (76637..79141) [2505 bp, 834 aa] {ON} similar ...    38   0.15 
TPHA0G00380 Chr7 complement(65673..68294) [2622 bp, 873 aa] {ON}       38   0.15 
NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56      38   0.15 
KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa] {O...    38   0.15 
ZYRO0D06688g Chr4 (577455..577507,577577..579311) [1788 bp, 595 ...    38   0.16 
SAKL0F11616g Chr6 complement(901066..902841) [1776 bp, 591 aa] {...    38   0.16 
Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981 ...    38   0.16 
CAGL0H01683g Chr8 (162753..164852) [2100 bp, 699 aa] {ON} simila...    38   0.16 
YER184C Chr5 complement(556296..558680) [2385 bp, 794 aa] {ON} P...    38   0.16 
Skud_2.106 Chr2 (200722..203754) [3033 bp, 1010 aa] {ON} YBL005W...    38   0.17 
ZYRO0E00638g Chr5 complement(44716..48036) [3321 bp, 1106 aa] {O...    38   0.17 
KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON} cons...    38   0.17 
TPHA0N01100 Chr14 (231308..232501) [1194 bp, 397 aa] {ON} Anc_6....    38   0.17 
KLTH0C10098g Chr3 complement(836528..838843) [2316 bp, 771 aa] {...    38   0.17 
Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON} (38439....    38   0.18 
Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106...    38   0.18 
Skud_7.627 Chr7 (1048240..1049664) [1425 bp, 474 aa] {ON} YBR297...    38   0.18 
TBLA0G00520 Chr7 (108060..110696) [2637 bp, 878 aa] {ON} Anc_6.6...    38   0.19 
NDAI0F02050 Chr6 complement(503400..504740) [1341 bp, 446 aa] {O...    38   0.19 
TPHA0C02180 Chr3 complement(493972..496632) [2661 bp, 886 aa] {O...    38   0.20 
Sklu_YGOB_gneas1 Chr3 complement(352893..354335) [1443 bp, 480 a...    38   0.20 
Kwal_14.931 s14 complement(119423..122608) [3186 bp, 1061 aa] {O...    38   0.21 
Skud_8.242 Chr8 (430739..432958) [2220 bp, 739 aa] {ON} YHR178W ...    38   0.21 
Kwal_47.17681 s47 complement(513119..515683) [2565 bp, 854 aa] {...    38   0.21 
SAKL0B12518g Chr2 (1072142..1073932) [1791 bp, 596 aa] {ON} cons...    38   0.21 
KLLA0D00484g Chr4 (44879..47893) [3015 bp, 1004 aa] {ON} conserv...    38   0.21 
Suva_2.51 Chr2 complement(93709..97176) [3468 bp, 1155 aa] {ON} ...    38   0.21 
Smik_16.15 Chr16 complement(14421..15812) [1392 bp, 463 aa] {ON}...    37   0.22 
YBL066C Chr2 complement(96669..100115) [3447 bp, 1148 aa] {ON}  ...    38   0.22 
Smik_2.50 Chr2 complement(90559..94011) [3453 bp, 1150 aa] {ON} ...    38   0.22 
NCAS0F00370 Chr6 complement(61819..65148) [3330 bp, 1109 aa] {ON...    38   0.22 
ZYRO0D14080g Chr4 (1191418..1194183) [2766 bp, 921 aa] {ON} weak...    38   0.22 
Kwal_14.1631 s14 (397794..399125) [1332 bp, 443 aa] {ON} YBR240C...    37   0.22 
YOR172W Chr15 (654210..656570) [2361 bp, 786 aa] {ON}  YRM1Zn2-C...    38   0.22 
Kpol_345.3 s345 complement(7411..11517) [4107 bp, 1368 aa] {ON} ...    38   0.22 
KLTH0D07898g Chr4 (672516..674534) [2019 bp, 672 aa] {ON} weakly...    38   0.22 
CAGL0C01199g Chr3 complement(121944..124712) [2769 bp, 922 aa] {...    38   0.23 
Skud_2.39 Chr2 complement(80293..83772) [3480 bp, 1159 aa] {ON} ...    38   0.23 
Ecym_4286 Chr4 (613587..615470) [1884 bp, 627 aa] {ON} similar t...    38   0.23 
NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa] {O...    38   0.24 
YLR266C Chr12 complement(675619..677724) [2106 bp, 701 aa] {ON} ...    38   0.24 
Suva_8.216 Chr8 complement(389549..391894) [2346 bp, 781 aa] {ON...    38   0.25 
Smik_15.350 Chr15 (610312..612666) [2355 bp, 784 aa] {ON} YOR172...    37   0.25 
AGL099C Chr7 complement(516587..518830) [2244 bp, 747 aa] {ON} S...    37   0.25 
Kwal_47.17233 s47 (309658..312504) [2847 bp, 948 aa] {ON} [conti...    38   0.25 
SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]...    37   0.25 
TPHA0K01100 Chr11 (228134..231619) [3486 bp, 1161 aa] {ON} Anc_6...    38   0.26 
TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.6...    37   0.26 
Kpol_1031.47 s1031 (125242..127926) [2685 bp, 894 aa] {ON} (1252...    37   0.26 
KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} simila...    37   0.26 
ZYRO0G00374g Chr7 complement(28649..30553) [1905 bp, 634 aa] {ON...    37   0.27 
AER291C Chr5 complement(1172383..1174374) [1992 bp, 663 aa] {ON}...    37   0.27 
CAGL0G09757g Chr7 (930351..934622) [4272 bp, 1423 aa] {ON} some ...    37   0.27 
Kpol_529.15 s529 complement(38664..41510) [2847 bp, 948 aa] {ON}...    37   0.27 
Smik_25.2 Chr25 (2105..4462) [2358 bp, 785 aa] {ON} YER184C (REAL)     37   0.28 
KLLA0E18195g Chr5 complement(1622300..1625701) [3402 bp, 1133 aa...    37   0.28 
Suva_2.121 Chr2 (211466..214381) [2916 bp, 971 aa] {ON} YBL005W ...    37   0.29 
Skud_15.334 Chr15 (602966..605338) [2373 bp, 790 aa] {ON} YOR172...    37   0.29 
KAFR0E02410 Chr5 (489279..491354) [2076 bp, 691 aa] {ON} Anc_7.5...    37   0.29 
KLTH0C00880g Chr3 complement(85841..89098) [3258 bp, 1085 aa] {O...    37   0.30 
KLTH0H00968g Chr8 (103482..105353) [1872 bp, 623 aa] {ON} simila...    37   0.31 
NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON} Anc_7...    37   0.31 
NCAS0A10550 Chr1 (2100725..2102950) [2226 bp, 741 aa] {ON} Anc_3...    37   0.31 
TDEL0B06360 Chr2 complement(1127150..1130095) [2946 bp, 981 aa] ...    37   0.31 
KLTH0E06666g Chr5 (611348..614188) [2841 bp, 946 aa] {ON} conser...    37   0.31 
Skud_12.346 Chr12 complement(616734..618818) [2085 bp, 694 aa] {...    37   0.32 
TDEL0F05470 Chr6 (1017743..1020175) [2433 bp, 810 aa] {ON} Anc_8...    37   0.32 
Smik_13.36 Chr13 complement(71547..74189) [2643 bp, 880 aa] {ON}...    37   0.33 
KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON} simi...    37   0.33 
NCAS0H01240 Chr8 (235885..237312) [1428 bp, 475 aa] {ON} Anc_6.154     37   0.33 
CAGL0H01507g Chr8 complement(147689..150073) [2385 bp, 794 aa] {...    37   0.34 
NDAI0C03450 Chr3 (789514..791844) [2331 bp, 776 aa] {ON} Anc_5.59      37   0.34 
KLLA0C04620g Chr3 complement(422705..426514) [3810 bp, 1269 aa] ...    37   0.35 
Skud_4.287 Chr4 complement(501344..503698) [2355 bp, 784 aa] {ON...    37   0.35 
ZYRO0C18282g Chr3 (1431515..1433665) [2151 bp, 716 aa] {ON} cons...    37   0.36 
NCAS0F00310 Chr6 (49514..52084) [2571 bp, 856 aa] {ON}                 37   0.36 
TDEL0E00300 Chr5 (64461..66374) [1914 bp, 637 aa] {ON}                 37   0.36 
TDEL0G04100 Chr7 complement(746975..749074) [2100 bp, 699 aa] {O...    37   0.37 
Ecym_6141 Chr6 complement(258221..258565) [345 bp, 114 aa] {ON} ...    35   0.37 
KLTH0E00440g Chr5 complement(42945..45011) [2067 bp, 688 aa] {ON...    37   0.37 
KLTH0B10076g Chr2 (841024..843090) [2067 bp, 688 aa] {ON} some s...    37   0.37 
Kpol_2001.16 s2001 (44110..46518) [2409 bp, 802 aa] {ON} (44110....    37   0.37 
TPHA0F02630 Chr6 complement(583511..587299) [3789 bp, 1262 aa] {...    37   0.38 
NDAI0B01680 Chr2 (398598..401372) [2775 bp, 924 aa] {ON} Anc_2.547     37   0.38 
CAGL0H06875g Chr8 complement(682518..684626) [2109 bp, 702 aa] {...    37   0.39 
Kpol_1061.37 s1061 complement(102667..104616) [1950 bp, 649 aa] ...    37   0.39 
Ecym_4144 Chr4 complement(306206..308728) [2523 bp, 840 aa] {ON}...    37   0.41 
Ecym_7239 Chr7 (501580..504774) [3195 bp, 1064 aa] {ON} similar ...    37   0.41 
TBLA0C03390 Chr3 complement(814708..818028) [3321 bp, 1106 aa] {...    37   0.42 
YBL005W Chr2 (217470..220400) [2931 bp, 976 aa] {ON}  PDR3Transc...    37   0.45 
Kwal_56.24670 s56 complement(1099601..1101532) [1932 bp, 643 aa]...    37   0.45 
TDEL0G00830 Chr7 complement(170169..172229) [2061 bp, 686 aa] {O...    37   0.45 
ZYRO0A09350g Chr1 (749695..752076) [2382 bp, 793 aa] {ON} simila...    37   0.46 
ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar ...    37   0.46 
SAKL0A06072g Chr1 (551181..552518) [1338 bp, 445 aa] {ON} simila...    37   0.47 
ZYRO0D14058g Chr4 (1188615..1190891) [2277 bp, 758 aa] {ON} simi...    37   0.48 
Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {O...    37   0.49 
Skud_16.500 Chr16 (874371..876485) [2115 bp, 704 aa] {ON} YKL222...    37   0.51 
Ecym_5183 Chr5 complement(385669..388101) [2433 bp, 810 aa] {ON}...    37   0.52 
KLTH0H05720g Chr8 (505672..507006) [1335 bp, 444 aa] {ON} simila...    36   0.52 
ACL096W Chr3 (169508..172015) [2508 bp, 835 aa] {ON} Syntenic ho...    37   0.53 
KLTH0C06776g Chr3 complement(586976..590140) [3165 bp, 1054 aa] ...    37   0.54 
TBLA0C02060 Chr3 (486966..489920) [2955 bp, 984 aa] {ON} Anc_1.1...    37   0.54 
TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa] ...    37   0.54 
KLTH0G13200g Chr7 (1133333..1133382,1133450..1135100) [1701 bp, ...    36   0.54 
SAKL0C05918g Chr3 complement(558911..561538) [2628 bp, 875 aa] {...    37   0.55 
AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic ...    37   0.56 
NDAI0I01940 Chr9 (450330..454112) [3783 bp, 1260 aa] {ON} Anc_6.75     37   0.56 
TDEL0C01880 Chr3 (332932..334554) [1623 bp, 540 aa] {ON} Anc_7.3...    36   0.57 
KLTH0D01804g Chr4 complement(173650..175608) [1959 bp, 652 aa] {...    36   0.58 
YOR337W Chr15 (954344..956623) [2280 bp, 759 aa] {ON}  TEA1Ty1 e...    36   0.59 
Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985 ...    36   0.59 
SAKL0G19404g Chr7 (1667193..1670582) [3390 bp, 1129 aa] {ON} sim...    36   0.60 
Smik_8.262 Chr8 (436380..438584) [2205 bp, 734 aa] {ON} YHR178W ...    36   0.60 
NCAS0A03570 Chr1 complement(708718..711654) [2937 bp, 978 aa] {O...    36   0.60 
AGL083W Chr7 (550291..552861) [2571 bp, 856 aa] {ON} Syntenic ho...    36   0.62 
KAFR0A04940 Chr1 (975356..978913) [3558 bp, 1185 aa] {ON} Anc_6....    36   0.62 
NDAI0K02840 Chr11 (640461..643634) [3174 bp, 1057 aa] {ON} Anc_6...    36   0.62 
KLTH0A00484g Chr1 (42443..44149) [1707 bp, 568 aa] {ON} conserve...    36   0.62 
KLTH0E00176g Chr5 (8605..10311) [1707 bp, 568 aa] {ON} conserved...    36   0.63 
Kwal_55.20722 s55 (530982..533465) [2484 bp, 827 aa] {ON} YCR106...    36   0.66 
YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative m...    36   0.67 
NDAI0D02730 Chr4 (629970..633647) [3678 bp, 1225 aa] {ON} Anc_6....    36   0.69 
CAGL0L09383g Chr12 (1020856..1021956) [1101 bp, 366 aa] {ON} som...    36   0.69 
ZYRO0C11880g Chr3 (929030..930943) [1914 bp, 637 aa] {ON} simila...    36   0.71 
CAGL0K11902g Chr11 complement(1149210..1151705) [2496 bp, 831 aa...    36   0.71 
Ecym_3001 Chr3 (1150..3042) [1893 bp, 630 aa] {ON} similar to As...    36   0.71 
TPHA0C02220 Chr3 (504550..506658) [2109 bp, 702 aa] {ON} Anc_8.4...    36   0.72 
Kwal_26.6664 s26 complement(11094..12833) [1740 bp, 579 aa] {ON}...    36   0.72 
ZYRO0D14432g Chr4 complement(1222977..1226489) [3513 bp, 1170 aa...    36   0.74 
Skud_15.502 Chr15 (894741..897020) [2280 bp, 759 aa] {ON} YOR337...    36   0.74 
NCAS0F01070 Chr6 (211085..213799) [2715 bp, 904 aa] {ON} Anc_5.5...    36   0.75 
YHR178W Chr8 (459299..461530) [2232 bp, 743 aa] {ON}  STB5Transc...    36   0.76 
SAKL0C03960g Chr3 (380387..383488) [3102 bp, 1033 aa] {ON} conse...    36   0.77 
Skud_7.646 Chr7 (1073386..1074795) [1410 bp, 469 aa] {ON} YPR196...    36   0.78 
KNAG0M00620 Chr13 (99320..100699) [1380 bp, 459 aa] {ON} Anc_6.1...    36   0.78 
NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56      36   0.79 
TBLA0A00300 Chr1 complement(48459..50714) [2256 bp, 751 aa] {ON}       36   0.79 
Smik_15.515 Chr15 (903950..906229) [2280 bp, 759 aa] {ON} YOR337...    36   0.80 
Suva_15.425 Chr15 (750153..752087) [1935 bp, 644 aa] {ON} YLR098...    36   0.81 
AGR061C Chr7 complement(831052..832890) [1839 bp, 612 aa] {ON} S...    36   0.81 
TBLA0I01890 Chr9 complement(423851..426328) [2478 bp, 825 aa] {O...    36   0.82 
Suva_8.225 Chr8 (404288..406693) [2406 bp, 801 aa] {ON} YOR172W ...    36   0.82 
KLTH0A06644g Chr1 complement(553084..555270) [2187 bp, 728 aa] {...    36   0.85 
ZYRO0G17512g Chr7 complement(1447970..1449541) [1572 bp, 523 aa]...    36   0.85 
KLLA0F02299g Chr6 (205549..208167) [2619 bp, 872 aa] {ON} conser...    36   0.89 
ADR199C Chr4 complement(1048528..1051362) [2835 bp, 944 aa] {ON}...    36   0.89 
TDEL0H00790 Chr8 complement(132519..135002) [2484 bp, 827 aa] {O...    36   0.90 
KLTH0E07854g Chr5 (719642..722458) [2817 bp, 938 aa] {ON} weakly...    36   0.94 
Ecym_4635 Chr4 complement(1238691..1241261) [2571 bp, 856 aa] {O...    36   0.96 
KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON} simi...    35   0.97 
TPHA0M00150 Chr13 (29607..31919) [2313 bp, 770 aa] {ON}                35   0.97 
KAFR0G03520 Chr7 complement(728360..729694) [1335 bp, 444 aa] {O...    35   0.98 
Suva_2.374 Chr2 complement(656129..658624) [2496 bp, 831 aa] {ON...    35   0.99 
TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa] ...    35   0.99 
KLLA0A03091g Chr1 (276333..277484) [1152 bp, 383 aa] {ON} some s...    35   1.0  
Smik_4.68 Chr4 (133172..134758) [1587 bp, 528 aa] {ON} YDL170W (...    35   1.0  
KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa] {O...    35   1.0  
KLTH0F03014g Chr6 (260568..262406) [1839 bp, 612 aa] {ON} simila...    35   1.0  
AGR280C Chr7 complement(1266912..1270232) [3321 bp, 1106 aa] {ON...    35   1.0  
Smik_26.8 Chr26 (8892..9242) [351 bp, 117 aa] {ON} YER184C (REAL)      33   1.0  
YDR207C Chr4 complement(865012..867522) [2511 bp, 836 aa] {ON}  ...    35   1.1  
AGL091W Chr7 (535317..537917) [2601 bp, 866 aa] {ON} Syntenic ho...    35   1.1  
NCAS0D02960 Chr4 complement(563406..566924) [3519 bp, 1172 aa] {...    35   1.1  
KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3....    35   1.1  
NDAI0C04790 Chr3 complement(1100952..1104053) [3102 bp, 1033 aa]...    35   1.1  
Ecym_4153 Chr4 complement(330831..333281) [2451 bp, 816 aa] {ON}...    35   1.1  
Smik_2.115 Chr2 (210321..213236) [2916 bp, 971 aa] {ON} YBL005W ...    35   1.1  
ADR365W Chr4 (1355407..1357512) [2106 bp, 701 aa] {ON} Syntenic ...    35   1.2  
KNAG0H00250 Chr8 (37360..40050) [2691 bp, 896 aa] {ON} Anc_2.654...    35   1.2  
Kwal_56.23308 s56 complement(485779..487092) [1314 bp, 438 aa] {...    35   1.2  
AFR722C Chr6 complement(1765861..1768293) [2433 bp, 810 aa] {ON}...    35   1.3  
SAKL0D02596g Chr4 (204347..206599) [2253 bp, 750 aa] {ON} conser...    35   1.3  
KNAG0A04550 Chr1 (642548..645208) [2661 bp, 886 aa] {ON} Anc_8.4...    35   1.3  
KLLA0F20680g Chr6 (1924148..1926511) [2364 bp, 787 aa] {ON} weak...    35   1.3  
TPHA0E00880 Chr5 complement(177030..180164) [3135 bp, 1044 aa] {...    35   1.3  
ABR174W Chr2 (728570..731164) [2595 bp, 864 aa] {ON} Syntenic ho...    35   1.3  
Kwal_56.24566 s56 (1057546..1059813) [2268 bp, 755 aa] {ON} [con...    35   1.3  
NCAS0B08200 Chr2 (1561174..1563801) [2628 bp, 875 aa] {ON} Anc_1...    35   1.4  
Ecym_5131 Chr5 (278980..281292) [2313 bp, 770 aa] {ON} similar t...    35   1.4  
Kpol_534.28 s534 (64772..66079) [1308 bp, 435 aa] {ON} (64772..6...    35   1.4  
TBLA0A07010 Chr1 (1713923..1716046) [2124 bp, 707 aa] {ON}             35   1.5  
Suva_15.378 Chr15 (665572..667815) [2244 bp, 747 aa] {ON} YHR178...    35   1.5  
TBLA0H03910 Chr8 complement(943931..946234) [2304 bp, 767 aa] {O...    35   1.5  
Suva_15.3 Chr15 complement(4971..6152) [1182 bp, 393 aa] {ON} YK...    35   1.5  
ACR241C Chr3 complement(784358..786745) [2388 bp, 795 aa] {ON} S...    35   1.5  
CAGL0I04246g Chr9 (377568..378641) [1074 bp, 357 aa] {ON} weakly...    35   1.5  
Ecym_3112 Chr3 (203876..207310) [3435 bp, 1144 aa] {ON} similar ...    35   1.6  
TPHA0E01290 Chr5 (258004..260562) [2559 bp, 852 aa] {ON} Anc_5.3...    35   1.6  
SAKL0A01386g Chr1 (132287..134599) [2313 bp, 770 aa] {ON} conser...    35   1.6  
NDAI0F04500 Chr6 complement(1093752..1096181) [2430 bp, 809 aa] ...    35   1.7  
Kwal_55.20674 s55 complement(515392..516147) [756 bp, 252 aa] {O...    34   1.7  
SAKL0A08074g Chr1 (711985..715425) [3441 bp, 1146 aa] {ON} simil...    35   1.7  
Kpol_1042.7 s1042 (12882..15233) [2352 bp, 783 aa] {ON} (12882.....    35   1.7  
NCAS0D02720 Chr4 complement(520916..523189) [2274 bp, 757 aa] {O...    35   1.7  
AGL348W Chr7 (56615..58804) [2190 bp, 729 aa] {ON} NOHBY723; No ...    35   1.8  
Kwal_27.10852 s27 complement(526456..529596) [3141 bp, 1046 aa] ...    35   1.8  
Kwal_14.915 s14 (110216..112684) [2469 bp, 822 aa] {ON} YKL015W ...    35   1.8  
SAKL0G02992g Chr7 (243859..247044) [3186 bp, 1061 aa] {ON} conse...    35   1.9  
NCAS0D01290 Chr4 complement(233978..236194) [2217 bp, 738 aa] {O...    35   1.9  
AGR369W Chr7 (1412833..1415988) [3156 bp, 1051 aa] {ON} Syntenic...    35   1.9  
KLLA0F02387g Chr6 complement(213669..215852) [2184 bp, 727 aa] {...    35   1.9  
KLTH0G15180g Chr7 (1326581..1329871) [3291 bp, 1096 aa] {ON} sim...    35   1.9  
TDEL0B04000 Chr2 (715716..716981) [1266 bp, 421 aa] {ON} Anc_6.1...    34   2.0  
KNAG0E00780 Chr5 (140071..142353) [2283 bp, 760 aa] {ON} Anc_5.5...    35   2.1  
TBLA0B07050 Chr2 (1669768..1671996) [2229 bp, 742 aa] {ON}             35   2.1  
Smik_4.453 Chr4 complement(820614..823172) [2559 bp, 852 aa] {ON...    35   2.2  
Ecym_5001 Chr5 (915..2738) [1824 bp, 607 aa] {ON} similar to Ash...    34   2.2  
KLTH0E03256g Chr5 complement(294997..297021) [2025 bp, 674 aa] {...    34   2.3  
Skud_14.399 Chr14 (715444..717267) [1824 bp, 607 aa] {ON} YNR063...    34   2.4  
NDAI0A06990 Chr1 (1593540..1596476) [2937 bp, 978 aa] {ON} Anc_3...    34   2.4  
Kwal_14.819 s14 complement(63184..64890) [1707 bp, 568 aa] {ON} ...    34   2.4  
TPHA0L02050 Chr12 complement(423921..426563) [2643 bp, 880 aa] {...    34   2.6  
SAKL0F00418g Chr6 (34751..36430) [1680 bp, 559 aa] {ON} conserve...    34   2.6  
Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421...    34   2.7  
NCAS0C01530 Chr3 (281676..282899) [1224 bp, 407 aa] {ON} Anc_8.642     34   2.8  
Ecym_5662 Chr5 complement(1338979..1341174) [2196 bp, 731 aa] {O...    34   2.9  
TDEL0H03950 Chr8 (674423..676411) [1989 bp, 662 aa] {ON} Anc_7.5...    34   3.0  
SAKL0F12342g Chr6 (964262..967393) [3132 bp, 1043 aa] {ON} simil...    34   3.0  
Skud_20.3 Chr20 (4504..5916) [1413 bp, 470 aa] {ON} YBR297W (REAL)     34   3.1  
KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa] ...    34   3.1  
TBLA0F03550 Chr6 complement(875734..876630) [897 bp, 298 aa] {ON...    33   3.3  
AFL033W Chr6 (373485..374633) [1149 bp, 382 aa] {ON} Syntenic ho...    33   3.4  
Suva_2.701 Chr2 complement(1233963..1236344) [2382 bp, 793 aa] {...    34   3.6  
Smik_12.341 Chr12 complement(613817..615922) [2106 bp, 701 aa] {...    34   3.6  
TBLA0E01110 Chr5 (243534..246755) [3222 bp, 1073 aa] {ON} Anc_6....    34   3.6  
KLTH0F03300g Chr6 complement(283918..285474) [1557 bp, 518 aa] {...    33   3.7  
TDEL0C05790 Chr3 (1045249..1047057) [1809 bp, 602 aa] {ON}             33   3.9  
YNR063W Chr14 (746943..748766) [1824 bp, 607 aa] {ON} Putative z...    33   3.9  
TDEL0D06620 Chr4 (1197405..1199084) [1680 bp, 559 aa] {ON}             33   4.1  
KLTH0E06116g Chr5 complement(553784..556297) [2514 bp, 837 aa] {...    33   4.2  
Smik_23.3 Chr23 complement(4675..6111) [1437 bp, 478 aa] {ON} YB...    33   4.4  
KLLA0E20307g Chr5 (1806005..1809364) [3360 bp, 1119 aa] {ON} uni...    33   4.5  
KAFR0C03230 Chr3 complement(655300..656520) [1221 bp, 406 aa] {O...    33   4.7  
SAKL0H13266g Chr8 (1138536..1140362) [1827 bp, 608 aa] {ON} some...    33   4.8  
Ecym_4686 Chr4 complement(1336279..1339581) [3303 bp, 1100 aa] {...    33   4.8  
TDEL0G04920 Chr7 complement(912754..914844) [2091 bp, 696 aa] {O...    33   5.0  
KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly...    33   5.2  
Kpol_1061.19 s1061 (51386..54709) [3324 bp, 1107 aa] {ON} (51386...    33   5.5  
KNAG0D02330 Chr4 complement(407687..408490) [804 bp, 267 aa] {ON...    33   5.5  
KLTH0F05258g Chr6 complement(462417..464825) [2409 bp, 802 aa] {...    33   5.6  
NDAI0E04190 Chr5 complement(944753..948466) [3714 bp, 1237 aa] {...    33   5.8  
TBLA0H00720 Chr8 (157413..159269) [1857 bp, 618 aa] {ON} Anc_8.4...    33   6.0  
Skud_4.469 Chr4 complement(831562..834189) [2628 bp, 875 aa] {ON...    33   6.5  
TDEL0B06970 Chr2 complement(1232117..1233133) [1017 bp, 338 aa] ...    32   8.3  
TPHA0C04280 Chr3 complement(922743..926132) [3390 bp, 1129 aa] {...    33   8.3  
NDAI0A01040 Chr1 complement(220931..223918) [2988 bp, 995 aa] {O...    32   8.9  

>ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa]
            {ON} similar to uniprot|Q75DZ4 Ashbya gossypii ABL121C
            ABL121Cp and similar to YMR280C uniprot|P39113
            Saccharomyces cerevisiae YMR280C CAT8 Zinc cluster
            transcriptional activator
          Length = 1250

 Score = 2056 bits (5328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1030/1250 (82%), Positives = 1030/1250 (82%)

Query: 1    MKDDADTRESNGSTRVPTTGAMQGPRYIRTXXXXXXXXXXXXXXXXXXXXPPYEQDDDSK 60
            MKDDADTRESNGSTRVPTTGAMQGPRYIRT                    PPYEQDDDSK
Sbjct: 1    MKDDADTRESNGSTRVPTTGAMQGPRYIRTLGSQSLGGLAGSNSSRSSTSPPYEQDDDSK 60

Query: 61   ESSSVPQSASMTGSSSQNAQREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQ 120
            ESSSVPQSASMTGSSSQNAQREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQ
Sbjct: 61   ESSSVPQSASMTGSSSQNAQREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQ 120

Query: 121  CSQCAAVGFECKISDRLSRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDIKEQQIHLFSQ 180
            CSQCAAVGFECKISDRLSRRAFPRGY                     CDIKEQQIHLFSQ
Sbjct: 121  CSQCAAVGFECKISDRLSRRAFPRGYTETLEERVRELEAENRRLVALCDIKEQQIHLFSQ 180

Query: 181  QHSPGGRRKDDERMLRELQSANGGSLNISSTNLYLLNTGSHXXXXXXXXXXXXXXXXXXX 240
            QHSPGGRRKDDERMLRELQSANGGSLNISSTNLYLLNTGSH                   
Sbjct: 181  QHSPGGRRKDDERMLRELQSANGGSLNISSTNLYLLNTGSHQRQGPQGPQQQEQLTQQKR 240

Query: 241  XPHVCDGLCCAGKLHVKPVSTNLNDPTSVSFEQSEAPGLPAVQALTSVATREQSNQLATL 300
             PHVCDGLCCAGKLHVKPVSTNLNDPTSVSFEQSEAPGLPAVQALTSVATREQSNQLATL
Sbjct: 241  QPHVCDGLCCAGKLHVKPVSTNLNDPTSVSFEQSEAPGLPAVQALTSVATREQSNQLATL 300

Query: 301  VALSVPRSTEEILFIPQLLARIRQIYGFTSKQCLYTVXXXXXXXXXXPEPHLVKHEPLET 360
            VALSVPRSTEEILFIPQLLARIRQIYGFTSKQCLYTV          PEPHLVKHEPLET
Sbjct: 301  VALSVPRSTEEILFIPQLLARIRQIYGFTSKQCLYTVSLLSSLKSSLPEPHLVKHEPLET 360

Query: 361  LASTNLWEMDDLEQFFAEIFKFKLESKSPSSYKGGAQLNXXXXXXXXXXXXXXXXXXXPI 420
            LASTNLWEMDDLEQFFAEIFKFKLESKSPSSYKGGAQLN                   PI
Sbjct: 361  LASTNLWEMDDLEQFFAEIFKFKLESKSPSSYKGGAQLNLSEIEELISIFFEHSSIHIPI 420

Query: 421  LVKDEFYHYFNQFKENVLQNLEFLKTPLQGPALTARRGKIISYKIFGCIILMLCQLGLLS 480
            LVKDEFYHYFNQFKENVLQNLEFLKTPLQGPALTARRGKIISYKIFGCIILMLCQLGLLS
Sbjct: 421  LVKDEFYHYFNQFKENVLQNLEFLKTPLQGPALTARRGKIISYKIFGCIILMLCQLGLLS 480

Query: 481  KIKAENLGATSKHHRLASYYHKAISLVYMNPYFGXXXXXXXXXXXXXXXXXXXXNIGNVS 540
            KIKAENLGATSKHHRLASYYHKAISLVYMNPYFG                    NIGNVS
Sbjct: 481  KIKAENLGATSKHHRLASYYHKAISLVYMNPYFGVLSTSLQSLQFLSLVLFYFLNIGNVS 540

Query: 541  AIYELRGRVVSMAQQLRLHRCPSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSALQLG 600
            AIYELRGRVVSMAQQLRLHRCPSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSALQLG
Sbjct: 541  AIYELRGRVVSMAQQLRLHRCPSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSALQLG 600

Query: 601  VPRLIKDFEIECALPVADNDDRTVNLAGQQIRLEGQVTNYSLAIIRFSKVLGNILDSIFK 660
            VPRLIKDFEIECALPVADNDDRTVNLAGQQIRLEGQVTNYSLAIIRFSKVLGNILDSIFK
Sbjct: 601  VPRLIKDFEIECALPVADNDDRTVNLAGQQIRLEGQVTNYSLAIIRFSKVLGNILDSIFK 660

Query: 661  RGMTESITKQVSLIHENALDNWRHGLPKELIFELDVNGTINIDEFNRLKQMNVTVERSEN 720
            RGMTESITKQVSLIHENALDNWRHGLPKELIFELDVNGTINIDEFNRLKQMNVTVERSEN
Sbjct: 661  RGMTESITKQVSLIHENALDNWRHGLPKELIFELDVNGTINIDEFNRLKQMNVTVERSEN 720

Query: 721  MTLLVMYFLAKCMIHLPVVATRPLPTNDSNDTGETSNATSNGNNVRARDPSTERNQAAAD 780
            MTLLVMYFLAKCMIHLPVVATRPLPTNDSNDTGETSNATSNGNNVRARDPSTERNQAAAD
Sbjct: 721  MTLLVMYFLAKCMIHLPVVATRPLPTNDSNDTGETSNATSNGNNVRARDPSTERNQAAAD 780

Query: 781  RSSSSYVLLQQATNTMLNVLESLKTLFLPLPLNISRTKARFALLSARGSLEYTKGGALFL 840
            RSSSSYVLLQQATNTMLNVLESLKTLFLPLPLNISRTKARFALLSARGSLEYTKGGALFL
Sbjct: 781  RSSSSYVLLQQATNTMLNVLESLKTLFLPLPLNISRTKARFALLSARGSLEYTKGGALFL 840

Query: 841  DNKSLLLDVIKDLEEDRKLDLPGVISWNSLKLLDMSINLLLQPPNTEVGXXXXXXXXXXX 900
            DNKSLLLDVIKDLEEDRKLDLPGVISWNSLKLLDMSINLLLQPPNTEVG           
Sbjct: 841  DNKSLLLDVIKDLEEDRKLDLPGVISWNSLKLLDMSINLLLQPPNTEVGKLDRLLKKKLN 900

Query: 901  XXXXXMGRPTVKQEPASKGHDLTPASSKDEEDTPAAKRIKIEETSIPLXXXXXXXXXXXX 960
                 MGRPTVKQEPASKGHDLTPASSKDEEDTPAAKRIKIEETSIPL            
Sbjct: 901  YYNRLMGRPTVKQEPASKGHDLTPASSKDEEDTPAAKRIKIEETSIPLAVPQQQQHMQAP 960

Query: 961  XXXXVQEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXTAFAEALQLDPVLNSNVSFQNAPP 1020
                VQEK                            TAFAEALQLDPVLNSNVSFQNAPP
Sbjct: 961  APVMVQEKQQPQPQPQPQPQPQPQLQPQPQQLQLPQTAFAEALQLDPVLNSNVSFQNAPP 1020

Query: 1021 TTLYDGPHDQPHQYQHHAQTQPQDPHLDTRSSDKLHGLFKVPSTADFLMDDSANSQLNFL 1080
            TTLYDGPHDQPHQYQHHAQTQPQDPHLDTRSSDKLHGLFKVPSTADFLMDDSANSQLNFL
Sbjct: 1021 TTLYDGPHDQPHQYQHHAQTQPQDPHLDTRSSDKLHGLFKVPSTADFLMDDSANSQLNFL 1080

Query: 1081 LGTTELGVLDPSQPSYTNNPGSGSAIGINNMPSGLNLSNLFDLEGSTDXXXXXXXXXXXX 1140
            LGTTELGVLDPSQPSYTNNPGSGSAIGINNMPSGLNLSNLFDLEGSTD            
Sbjct: 1081 LGTTELGVLDPSQPSYTNNPGSGSAIGINNMPSGLNLSNLFDLEGSTDQPPTNTNATQAT 1140

Query: 1141 XXXSGGFNFAVDASLGLAPLLAWTPDHNGIVLDVVEDEXXXXXXXXXXXXXXXXXXXXXD 1200
               SGGFNFAVDASLGLAPLLAWTPDHNGIVLDVVEDE                     D
Sbjct: 1141 QANSGGFNFAVDASLGLAPLLAWTPDHNGIVLDVVEDEEGSNLQQGQQSQEQNQQQHQLD 1200

Query: 1201 HNLMQPHMDMDVDIDQDLSIXXXXXXXXXXXXXXKHEENLHDLFCWQNSK 1250
            HNLMQPHMDMDVDIDQDLSI              KHEENLHDLFCWQNSK
Sbjct: 1201 HNLMQPHMDMDVDIDQDLSIRRRPDRSRGRGRPRKHEENLHDLFCWQNSK 1250

>TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.845
            YMR280C
          Length = 1301

 Score = 1061 bits (2745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 610/1233 (49%), Positives = 736/1233 (59%), Gaps = 125/1233 (10%)

Query: 24   GPRYIRTXXXXXXX-----XXXXXXXXXXXXXPPYEQDDDSKESSSVPQSAS---MTGSS 75
            GP+YIRT                         P    DD+  E     +  S   + G+ 
Sbjct: 10   GPKYIRTMGSQSLSGLNPLSSGGSSQVSISHSPSVLLDDNGSEDVRSAKRKSPSLLAGTP 69

Query: 76   SQ----NAQREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
            SQ    N +     + +  + A + NLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC
Sbjct: 70   SQRPRLNTEVSEVASYTSVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129

Query: 132  KISDRLSRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDIKEQQIHLFSQQHSPGGRRK-- 189
            +ISD+LSRRAFPRGY                     CDIKEQQIHL S  H P  ++K  
Sbjct: 130  RISDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDIKEQQIHLVS--HFPTNKKKIG 187

Query: 190  -DDERMLRELQSANGGSLNISSTNLYLLNT---GSHXXXXXXXXXXXXXXXXXXXXPHVC 245
             +DE+ML+EL  AN G L ISSTNL+LLN    G                       H C
Sbjct: 188  GNDEQMLQELTGANNGRLRISSTNLFLLNKARDGKQPATISNGDDHMTKPDHEHTGKHRC 247

Query: 246  DGLCCAGKLHVKPVSTNLNDPTSVSFEQSEAPGLPAVQALTSVATREQSNQLATLVALSV 305
            D L C  KLH KPVSTNLNDPT++SFEQ+EAPGLPAV+ALTS+ATREQS QLATLVALSV
Sbjct: 248  DELDCNNKLHSKPVSTNLNDPTAISFEQNEAPGLPAVKALTSMATREQSTQLATLVALSV 307

Query: 306  PRSTEEILFIPQLLARIRQIYGFTSKQCLYTVXXXXXXXXXXPEPHLVKHEPLETLASTN 365
            PRSTEEILFIPQLLARI QI+GFTSKQCLY+V          P P LVK + L+ L +TN
Sbjct: 308  PRSTEEILFIPQLLARIIQIHGFTSKQCLYSVSLLASLKNNLPGPQLVKWDELDYLKTTN 367

Query: 366  LWEMDDLEQFFAEIFKFKLESKSPSSYKGGAQLNXXXXXXXXXXXXXXXXXXXPILVKDE 425
            LWE+D+L++FF E  KF +     S       L+                   PIL K+E
Sbjct: 368  LWEVDNLDKFFHETLKFNILRPGVSDDGESLGLSIKEIDELVNLFFDSWAVHIPILDKEE 427

Query: 426  FYHYFNQFKENVLQNLEFLKTPLQGPALTARRGKIISYKIFGCIILMLCQLGLLSKIKAE 485
            F+ Y+++ K+++       +   +GP+  ARR KIISYKIF CI+  +CQ+GLL+K+K E
Sbjct: 428  FFSYYDKLKKDISTQPGLFQ---EGPSNFARRNKIISYKIFACILFTVCQMGLLTKVKGE 484

Query: 486  NL-GATSKHHRLASYYHKAISLVYMNPYFGXXXXXXXXXXXXXXXXXXXXNIGNVSAIYE 544
             +  A S + +L SYYH+AISL+Y+NPYFG                    N GNVSAIYE
Sbjct: 485  KITSADSPYVKLTSYYHRAISLIYLNPYFGVLTTSLQSLQFLSLLLFYFVNTGNVSAIYE 544

Query: 545  LRGRVVSMAQQLRLHRCPSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRL 604
            LRGRVVSMAQQLRLHRCPSAVLGG+GSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRL
Sbjct: 545  LRGRVVSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRL 604

Query: 605  IKDFEIECALPVADNDDRTVNLAGQQIRLEGQVTNYSLAIIRFSKVLGNILDSIFKRGMT 664
            IKDFEIECALPVA+NDDR V+LAGQ IRLEG+V+ +SLAIIRF+KVLGNILD++FKRGMT
Sbjct: 605  IKDFEIECALPVAENDDREVSLAGQMIRLEGRVSQFSLAIIRFAKVLGNILDTVFKRGMT 664

Query: 665  ESITKQVSLIHENALDNWRHGLPKELIFELDVNGTINIDEFNRLKQMNVTVERSENMTLL 724
            ES++K+++LIHENALDNWR GLP ELIFE++VNGTIN+D+FN +KQ N TVE  E M LL
Sbjct: 665  ESVSKKLALIHENALDNWRRGLPAELIFEIEVNGTINMDKFNEMKQNNATVENVEQMVLL 724

Query: 725  VMYFLAKCMIHLPVVATRPLPTNDSNDTGETSNATSNGNNVRARDPSTERNQAA--ADRS 782
            V YFLAKCMIHLPVVATRPLP++D  ++           +++  +   ++N  +  A RS
Sbjct: 725  VSYFLAKCMIHLPVVATRPLPSSDDPNS-----------DIKEEEEVNDKNGESNFAIRS 773

Query: 783  SSSYVLLQQATNTMLNVLESLKTLFLPLPLNISRTKARFALLSARGSLEYTKGGALFLDN 842
            SSSYVLLQQATNTMLNVLESLK+++LPLP N++RTKARFALLSARGSLEY KGGALFLDN
Sbjct: 774  SSSYVLLQQATNTMLNVLESLKSIYLPLPFNVARTKARFALLSARGSLEYIKGGALFLDN 833

Query: 843  KSLLLDVIKDLEEDRKLDLPGVISWNSLKLLDMSINLLLQPPNTEVGXXXXXXXXXXXXX 902
            K+LLLDV+K +EEDRKL++PGVISW+ LKLLDM+I+LLLQPPNT+V              
Sbjct: 834  KALLLDVVKSIEEDRKLEIPGVISWHGLKLLDMTISLLLQPPNTKVEKLDRLLKKKLNYY 893

Query: 903  XXXMGRPTVK-----QEPASK-------------------GHDLTPASSKDEEDTPAAKR 938
               MGRP +K     QE   K                     +LTP SSK  + +P  K+
Sbjct: 894  SRVMGRPILKTSSLRQEANGKRRNSSDDKLSRSGTEENFRATNLTPISSK-SDGSPVEKK 952

Query: 939  IKIEETSIPLXXXXXXXXXXXXXXXXVQEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXTA 998
            IK+E+ S                     +                             TA
Sbjct: 953  IKLEDESSDTSNALVDKSYTDDLSSSANQP---------------------QVPASTQTA 991

Query: 999  FAEALQLDPVLNSNVSFQNAPPTTLYDGPHDQPHQYQHHAQTQPQD---PHLDTRS---- 1051
             AEAL LDPVLN+N+    A     + G        QH + T   D    H+        
Sbjct: 992  IAEALHLDPVLNNNI-LSVADLAAFFGGNMPAAGGNQHSSYTNQNDFAPKHMRKEKEPAA 1050

Query: 1052 -SDKLH---------GLFKVPSTADFLMDD---SANSQLNFLLGTTELGVLDPSQPSYTN 1098
             SD  H         GLF+VPS ADFLMD+   S  S +N  L        D    ++  
Sbjct: 1051 FSDLAHKKSSVTGVDGLFRVPSNADFLMDEYYPSGTSHINLTLFNNNANNHD---DTFGL 1107

Query: 1099 NPGSGSAIGIN---NMPSGLNLSNLFDLEGSTDXXXXXXXXXXXXXXXSGG--FNFAVDA 1153
            + G G   G+N   N+  G   +N   L    D               + G  FNFAVDA
Sbjct: 1108 SDGHGKDTGVNTNFNVKGGHQSTNHSHLTNFNDRLQGNQLGFTNSGNMNSGSDFNFAVDA 1167

Query: 1154 SLGLAPLLAWTP-------------DHNGIVLD 1173
            SLGLAPLL W+P             D +GI+LD
Sbjct: 1168 SLGLAPLLDWSPEMHTHGKTVSHASDRSGIILD 1200

>SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} similar to
            uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
            similar to YMR280C uniprot|P39113 Saccharomyces
            cerevisiae YMR280C CAT8 Zinc cluster transcriptional
            activator
          Length = 1270

 Score =  924 bits (2387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/1172 (46%), Positives = 682/1172 (58%), Gaps = 150/1172 (12%)

Query: 62   SSSVPQSASMTGSSSQ---NAQREGGGNGSIA---SPAGSQNLRVAQACDRCRSKKTRCD 115
            SS+VP  A+   + S    N+   G G    +   +PA + N RVAQACDRCRSKKTRCD
Sbjct: 43   SSTVPHVAANNTTMSPTPLNSNNMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCD 102

Query: 116  GKRPQCSQCAAVGFECKISDRLSRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDIKEQQI 175
            GKRPQCSQCAAVGFECKISD+LSRRAFPRGY                     CD+KE+Q+
Sbjct: 103  GKRPQCSQCAAVGFECKISDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDLKEEQL 162

Query: 176  HL---FSQQHSPGGRRKDDERMLRELQSANGGSLNISSTNLYLLNTGSHXXXXXXXXXXX 232
            HL   +S + +      +DE++L++L +ANGGSL +SSTNLYLLN  +            
Sbjct: 163  HLVSKYSNKRTSEISENEDEQILQQLSAANGGSLRVSSTNLYLLNKTTPGDQQDEEDQMS 222

Query: 233  XXXXXXXXXPHVCDGLCC----AGKLHVKPVSTNLNDPTSVSFEQSEAPGLPAVQALTSV 288
                        C+G+ C       +H KPVSTNLNDPTS+SFEQ+EAPGLPAV+ALTS+
Sbjct: 223  SKTTVD------CNGVGCNHSHQPNIHDKPVSTNLNDPTSISFEQNEAPGLPAVKALTSM 276

Query: 289  ATREQSNQLATLVALSVPRSTEEILFIPQLLARIRQIYGFTSKQCLYTVXXXXXXXXXXP 348
            A  E S QLATLVALSVPRSTEEIL IPQLLARI Q++G TSKQ LYT           P
Sbjct: 277  ANHEHSVQLATLVALSVPRSTEEILLIPQLLARIGQVHGLTSKQSLYTASLLASLKESIP 336

Query: 349  EPHLVKHEPLETLASTNLWEMDDLEQFFAEIFKFKLESKSPSSYKGGAQLNXXXXXXXXX 408
               L     ++ L STNLWE+DD+ QFF  +FKF ++++S ++ +    L          
Sbjct: 337  ---LTLPTNVDMLKSTNLWEVDDVIQFFQTVFKFDIQAESSTTSQD--HLIATEIDGLVS 391

Query: 409  XXXXXXXXXXPILVKDEFYHYFNQFKENVLQNLEFLKTPLQGPALTARRGKIISYKIFGC 468
                      PIL KDEFY+Y+N+FK +++    F         L  +R K ISYKIFGC
Sbjct: 392  DFFSQWYNFIPILDKDEFYNYYNKFKTDLMDPNFFDDEK----NLFNKRNKSISYKIFGC 447

Query: 469  IILMLCQLGLLSKIKAENLGATSKHHRLASYYHKAISLVYMNPYFGXXXXXXXXXXXXXX 528
            I+L++CQ+GL+SK+KAENL AT+K+ +L +YY   +  + MNPYF               
Sbjct: 448  ILLIICQMGLISKVKAENLPATNKYSQLMAYYDIVVRQLMMNPYFNLKSTSIQSLQFTSL 507

Query: 529  XXXXXXNIGNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGAGSTMNKREQGDRRVLFWGI 588
                  NIG VS++Y+LRG+VVSM+QQLRLHRCPSAVLGG GS ++K +QG+RR+LFWGI
Sbjct: 508  QLFYFLNIGEVSSVYDLRGKVVSMSQQLRLHRCPSAVLGGNGSAVSKAQQGERRILFWGI 567

Query: 589  YYLDVFSALQLGVPRLIKDFEIECALPVADNDDRTVNLAGQQIRLEGQVTNYSLAIIRFS 648
            YYLDVFSALQLGVPRL+KD EIECALPVADNDD+ VNLAGQ I LEG+V+  SL++IRF+
Sbjct: 568  YYLDVFSALQLGVPRLLKDHEIECALPVADNDDQKVNLAGQMIALEGRVSMLSLSVIRFA 627

Query: 649  KVLGNILDSIFKRGMTESITKQVSLIHENALDNWRHGLPKELIFELDVNGTINIDEFNRL 708
            KVLGNILDSIFKRGM+ S+TKQ+SL+HENALDNWR GLP++L FELDVNGTIN+DEFN L
Sbjct: 628  KVLGNILDSIFKRGMSASLTKQISLVHENALDNWRRGLPQQLKFELDVNGTINMDEFNHL 687

Query: 709  KQMNVT--VERSENMTLLVMYFLAKCMIHLPVVATRPLPTNDSNDTGETSNATSNGNNVR 766
            KQ++ +  +   EN +L+V+YF+AKCMIHLPVVA RPL  ND   + E+S  ++N     
Sbjct: 688  KQLDTSGNMYSKENKSLMVLYFMAKCMIHLPVVAKRPL-VNDPEQSPESSTPSNN----- 741

Query: 767  ARDPSTERNQAAADRSSSSYVLLQQATNTMLNVLESLKTLFLPLPLNISRTKARFALLSA 826
                         DRSSSSYVLLQQATNT+LNV  SL+ ++ P+P+N+SRTK RF+LLSA
Sbjct: 742  -----------CGDRSSSSYVLLQQATNTLLNVFTSLRNVYPPIPINVSRTKTRFSLLSA 790

Query: 827  RGSLEYTKGGALFLDNKSLLLDVIKDLEEDRKLDLPGVISWNSLKLLDMSINLLLQPPNT 886
            RGSLEYTKGGALF DNK+LLLD++K+LE D+KL+LPG +SW+SLKLLDMSI+L+LQP NT
Sbjct: 791  RGSLEYTKGGALFQDNKALLLDLVKELEVDKKLELPGTLSWHSLKLLDMSISLILQPANT 850

Query: 887  EVGXXXXXXXXXXXXXXXXMGRPTV-------------------KQEPASKGHDLTPASS 927
            +                    R +                    + + +++   LTPASS
Sbjct: 851  KPEKLEKMLQRKLNYYNKLTNRRSNLGGGRSASSPGGNSKRKLDENQGSAEPPKLTPASS 910

Query: 928  KDEEDTPAAKRIKIEETS-IPLXXXXXXXXXXXXXXXXVQEKXXXXXXXXXXXXXXXXXX 986
            K   DTP  K+IK+E+T  +P+                 Q                    
Sbjct: 911  KG--DTPPDKKIKLEDTGFVPVRAVSQHSQSDSEKFENFQPP------------------ 950

Query: 987  XXXXXXXXXXTAFAEALQLDPVLNSNVSFQNAP------------PTTLYDGPHDQPHQY 1034
                       + AEA  LDPVLN+N  F N              P  L  G        
Sbjct: 951  ------VAPQNSIAEAFHLDPVLNNN-PFSNTDLNAFFNTNNGNVPAALRSG--GSLFNI 1001

Query: 1035 QHHAQTQPQDPHLDTRSSDKLHGLFKVPSTADFLMDDSANSQLNFLLGTTELGVLDPSQP 1094
               A     + +    S+    GLFKVPS  DFL D                        
Sbjct: 1002 AATAAASGNNANSTAPSNTLNEGLFKVPSNGDFLKD------------------------ 1037

Query: 1095 SYTNNPGSGSAIGINNMPSGLNLSNLFDLEGSTDXXXXXXXXXXXXXXXSGGFNFAVDAS 1154
             Y N PG+ S+       +    +    L GS+                + GF FAVDAS
Sbjct: 1038 -YYNVPGASSSQLNLLFLNNNASNGKPQLNGSS-----AHSGTQAQNNDNNGFGFAVDAS 1091

Query: 1155 LGLAPLLAWTP------------DHNGIVLDV 1174
             GLAPLL W+P            + N I+LD 
Sbjct: 1092 WGLAPLLEWSPAGKPVDPGTCNANENSIILDT 1123

>KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P39113 Saccharomyces cerevisiae YMR280C CAT8 Zinc
            cluster transcriptional activator
          Length = 1206

 Score =  837 bits (2163), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/1117 (45%), Positives = 639/1117 (57%), Gaps = 135/1117 (12%)

Query: 90   ASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGYXXX 149
            AS   S N RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK+SD+LSRRAFPRGY   
Sbjct: 60   ASVTPSSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYTET 119

Query: 150  XXXXXXXXXXXXXXXXXXCDIKEQQIHL---FSQQHSPGGRRKDDERMLRELQSANGGSL 206
                              CD+K++Q+HL   +S    P     ++E+ML +L S+NGGSL
Sbjct: 120  LEERVRELEAENRRLVALCDLKDEQMHLVYKYSSNKRPEPSSTEEEQMLEQLSSSNGGSL 179

Query: 207  NISSTNLYLLNTGSHXXXXXXXXXXXXXXXXXXXXPHVCDGLCCAGK----LHVKPVSTN 262
             +SSTNLYLLN  S                      H C G+ C       LH KPVST 
Sbjct: 180  RVSSTNLYLLNKTSPAGHEVPEN-------------HKCQGIDCNHTSHPHLHEKPVSTT 226

Query: 263  LNDPTSVSFEQSEAPGLPAVQALTSVATREQSNQLATLVALSVPRSTEEILFIPQLLARI 322
            L+DPT++SFEQ EAPGLPAV+AL+S+A  E S QLA LVALSVPRSTEEILFIPQLLAR+
Sbjct: 227  LSDPTTISFEQHEAPGLPAVKALSSMANHEYSTQLACLVALSVPRSTEEILFIPQLLARL 286

Query: 323  RQIYGFTSKQCLYTVXXXXXXXXXXPEPHLV-KHEPLETLASTNLWEMDDLEQFFAEIFK 381
             Q++G TSKQCLYT           P   +V   + L  L  T+LWE+DD  +FF +  K
Sbjct: 287  GQVHGLTSKQCLYTASLLASLKE--PSQAVVPTTDGLTELKCTSLWEIDDPMRFFKDSCK 344

Query: 382  FKLESKSPSSYKGGAQLNXXXXXXXXXXXXXXXXXXXPILVKDEFYHYFNQFKENVLQNL 441
            F L S +         L+                   P+L ++EFY Y+N+FKE++  + 
Sbjct: 345  FNLGSDNDVEL-----LSISEIEDLISIYFEECHALIPVLNENEFYKYYNKFKESLTVDP 399

Query: 442  EFLKTPLQGPALTARRGKIISYKIFGCIILMLCQLGLLSKIKAENLGATSKHHRLASYYH 501
             F     +  +  A R K ISYKIF CI+L++CQLG++SK+K E L A SK  R+ +YY+
Sbjct: 400  NFFG---KANSSFAHRSKSISYKIFACILLVVCQLGIMSKVKREQLPAKSKFSRIMAYYN 456

Query: 502  KAISLVYMNPYFGXXXXXXXXXXXXXXXXXXXXNIGNVSAIYELRGRVVSMAQQLRLHRC 561
             AI  + +NPYF                     N+G VS++YELRG +VSMAQQLRLHRC
Sbjct: 457  NAILALKLNPYFSVKTTSVKTLQLMSLLLFYFLNVGEVSSVYELRGTIVSMAQQLRLHRC 516

Query: 562  PSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVADNDD 621
            PSAVLG  GSTM+K EQGDRR+LFWGIYYLDVFSALQLGVPRL+KD EIECALP+++N  
Sbjct: 517  PSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFSALQLGVPRLLKDHEIECALPISENGH 576

Query: 622  RTVNLAGQQIRLEGQVTNYSLAIIRFSKVLGNILDSIFKRGMTESITKQVSLIHENALDN 681
              V+LA Q IRLEGQV+ +SL+++RFSK+LGNILDSIFKRGMT SI +QV+LIHENALD+
Sbjct: 577  PGVSLADQVIRLEGQVSEFSLSLLRFSKILGNILDSIFKRGMTSSIAQQVALIHENALDS 636

Query: 682  WRHGLPKELIFELDVNGTINIDEFN---RLKQMNVTVERSENMTLLVMYFLAKCMIHLPV 738
            WR GLPK L FELDVNGTIN++E N     K+   T    +N TL+V+YFL KC++HLPV
Sbjct: 637  WRRGLPKNLTFELDVNGTINMEELNSGSHWKKDYSTAPSCDNRTLMVLYFLVKCLVHLPV 696

Query: 739  VATRPLPTNDSNDTGETSNATSNGNNVRARDPSTERNQAAADRSSSSYVLLQQATNTMLN 798
            +A +PL    S    + + A  +               + ADRSSSSYVLLQQATNT L+
Sbjct: 697  LAAKPLLGGASEVDTDATLAFDDA-------------SSGADRSSSSYVLLQQATNTFLS 743

Query: 799  VLESLKTLFLPLPLNISRTKARFALLSARGSLEYTKGGALFLDNKSLLLDVIKDLEEDRK 858
            V  SLK+  LPL LN+ R KARFALLSARG LEYTKGGALF  NK+LLLDV+K+LE  ++
Sbjct: 744  VQSSLKSRHLPLALNLPRIKARFALLSARGILEYTKGGALFQGNKALLLDVVKELETTKR 803

Query: 859  LDLPGVISWNSLKLLDMSINLLLQPPNTEVGXXXXXXXXXXXXXXXXMGRPTVKQEPASK 918
            L++PG +SW+SL LLDM+++L++QPP+T+ G                MGR         K
Sbjct: 804  LEIPGSLSWHSLILLDMAVSLIMQPPHTKAGKLDKLLEAKLSYYNKLMGRSANVASTKRK 863

Query: 919  GHDLTPASSKDEEDTP--------AAKRIKIEETSIPLXXXXXXXXXXXXXXXXVQEKXX 970
              +   + S   + TP        + KR+K+E T   +                 QE   
Sbjct: 864  KEEDNTSLSNATKLTPLSSDSSSPSEKRVKLEHTD-KVGETPVGVENTGQPNGNTQEH-- 920

Query: 971  XXXXXXXXXXXXXXXXXXXXXXXXXXTAFAEALQLDPVLNSNVSFQNAPPTTLYDGPHDQ 1030
                                      +  AEA  LDPVLN+N  F N   T  +   +  
Sbjct: 921  --------------YAATWSNQNQPHSTVAEAFHLDPVLNNN-PFSNGDLTAFFSTDNGM 965

Query: 1031 PH--------------QYQHHAQTQPQDP-HLDTRSSDKLH-GLFKVPSTADFLMD---- 1070
            P+              Q    A    Q+  + +++ S   + GLF+VPS  DFL D    
Sbjct: 966  PNLSGGASMLNMVGVDQAHSTAGNDAQNTVNANSQQSTLFNDGLFRVPSNGDFLKDYYRV 1025

Query: 1071 -DSANSQLNFLLGTTELGVLDPSQPSYTNNPGSGSAIGINNMPSGLNLSNLFDLEGSTDX 1129
              +++SQLN +L                   GSGS+ G N   +    +N  D       
Sbjct: 1026 PGASSSQLNLMLM------------------GSGSS-GSNQRQAKQQQTNTTD------- 1059

Query: 1130 XXXXXXXXXXXXXXSGGFNFAVDASLGLAPLLAWTPD 1166
                            GF F VDASLGLAPLLAW+P+
Sbjct: 1060 ---------------PGFGFTVDASLGLAPLLAWSPE 1081

>Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR280C
            (CAT8) - Zinc-cluster protein involved in activating
            gluconeogenic genes; related to Gal4p [contig 39] FULL
          Length = 1209

 Score =  810 bits (2091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/1125 (44%), Positives = 624/1125 (55%), Gaps = 148/1125 (13%)

Query: 89   IASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGYXX 148
            + S   + N RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK+SD+LSRRAFPRGY  
Sbjct: 59   VTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYTE 118

Query: 149  XXXXXXXXXXXXXXXXXXXCDIKEQQIHLFSQ-----QHSPGGRRKDDERMLRELQSANG 203
                               CD+K++Q+HL S+     +H P     ++ RML +L +++G
Sbjct: 119  TLEERVRELEAENRRLVALCDLKDEQMHLVSKYSSNKRHEPSS--TEEGRMLEQLSNSDG 176

Query: 204  GSLNISSTNLYLLNTGSHXXXXXXXXXXXXXXXXXXXXPHVCDGLCCAGK----LHVKPV 259
            GSL +SSTNLYLLN  +                      H C GL C       LH KPV
Sbjct: 177  GSLRVSSTNLYLLNKTTPAVQDGSEL-------------HKCQGLGCNHASHPHLHEKPV 223

Query: 260  STNLNDPTSVSFEQSEAPGLPAVQALTSVATREQSNQLATLVALSVPRSTEEILFIPQLL 319
            ST+L+DP ++SFEQ+EAPGLPAV+AL ++A  E S QLA LVALSVPRST+EILFIPQLL
Sbjct: 224  STSLSDPAAISFEQNEAPGLPAVKALNTMANHEYSAQLAYLVALSVPRSTDEILFIPQLL 283

Query: 320  ARIRQIYGFTSKQCLYTVXXXXXXXXXXPEPHLVKHEPLETLASTNLWEMDDLEQFFAEI 379
            AR+ Q++G TSKQCLY+            +         + L   +LWE+DD   FF   
Sbjct: 284  ARLGQVHGLTSKQCLYSASLLAALKESS-QTSFQGSPDYKDLKDKSLWEIDDCMTFFKTG 342

Query: 380  FKFKLESKSPSSYKGGAQLNXXXXXXXXXXXXXXXXXXXPILVKDEFYHYFNQFKENVLQ 439
             KF L     +S K    L                    P+L + EFY Y+N+FK N+  
Sbjct: 343  CKFNL-----TSSKDAECLTISEIEELISIYFGECHALIPVLNEAEFYKYYNKFKSNLTT 397

Query: 440  NLEFLKTPLQGPALTARRGKIISYKIFGCIILMLCQLGLLSKIKAENLGATSKHHRLASY 499
            + EF KT    P+  A+R K ISYKIF CI+L++CQ GL++K+K E L   +K   L SY
Sbjct: 398  DPEFFKT--STPSF-AQRSKSISYKIFACILLVICQFGLMAKVKREQLPTKNKFSLLMSY 454

Query: 500  YHKAISLVYMNPYFGXXXXXXXXXXXXXXXXXXXXNIGNVSAIYELRGRVVSMAQQLRLH 559
            Y  A+  +  NPYF                     N+G VS++YE+RG VVSMAQQLRLH
Sbjct: 455  YSNALLALKTNPYFSVKNTSIQTLQLLSLLLFYYLNVGEVSSVYEIRGTVVSMAQQLRLH 514

Query: 560  RCPSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVADN 619
            RCPSAVLG  GSTM+K EQGDRR+LFWGIYYLDVF ALQLGVPRL+KD EIECALP++++
Sbjct: 515  RCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQLGVPRLLKDHEIECALPISEH 574

Query: 620  DDRTVNLAGQQIRLEGQVTNYSLAIIRFSKVLGNILDSIFKRGMTESITKQVSLIHENAL 679
                V+LA Q I+LEGQV+  SL+++RFSK+LGNILDSIFKRGMT S  +QV+LIHENAL
Sbjct: 575  AHAGVSLADQVIKLEGQVSELSLSLLRFSKILGNILDSIFKRGMTSSAAQQVALIHENAL 634

Query: 680  DNWRHGLPKELIFELDVNGTINIDEFNRLKQMNVTVER---SENMTLLVMYFLAKCMIHL 736
            DNWR GLPK L FELDVNGTI I+E     Q N    +   S+   L+++YFL KC++HL
Sbjct: 635  DNWRRGLPKNLTFELDVNGTIKIEELTGSAQNNQDFTKNASSDKKILMLLYFLVKCLVHL 694

Query: 737  PVVATRPLPTNDSNDTGETSNATSNGNNVRARDPSTERNQAAADRSSSSYVLLQQATNTM 796
            PV+A +PL    S    + +             P+ +   + ADRSSSSYVLLQQATNT 
Sbjct: 695  PVLAAKPLLGGSSEPDKDAT-------------PAFDDASSGADRSSSSYVLLQQATNTF 741

Query: 797  LNVLESLKTLFLPLPLNISRTKARFALLSARGSLEYTKGGALFLDNKSLLLDVIKDLEED 856
            L+V    KT  LPL +++ R KARFALLSARG LEYTKGGALF DNK+LLL+V+K+LE  
Sbjct: 742  LSVQSCFKTRHLPLAIDLPRIKARFALLSARGILEYTKGGALFQDNKALLLEVVKELEAS 801

Query: 857  RKLDLPGVISWNSLKLLDMSINLLLQPPNTEVGXXXXXXXXXXXXXXXXMGRPTV----- 911
            +KL+LPG +SW+SL LLDM+  L++QPP T+                  MGR T+     
Sbjct: 802  KKLELPGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLLETRLNYYNKLMGRSTLTSNGK 861

Query: 912  ----KQEPASKGHDLTPASSKDEEDTPAAKRIKIEETSIPLXXXXXXXXXXXXXXXXVQE 967
                + +  SK   LTP SS  E +TP+ KRIK+E  SI                  +Q 
Sbjct: 862  RKNEENDATSKVSKLTPLSS--EYNTPSDKRIKVE--SIGSSGNVPSNSESVHHFDDIQN 917

Query: 968  KXXXXXXXXXXXXXXXXXXXXXXXXXXXXTAFAEALQLDPVLNSNVSFQNAPPTTLYDGP 1027
                                          A AEA  LDPVLN N  F N   T  ++  
Sbjct: 918  D---------------KFSTNWPSNNPQPNAIAEAFHLDPVLNGN-PFSNGDLTAFFNSD 961

Query: 1028 HDQPH--------------------QYQHHAQTQPQDPH-LDTRSSDKLHGLFKVPSTAD 1066
            +  P                        ++ +     P  + T  +D   GLF+VPS  D
Sbjct: 962  NGIPQIGGGSSVLNLAGIGAANSNELNNNNNEAAGGGPRKVATTVND---GLFRVPSNGD 1018

Query: 1067 FLMD-----DSANSQLNFLLGTTELGVLDPSQPSYTNNPGSGSAIGINNMPSGLNLSNLF 1121
            FL D      +++SQLN +                    G G+     N P+  N  N F
Sbjct: 1019 FLKDYYRIPGASSSQLNLMFM------------------GPGNTGANQNAPN--NQKNNF 1058

Query: 1122 DLEGSTDXXXXXXXXXXXXXXXSGGFNFAVDASLGLAPLLAWTPD 1166
             +                      GF F VDASLGLAPLLAW+P+
Sbjct: 1059 TVP---------------------GFGFTVDASLGLAPLLAWSPE 1082

>ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR280C
           (CAT8)
          Length = 1285

 Score =  764 bits (1974), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/896 (49%), Positives = 552/896 (61%), Gaps = 108/896 (12%)

Query: 66  PQSASMTGSSSQNAQREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCA 125
           P+ A+   S +   Q   G   S  +P    N RVAQACDRCRSKKTRCDGKRPQCSQCA
Sbjct: 43  PEGATGGASPAAAPQSTTGTPLSSLTPT---NYRVAQACDRCRSKKTRCDGKRPQCSQCA 99

Query: 126 AVGFECKISDRLSRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDIKEQQIHLFSQ----- 180
           AVGFECKISD+LSRRAFPRGY                     CD+KE+Q+ L S+     
Sbjct: 100 AVGFECKISDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDLKEEQLRLVSKYGCAS 159

Query: 181 ----QHSPGGRRKD-------DERMLRELQSANGGSLNISSTNLYLLNTGSHXXXXXXXX 229
                 S   ++ D       DE++L++L +++GG+L +SSTNLYLLN  +         
Sbjct: 160 APATSSSSANKKGDSDHTTLEDEQILQQLSNSDGGALRVSSTNLYLLNKKTAAFPLVQPV 219

Query: 230 XXXXXXXXXXXXP---------------HVCD---GL--------CCAGKLHVKPVSTNL 263
                       P               HV D   GL           G++   P  TNL
Sbjct: 220 QQNLSPTQLRSNPYTRATLSPSHVAEADHVTDLRKGLPANPVAISSSVGQVPPYPF-TNL 278

Query: 264 NDPTSVSFEQSEAPGLPAVQALTSVATREQSNQLATLVALSVPRSTEEILFIPQLLARIR 323
           NDPTS+SFEQ +APGLPAV+AL+S+A+ E+S+QLA LVA+S+PR+TEEILF+PQLLARI 
Sbjct: 279 NDPTSISFEQDQAPGLPAVKALSSLASHEESSQLAALVAVSIPRTTEEILFVPQLLARIG 338

Query: 324 QIYGFTSKQCLYTVXXXXXXXXXXPEPHLVKHEPLETLASTNLWEMDDLEQFFAEIFKFK 383
           Q++GFTSKQCLYT           P         LE L + NLWE+D+++ F  E  +  
Sbjct: 339 QMHGFTSKQCLYTASVLASLKEITPR---KTSSILEQLKAKNLWEIDNVDTFLLEGLQID 395

Query: 384 LESKS--------PSSYKGGAQ----------------LNXXXXXXXXXXXXXXXXXXXP 419
           +   S        P+ YK   +                L                    P
Sbjct: 396 IRRGSSGDFNLENPNGYKLENEYHQTKDAHPELQELTPLTFQEIEELIQLFFDDWYSLIP 455

Query: 420 ILVKDEFYHYFNQFKENVLQNLEFLKTPLQGPALTARRGKIISYKIFGCIILMLCQLGLL 479
           I  + EF  Y+ +FK+NV     F      G  L  RR K ISYKIF C++L +CQ+GL+
Sbjct: 456 IFDRSEFESYWVKFKDNVSTPGFFTS----GDTLFDRRHKSISYKIFACLLLTVCQMGLM 511

Query: 480 SKIKAENLGATSKHHRLASYYHKAISLVYMNPYFGXXXXXXXXXXXXXXXXXXXXNIGNV 539
           SK+K E      + + L +YY +AIS V MNPYF                     N+G+V
Sbjct: 512 SKVKRERHERGDRLNNLMTYYDRAISHVIMNPYFSSSSTSIQSLQLLSLLLFYFLNVGDV 571

Query: 540 SAIYELRGRVVSMAQQLRLHRCPSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSALQL 599
           S +YELRG+VVS+ QQLRLHRCPSAVLG  GST+ K +QG+RRVLFWG+YYLDVFS+LQL
Sbjct: 572 SNVYELRGKVVSLTQQLRLHRCPSAVLGSDGSTVGKIQQGERRVLFWGVYYLDVFSSLQL 631

Query: 600 GVPRLIKDFEIECALPVADNDDRTVNLAGQQIRLEGQVTNYSLAIIRFSKVLGNILDSIF 659
           GVPRL+KD EIECALPV+ +DD  VNLAGQ I LEG+++ +SL+IIRFSKVLGN+LDSIF
Sbjct: 632 GVPRLMKDHEIECALPVSSDDDNHVNLAGQMIALEGKMSPFSLSIIRFSKVLGNVLDSIF 691

Query: 660 KRGMTESITKQVSLIHENALDNWRHGLPKELIFELDVNGTINIDEFNRLKQMNV---TVE 716
           KRGMTES+TKQV+L+HENALDNWRH LP  L F+LDVNGTIN+++ N+LK+  +   T  
Sbjct: 692 KRGMTESMTKQVALVHENALDNWRHALPDNLRFQLDVNGTINMEDLNQLKRDYLNKDTAL 751

Query: 717 RSENMTLLVMYFLAKCMIHLPVVATRPL-----PTNDSNDTGETSNATSNGNNVRARDPS 771
           +  N   + +YFLAK MIHLPVVAT+P+     P  D+N  G                  
Sbjct: 752 KLNNAIFMALYFLAKIMIHLPVVATKPIIDKPQPVVDTNIPG------------------ 793

Query: 772 TERNQAAADRSSSSYVLLQQATNTMLNVLESLKTLFLPLPLNISRTKARFALLSARGSLE 831
                +  DRSSSSYVLLQQATNT LNVL S+ +L+LPLPLNI+RTK RF L+SARGSLE
Sbjct: 794 -----SQIDRSSSSYVLLQQATNTFLNVLSSVSSLYLPLPLNITRTKTRFGLVSARGSLE 848

Query: 832 YTKGGALFLDNKSLLLDVIKDLEEDRKLDLPGVISWNSLKLLDMSINLLLQPPNTE 887
           YTKGGALF DNK+LLLD++KDLE D+KL++PG ISW+SLKLLDM++NL+LQPPNT+
Sbjct: 849 YTKGGALFQDNKNLLLDLLKDLEADKKLNMPGTISWHSLKLLDMAVNLILQPPNTK 904

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 56/188 (29%), Positives = 69/188 (36%), Gaps = 63/188 (33%)

Query: 998  AFAEALQLDPVLN----SNVSF-------QNAPPTTL------YDGPHDQPHQYQHHAQT 1040
            A  EA QLDP+L     SN          Q A P  L      Y  P   P Q      +
Sbjct: 1039 AITEAFQLDPILQPTPFSNTDLPSFFGVDQYAAPPELQPFPAGYAAPDKVP-QAAAQGPS 1097

Query: 1041 QPQDPHLDTRSSDKLHGLFKVPSTADFLMD---DSANSQLNFLLGTTELGVLDPSQPSYT 1097
                P L ++ S     LFKVPS  DFL D     +++QLN L    +   + P  P   
Sbjct: 1098 ATAGPPLSSKDS-----LFKVPSNGDFLKDYYSGMSSAQLNSLFTAPDRRDVRPRAP--- 1149

Query: 1098 NNPGSGSAIGINNMPSGLNLSNLFDLEGSTDXXXXXXXXXXXXXXXSGGFNFAVDASLGL 1157
              P    + G+   P                                 G+ F VDASLGL
Sbjct: 1150 -QPDRAPSDGLQQQP---------------------------------GYGFVVDASLGL 1175

Query: 1158 APLLAWTP 1165
            APLLAW+P
Sbjct: 1176 APLLAWSP 1183

>Suva_13.468 Chr13 complement(809712..812654,812694..814007) [4257
           bp, 1418 aa] {ON} YMR280C (REAL)
          Length = 1418

 Score =  705 bits (1819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/883 (45%), Positives = 518/883 (58%), Gaps = 67/883 (7%)

Query: 91  SPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGYXXXX 150
           +P  +   R+AQACDRCRSKKTRCDGKRPQCSQCAAVGFEC+ISD+L R+A+P+GY    
Sbjct: 56  TPLSTPIYRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESL 115

Query: 151 XXXXXXXXXXXXXXXXXCDIKEQQIHLFSQQHSPGGRRKDDERMLRELQSANGGSLNISS 210
                            CDIKEQQI+L SQ   P     D+       Q      LN+SS
Sbjct: 116 EERVRELEAENKRLLALCDIKEQQINLVSQSRPPTSL--DNTVSDNFKQDLKDAPLNLSS 173

Query: 211 TNLYLLNTGSHXXXXXXXXXXXXXXXXXX---------XXPHVCDGLCCAGKLHVKPVST 261
           TN+YLLN   +                              HVCDG+ C   LH KP ST
Sbjct: 174 TNIYLLNQTVNKQLQNGKIDTNRSDSTMGLLATSPPLPQKDHVCDGVSCTNNLHAKPTST 233

Query: 262 NLNDPTSVSFEQSEAPGLPAVQALTSVATREQSNQLATLVALSVPRSTEEILFIPQLLAR 321
           +LNDPT++SFEQ+EAPGLPAV+AL S+ T ++S QLATLV+LS+PRSTEEILFIPQLL R
Sbjct: 234 SLNDPTAISFEQNEAPGLPAVKALKSMTTHQRSTQLATLVSLSIPRSTEEILFIPQLLTR 293

Query: 322 IRQIYGFTSKQCLYTVXXXXXXXXXXPEPHLV------------KHEPLETLASTNLWEM 369
           IRQI+GF SKQCLYTV          P P L+              + L T  +T+L E 
Sbjct: 294 IRQIFGFNSKQCLYTVSLLSSLKNRLPAPKLLLSSTSTKIKENDDSKFLNTFETTSLAEF 353

Query: 370 DDLEQFFAEIFKFKLESKS---PSSYKGGAQ---LNXXXXXXXXXXXXXXXXXXXPILVK 423
            DL++F   + KF + S S   P      +    L+                    IL  
Sbjct: 354 GDLKKFLISL-KFDINSFSNQQPEVQNNKSDNDLLSLNEIKELLHLFFKFWSNQVSILNN 412

Query: 424 DEFYHYFNQFKENVLQNLEFLKTPLQGPALTARRGKIISYKIFGCIILMLCQLGLLSKIK 483
           D F  YFN F E V++ L        G    A      +++IF   +L++ Q+GLL K+K
Sbjct: 413 DHFLLYFNNFVE-VIKALPLELKKTNGTKTHA----TTNHQIFALKLLIMLQMGLLIKVK 467

Query: 484 AENLGAT------SKHHRLASYYHKAISLVYMNPYF-GXXXXXXXXXXXXXXXXXXXXNI 536
            E +  T      SK  +L  YYH+  S++  NPYF                      N+
Sbjct: 468 REKIKDTVPGNQNSKFAKLMVYYHQVSSIIPKNPYFLNMSTTSLPSLQLLSLTSFYFLNV 527

Query: 537 GNVSAIYELRGRVVSMAQQLRLHRCPSAVLG-GAGSTMNKREQGDRRVLFWGIYYLDVFS 595
           G++ AIY LRGR+VSM+QQLRLHRCPSAVL   +   + + EQ +RR+LFW +YY+DVF+
Sbjct: 528 GDIPAIYGLRGRIVSMSQQLRLHRCPSAVLSVHSNPVLQRFEQSERRLLFWAVYYIDVFA 587

Query: 596 ALQLGVPRLIKDFEIECALPVAD--------NDDRTVNLAGQQIRLEGQVTNYSLAIIRF 647
           +LQLGVPRL+KDF+IECALP++D        +++       ++I+L+GQV+++SL IIRF
Sbjct: 588 SLQLGVPRLLKDFDIECALPISDVEFEDQLASENEKTKNKTKKIQLQGQVSSFSLQIIRF 647

Query: 648 SKVLGNILDSIFKRGMT-ESITKQVSLIHENALDNWRHGLPKELIFELDVNGTINIDEF- 705
           +K+LGNILDSIFKRGM  E +T +V+L+HENALDNWR+ LP+   F++ VNGT+N+D+  
Sbjct: 648 AKILGNILDSIFKRGMMDERVTSEVALVHENALDNWRNQLPEMYYFQITVNGTVNLDDIR 707

Query: 706 -NRLKQMNVTVERS-----ENMTLLVMYFLAKCMIHLPVVATRPLPTNDSNDTGET---- 755
            N  +      +R      E   LL+ YFLAK MIHLPV+AT+PLP    N T +     
Sbjct: 708 ANNSRNTEAKFDRKDIICFEKNVLLLFYFLAKSMIHLPVIATKPLPKTVDNSTKKKHSMF 767

Query: 756 SNATSNGNNVRARDPSTERNQAAADRSSSSYVLLQQATNTMLNVLESLKTLFLPLPLNIS 815
           +N T + NN        +    A  R+SSSY++LQQATN  L + +S+ +++LPLPLN+S
Sbjct: 768 NNDTKSINNQDHSVVDVDMTSPAI-RTSSSYIILQQATNATLTLFQSINSVYLPLPLNVS 826

Query: 816 RTKARFALLSARGSLEYTKGGALFLDNKSLLLDVIKDLEEDRKLDLPGVISWNSLKLLDM 875
           RT  RF+LL ARGSLEYTKGGALFLDNK+LLLD IKD+E DR LDLPGV SW++LKL DM
Sbjct: 827 RTLIRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLDLPGVASWHTLKLFDM 886

Query: 876 SINLLLQPPNTEVGXXXXXXXXXXXXXXXXMGRP---TVKQEP 915
           +INLLL+ PN +V                 MG P   T   EP
Sbjct: 887 TINLLLKAPNVKVERLDKFLEKKLNYYNRLMGLPPTTTTSSEP 929

>YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}
           CAT8Zinc cluster transcriptional activator necessary for
           derepression of a variety of genes under
           non-fermentative growth conditions, active after diauxic
           shift, binds carbon source responsive elements
          Length = 1433

 Score =  705 bits (1820), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/903 (45%), Positives = 526/903 (58%), Gaps = 98/903 (10%)

Query: 64  SVPQSASMTGSSSQNAQ-----REGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKR 118
           S P  ++ T SS  N       +E     +  +P  +   R+AQACDRCRSKKTRCDGKR
Sbjct: 25  SGPSISNRTSSSEANPHFSKNVKEAMIKTASPTPLSTPIYRIAQACDRCRSKKTRCDGKR 84

Query: 119 PQCSQCAAVGFECKISDRLSRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDIKEQQIHLF 178
           PQCSQCAAVGFEC+ISD+L R+A+P+GY                     CDIKEQQI L 
Sbjct: 85  PQCSQCAAVGFECRISDKLLRKAYPKGYTESLEERVRELEAENKRLLALCDIKEQQISLV 144

Query: 179 SQQ-------HSPGGRRKDDERMLRELQSANGGSLNISSTNLYLLNTGSHXXXXXXXXXX 231
           SQ        ++  G  K D +            LN+SSTN+YLLN   +          
Sbjct: 145 SQSRPQTSTDNTINGNFKHDLK---------DAPLNLSSTNIYLLNQTVNKQLQNGKMDG 195

Query: 232 XXXXXXXX---------XXPHVCDGLCCAGKLHVKPVSTNLNDPTSVSFEQSEAPGLPAV 282
                               H+CDG+ C   LHVKP ST+LNDPT++SFEQ EAPGLPAV
Sbjct: 196 DNSGSAMSPLGAPPPPPHKDHLCDGVSCTNHLHVKPTSTSLNDPTAISFEQDEAPGLPAV 255

Query: 283 QALTSVATREQSNQLATLVALSVPRSTEEILFIPQLLARIRQIYGFTSKQCLYTVXXXXX 342
           +AL S+ T ++S QLATLV+LS+PRSTEEILFIPQLL RIRQI+GF SKQCLYTV     
Sbjct: 256 KALKSMTTHQRSTQLATLVSLSIPRSTEEILFIPQLLTRIRQIFGFNSKQCLYTVSLLSS 315

Query: 343 XXXXXPEPHLVKHEP-------------------LETLASTNLWEMDDLEQFFA----EI 379
                P P L+                       ++   STNL E  DL++F       I
Sbjct: 316 LKNRLPAPRLLAPSTSTKLKEKDEDKKLDDDSAFVKRFQSTNLSEFVDLKKFLISLKFNI 375

Query: 380 FKFKLESKSPSSYKGGAQLNXXXXXXXXXXXXXXXXXXXPILVKDEFYHYFNQFKENVLQ 439
             F  +S+ P++ +    L+                   PIL  D F  YFN F E V  
Sbjct: 376 NSFSKQSEKPANDQDDELLSLTEIKELLHLFFKFWSNQVPILNNDHFLIYFNNFVEVV-- 433

Query: 440 NLEFLKTPLQGPALTARRGKIISYKIFGCIILMLCQLGLLSKIKAENLGAT------SKH 493
             + L T       T +     +++IF   +LM+ Q+GLL KIK E +  T      +K+
Sbjct: 434 --KHLSTENLETNNTTKSTVTTNHEIFALKLLMMLQMGLLVKIKMEKIKYTVPKNPKAKY 491

Query: 494 HRLASYYHKAISLVYMNPYF-GXXXXXXXXXXXXXXXXXXXXNIGNVSAIYELRGRVVSM 552
            RL +YYH+   ++  NPYF                      N+G++SAIY +RGR+VSM
Sbjct: 492 ARLMAYYHQLSLIIPKNPYFLNMSTTSLPSLQLLSLASFYYLNVGDISAIYGVRGRIVSM 551

Query: 553 AQQLRLHRCPSAVLG-GAGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIE 611
           AQQLRLHRCPSAVL   +   + K EQ +RR+LFW IYY+DVF++LQLGVPRL+KDF+IE
Sbjct: 552 AQQLRLHRCPSAVLSVHSNPVLQKFEQSERRLLFWAIYYVDVFASLQLGVPRLLKDFDIE 611

Query: 612 CALPVAD--------NDDRTVNLAGQQIRLEGQVTNYSLAIIRFSKVLGNILDSIFKRGM 663
           CALP++D         ++   +   ++I+L+GQV+++SL IIRF+K+LGNILDSIFKRGM
Sbjct: 612 CALPISDVEYKDQLSMENEKADKKAKKIQLQGQVSSFSLQIIRFAKILGNILDSIFKRGM 671

Query: 664 T-ESITKQVSLIHENALDNWRHGLPKELIFELDVNGTINIDEFNRLKQMNVTVERS---- 718
             E IT +V+L+HENALDNWR+ LP+   F++ VNGT+N+DE     Q N   +      
Sbjct: 672 MDERITSEVALVHENALDNWRNQLPEMYYFQITVNGTVNLDEIRATNQRNTETKFDKKDI 731

Query: 719 ---ENMTLLVMYFLAKCMIHLPVVATRPLPTNDSNDTGETSNATSNGNNVRARDPSTERN 775
              E   LL+ YFLAK MIHLPV+AT+PLP N         NAT    ++   D     N
Sbjct: 732 ILFEKKILLLFYFLAKSMIHLPVIATKPLPKN-------VDNATKKKQSMFNNDSKGATN 784

Query: 776 Q----------AAADRSSSSYVLLQQATNTMLNVLESLKTLFLPLPLNISRTKARFALLS 825
           Q          + A R+SSSY++LQQATN  L + +++ +++LPLPLN+SRT  RF+LL 
Sbjct: 785 QDHMILDVDMTSPAIRTSSSYIILQQATNATLTIFQAINSMYLPLPLNVSRTLIRFSLLC 844

Query: 826 ARGSLEYTKGGALFLDNKSLLLDVIKDLEEDRKLDLPGVISWNSLKLLDMSINLLLQPPN 885
           ARGSLEYTKGGALFLDNK+LLLD IKD+E DR LDLPG+ SW++LKL DMSINLLL+ PN
Sbjct: 845 ARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLDLPGIASWHTLKLFDMSINLLLKAPN 904

Query: 886 TEV 888
            +V
Sbjct: 905 VKV 907

>Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa]
           {ON} YMR280C (REAL)
          Length = 1433

 Score =  697 bits (1800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/860 (46%), Positives = 514/860 (59%), Gaps = 71/860 (8%)

Query: 91  SPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGYXXXX 150
           +P  +   R+AQACDRCRSKKTRCDGKRPQCSQCAAVGFEC+ISD+L R+A+P+GY    
Sbjct: 57  TPLSTPIYRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESL 116

Query: 151 XXXXXXXXXXXXXXXXXCDIKEQQIHLFSQQHSPGGRRKDDERMLRELQSANGGSLNISS 210
                            CDIKEQQI L SQ   P           +  Q      LN+SS
Sbjct: 117 EERVRELEAENKRLLALCDIKEQQISLVSQSRPPTSMDNTANGSFK--QELKDAPLNLSS 174

Query: 211 TNLYLLNTGSHXXXXXXXXXXXXXXXXXXXXP---------HVCDGLCCAGKLHVKPVST 261
           TN+YLLN   +                              HVCDG+ C   LHVKP ST
Sbjct: 175 TNIYLLNQTVNKQLQNGKMDSDNSNTVMNSLAAAPLPPQKDHVCDGISCTNHLHVKPTST 234

Query: 262 NLNDPTSVSFEQSEAPGLPAVQALTSVATREQSNQLATLVALSVPRSTEEILFIPQLLAR 321
           +LNDPT++SFEQ EAPGLPAV+AL  + T ++S QLATLV+LS+PRSTEEILFIPQLL R
Sbjct: 235 SLNDPTAISFEQDEAPGLPAVKALKLMTTHQRSTQLATLVSLSIPRSTEEILFIPQLLTR 294

Query: 322 IRQIYGFTSKQCLYTVXXXXXXXXXXPEPHLV----------KHEP---------LETLA 362
           IRQI+GF SKQCLYTV          P P L+          K E           +   
Sbjct: 295 IRQIFGFNSKQCLYTVSLLSSLKNRLPAPRLLPPSTSTKLKEKGEDKILDDDSAFFKKFQ 354

Query: 363 STNLWEMDDLEQFFAEIFKFKLESKSPSSYK-----GGAQLNXXXXXXXXXXXXXXXXXX 417
           +TNL E  DL+ F   + KF ++S S  S           L+                  
Sbjct: 355 TTNLSEFVDLKGFLVSL-KFDIDSFSKQSENLPNDHDNELLSLTEIKELLHLFFKFWSNQ 413

Query: 418 XPILVKDEFYHYFNQFKENVLQNLEF--LKTPLQGPALTARRGKIISYKIFGCIILMLCQ 475
            PIL  D F  YFN F E V+++L    LKT +   ++        ++++F   + M+  
Sbjct: 414 VPILNNDHFLLYFNNFVE-VVKDLSSANLKTNVTNTSIVT-----TNHELFALKLSMMLL 467

Query: 476 LGLLSKIKAENLGAT------SKHHRLASYYHKAISLVYMNPYF-GXXXXXXXXXXXXXX 528
           +GLL KIK E +  T      SK+ RL +YYH+   ++  NPYF                
Sbjct: 468 MGLLVKIKMEKIKYTVPKNPNSKYARLMAYYHQLSLIIPKNPYFLNMSTTSLPSLQLLSL 527

Query: 529 XXXXXXNIGNVSAIYELRGRVVSMAQQLRLHRCPSAVLG-GAGSTMNKREQGDRRVLFWG 587
                 N+G++SAIY +RGR+VSMAQQLRLHRCPSAVL   +   + K EQ +RR+LFW 
Sbjct: 528 ASFYYLNVGDISAIYGVRGRIVSMAQQLRLHRCPSAVLSVHSNPVLQKFEQSERRLLFWA 587

Query: 588 IYYLDVFSALQLGVPRLIKDFEIECALPVADNDDR--------TVNLAGQQIRLEGQVTN 639
           IYY+DVF++LQLGVPRL+KDF+IECALP++D + +          N   ++I+L+GQV++
Sbjct: 588 IYYVDVFASLQLGVPRLLKDFDIECALPISDVEYKDQLFMENKKTNKKAKKIQLQGQVSS 647

Query: 640 YSLAIIRFSKVLGNILDSIFKRGMT-ESITKQVSLIHENALDNWRHGLPKELIFELDVNG 698
           +SL IIRF+K+LGNILDSIFKRGM  E IT +V+L+HENALDNWR  LPK   F++ VNG
Sbjct: 648 FSLQIIRFAKILGNILDSIFKRGMMDERITSEVALVHENALDNWRSQLPKMYYFQITVNG 707

Query: 699 TINIDEF--NRLKQMNVTVERS-----ENMTLLVMYFLAKCMIHLPVVATRPLPTNDSND 751
           T+N+DE   N  K +    E+      E   LL+ YFLAK MIHLPV+AT+PLP N  N 
Sbjct: 708 TVNLDEIRVNDSKNIETRFEKKDIILFEKKILLLFYFLAKSMIHLPVIATKPLPKNIDNG 767

Query: 752 TGETSNATSN---GNNVRARDPSTERNQAAADRSSSSYVLLQQATNTMLNVLESLKTLFL 808
           T +  +  SN   G+N +          + A R+SSSY++LQQATN  L + +++  +++
Sbjct: 768 TKKKQSVFSNDSKGSNDQDHMIVDVDMTSPAIRTSSSYIILQQATNATLMIFQTINWMYI 827

Query: 809 PLPLNISRTKARFALLSARGSLEYTKGGALFLDNKSLLLDVIKDLEEDRKLDLPGVISWN 868
           PLPLN+SRT  RF+LL ARGSLEYTKGGALFLDNK+LLLD IKD+E DR LDLPG  SW+
Sbjct: 828 PLPLNVSRTLIRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLDLPGTASWH 887

Query: 869 SLKLLDMSINLLLQPPNTEV 888
           +LKL DM+INLLL+ PN +V
Sbjct: 888 TLKLYDMTINLLLKAPNVKV 907

>Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa]
           {ON} YMR280C (REAL)
          Length = 1432

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/869 (46%), Positives = 525/869 (60%), Gaps = 69/869 (7%)

Query: 81  REGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRR 140
           +E   N +  +P  +   R+AQACDRCRSKKTRCDGKRPQCSQCAAVGFEC+ISD+L R+
Sbjct: 46  KEATVNTTSPTPLSTPIYRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRK 105

Query: 141 AFPRGYXXXXXXXXXXXXXXXXXXXXXCDIKEQQIHLFSQQH-SPGGRRKDDERMLRELQ 199
           A+P+GY                     CDIKEQQI L SQ   S       D    +EL+
Sbjct: 106 AYPKGYTESLEERVRELEAENKRLLALCDIKEQQISLVSQSRPSTSLDSNVDGNCKKELK 165

Query: 200 SANGGSLNISSTNLYLLNTGSHXXXXXXXXXXXXXXXXXXXXP---------HVCDGLCC 250
            A    LN+SSTN+YLLN   +                              HVCDG+ C
Sbjct: 166 DA---PLNLSSTNIYLLNQTVNKQLQSGKMDNDNSDAAIDSLAASPSPPPKDHVCDGVSC 222

Query: 251 AGKLHVKPVSTNLNDPTSVSFEQSEAPGLPAVQALTSVATREQSNQLATLVALSVPRSTE 310
             +LHVKP ST+L+DPT++SFEQ+EAPGLPAV+AL S+ T ++S QLATLV+LS+PRSTE
Sbjct: 223 TNRLHVKPTSTSLSDPTAISFEQNEAPGLPAVKALKSMTTHQRSTQLATLVSLSIPRSTE 282

Query: 311 EILFIPQLLARIRQIYGFTSKQCLYTVXXXXXXXXXXPEPHLV----------KHEP--- 357
           EILFIPQLL RIRQI+GF SKQCLYTV          P P ++          K+E    
Sbjct: 283 EILFIPQLLTRIRQIFGFNSKQCLYTVSLLSSLKNRLPAPSILLPSTSTNSKEKNEDKTP 342

Query: 358 ------LETLASTNLWEMDDLEQFFAEIFKFKLES--KSPSSYKGGAQ---LNXXXXXXX 406
                 L+T  ST+L E  DL++F   + KF ++S  K P     G     L+       
Sbjct: 343 NDDSAFLKTFQSTSLSEFVDLKKFLISL-KFDIDSFSKQPEKQANGHDSDLLSLTEIKEL 401

Query: 407 XXXXXXXXXXXXPILVKDEFYHYFNQFKENVLQNLEFLKTPLQGPALTARRGKIISYKIF 466
                       PIL  D F  YFN F E ++++   + T       T +     +++IF
Sbjct: 402 LHLFFKFWSNQVPILNNDHFLLYFNNFVE-IIKDFSLISTKANS---TTKNNVTTNHEIF 457

Query: 467 GCIILMLCQLGLLSKIKAENLGAT------SKHHRLASYYHKAISLVYMNPYF-GXXXXX 519
              +LM+ Q+GLL KIK + +  T      +K+ RL SYYH+   ++  NPYF       
Sbjct: 458 TLKLLMMLQMGLLIKIKKDKIKDTVPRNSNAKYIRLMSYYHQISLIIPKNPYFLNMSTTS 517

Query: 520 XXXXXXXXXXXXXXXNIGNVSAIYELRGRVVSMAQQLRLHRCPSAVLG-GAGSTMNKREQ 578
                          N+G++SAIY +RGR+VSMAQQLRLHRCPSAVL   +   + K EQ
Sbjct: 518 LPSLQLLSLASFYYLNVGDISAIYGIRGRIVSMAQQLRLHRCPSAVLSVHSNPVLQKFEQ 577

Query: 579 GDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVAD--------NDDRTVNLAGQQ 630
            +RR+LFW IYY+DVF++LQLGVPRL+KDF+IECALP++D         ++  +    ++
Sbjct: 578 SERRLLFWAIYYVDVFASLQLGVPRLLKDFDIECALPISDVEYKDQLSMENEKMKNKAKK 637

Query: 631 IRLEGQVTNYSLAIIRFSKVLGNILDSIFKRGMT-ESITKQVSLIHENALDNWRHGLPKE 689
           I+L+GQV+++SL IIRF+K+LGNILDSIFKRGM  E I+ +V+L+HENALDNWR+ LP+ 
Sbjct: 638 IQLQGQVSSFSLQIIRFAKILGNILDSIFKRGMMDERISSEVALVHENALDNWRNQLPEM 697

Query: 690 LIFELDVNGTINIDEF--NRLKQMNVTVERS-----ENMTLLVMYFLAKCMIHLPVVATR 742
             F++ VNGT+N+DE   N  + +    E       E   LL+ YFLAK MIHLPV+AT+
Sbjct: 698 YYFKITVNGTVNLDEIRANNSRDIETPFETKDIILFEKKILLLFYFLAKSMIHLPVIATK 757

Query: 743 PLPTNDSNDTGETS---NATSNGNNVRARDPSTERNQAAADRSSSSYVLLQQATNTMLNV 799
           PL  N  N   +     N  S G N            + A R+SSSY++LQQATN  L +
Sbjct: 758 PLSKNVDNVMKKKQSMFNNDSKGTNNHDHMAVDVDMTSPAIRTSSSYIILQQATNATLTI 817

Query: 800 LESLKTLFLPLPLNISRTKARFALLSARGSLEYTKGGALFLDNKSLLLDVIKDLEEDRKL 859
            +S+  ++LPLPLN+SRT  RF+LL ARGSLEYTKGGALFLDNK+LLLD IKD+E DR L
Sbjct: 818 FQSINWMYLPLPLNVSRTLVRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLL 877

Query: 860 DLPGVISWNSLKLLDMSINLLLQPPNTEV 888
           +LPG+ SW++LKL DM+INLLL+ PN +V
Sbjct: 878 ELPGIASWHTLKLFDMTINLLLKAPNVKV 906

>KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} similar to
            uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
            similar to YMR280C uniprot|P39113 Saccharomyces
            cerevisiae YMR280C CAT8 Zinc cluster transcriptional
            activator
          Length = 1445

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/690 (50%), Positives = 459/690 (66%), Gaps = 51/690 (7%)

Query: 265  DPTSVSFEQSEAPGLPAVQALTSVATREQSNQLATLVALSVPRSTEEILFIPQLLARIRQ 324
            DP  +SFEQ+EAPGLPA++AL+S++  +Q  QLATLVA+SVPR+TEEILF+PQLLARI Q
Sbjct: 371  DPYGISFEQNEAPGLPALKALSSLSKYKQGTQLATLVAVSVPRTTEEILFVPQLLARIGQ 430

Query: 325  IYGFTSKQCLYTVXXXXXXXXXXPEPHLVKHEP-LETLASTNLWEMDDLEQFFAEIFKFK 383
            I+GFTSKQC+YT            E ++    P LE L + NLWE+DD+  F+  +FK  
Sbjct: 431  IHGFTSKQCIYTASVLASLK----ENNISSIPPELEVLKNHNLWEIDDVLHFWKNVFKLD 486

Query: 384  LESKSPSSYKGGAQLNXXXXXXXXXXXXXXXXXXXPILVKDEFYHYFNQFKENVLQNLEF 443
              + +   +     LN                   P+  K+EF  Y+ +FK NV     F
Sbjct: 487  FMTHTAVDH-SSTHLNFAEVEELMQLFFQDWYELIPLFDKNEFNSYYEKFKLNVTDPNFF 545

Query: 444  LKTPLQGPALTARRGKIISYKIFGCIILMLCQLGLLSKIKAENLGATSKHHRLASYYHKA 503
            ++   +   +   R + ISYKIF C+++++ Q+G+LSKIK + +  + K   L  YY K 
Sbjct: 546  VR---KDDTVFNNRTRSISYKIFSCLLIIIVQMGMLSKIKRDKI-TSGKLSTLMKYYDKL 601

Query: 504  ISLVYMNPYFGXXXXXXXXXXXXXXXXXXXXNIGNVSAIYELRGRVVSMAQQLRLHRCPS 563
            ++ +++NPYF                     N+G++S+IYELRG+VVSM+QQLRLHRCPS
Sbjct: 602  MTHIWINPYFNSRNTSIQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLRLHRCPS 661

Query: 564  AVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVADNDDRT 623
            AVLGG GST++K +QG+RR+LFW IYYLDVFSALQLGVPRL+KDFEIECALPV  +DDR 
Sbjct: 662  AVLGGDGSTVSKVQQGERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDRQ 721

Query: 624  VNLAGQQIRLEGQVTNYSLAIIRFSKVLGNILDSIFKRGMTESITKQVSLIHENALDNWR 683
            VNLAGQ I LEG+V+ +SL++IRF+KV+GNILDS FKRGMT S+TKQ +L+HENALDNWR
Sbjct: 722  VNLAGQMIALEGKVSQFSLSVIRFAKVMGNILDSTFKRGMTTSLTKQAALVHENALDNWR 781

Query: 684  HGLPKELIFELDVNGTINIDEFNRLKQMNVTVE------RSENMTLLVMYFLAKCMIHLP 737
            HGL K+L F+LDVNGTIN+DEFN+ KQ + ++          ++ L+ +YF+AKCMIHLP
Sbjct: 782  HGLQKDLFFQLDVNGTINMDEFNQQKQYSKSLSPRTAAFTHNSLVLMTLYFMAKCMIHLP 841

Query: 738  VVATRPLPTNDSNDTGETSNATSNGNNVRARDPSTERNQAAADRSSSSYVLLQQATNTML 797
            VVAT+PL          T N T NG               + DRS SSYVLLQQATNT+L
Sbjct: 842  VVATKPLVAEAIQT--PTDNQTENG---------------SVDRSLSSYVLLQQATNTLL 884

Query: 798  NVLESLKTLFLPLPLNISRTKARFALLSARGSLEYTKGGALFLDNKSLLLDVIKDLEEDR 857
            NVL +L +++LPLP+N++RTK RF L SARGSLEYTKGGALF DNK+LLLD++K+LE D+
Sbjct: 885  NVLTALNSIYLPLPINLARTKTRFGLFSARGSLEYTKGGALFQDNKALLLDLVKELETDK 944

Query: 858  KLDLPGVISWNSLKLLDMSINLLLQPPNTEVGXXXXXXXXXXXXXXXXMGRPTV----KQ 913
            KL+LPG  SW+SLKL D+SINL+LQP N+                   MG+PTV    K+
Sbjct: 945  KLELPGNTSWHSLKLFDLSINLILQPVNSNPEKTEKMIQKKINYYNKLMGQPTVAVKRKR 1004

Query: 914  EPASKGHDLTPASSKDEEDTPAAKRIKIEE 943
            +P            K  E+T  +K++K+E+
Sbjct: 1005 DP------------KATENT--SKKVKVED 1020

 Score =  150 bits (378), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 83/125 (66%), Gaps = 6/125 (4%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGYXXXXXXXXXXXX 158
           RVAQACDRCR+KK RCDGKRPQC+QCAAVGFECKISD+LSRRAFPRGY            
Sbjct: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGYTETLEERVRELE 237

Query: 159 XXXXXXXXXCDIKEQQIHLFSQQHSPGGRR------KDDERMLRELQSANGGSLNISSTN 212
                    CD+KE+Q+HL S+  +            ++E++L EL   NGGSL +SSTN
Sbjct: 238 AENRRLVALCDLKEEQLHLVSKYSNSKDENGVEIPSTEEEQILHELSKTNGGSLRVSSTN 297

Query: 213 LYLLN 217
           LYLLN
Sbjct: 298 LYLLN 302

 Score = 56.2 bits (134), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/121 (39%), Positives = 58/121 (47%), Gaps = 31/121 (25%)

Query: 1058 LFKVPSTADFLMDDSANSQLNFLLGT------------TELGVLDPSQPSYTNNPGSGSA 1105
            LFKVPS  DFL D   N+  N  L              ++LG L  S  S TN P S + 
Sbjct: 1182 LFKVPSNGDFLKDYYINNMSNTGLSNLHTSSVNKGPSLSQLGSLFMSSGSGTNLPYS-NV 1240

Query: 1106 IGINNMPSGLNLSNLFDLEGSTDXXXXXXXXXXXXXXXSGGFNFAVDASLGLAPLLAWTP 1165
             G +  PSG+NL N    + + D                 GF+FA DASLGLAPLLAW+P
Sbjct: 1241 RGESKHPSGVNL-NKQRAQPAMD-----------------GFSFAADASLGLAPLLAWSP 1282

Query: 1166 D 1166
            D
Sbjct: 1283 D 1283

>NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845
          Length = 1164

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/839 (45%), Positives = 484/839 (57%), Gaps = 119/839 (14%)

Query: 97  NLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGYXXXXXXXXXX 156
           NLR+AQACDRCRSKKTRCDGKRPQCSQCA VGFECKISD+L R++FPRGY          
Sbjct: 74  NLRIAQACDRCRSKKTRCDGKRPQCSQCAIVGFECKISDKLQRKSFPRGYTETLEEKVRE 133

Query: 157 XXXXXXXXXXXCDIKEQQIHLFSQQHSPGGRRKDDERMLRELQSANGGSLNISSTNLYLL 216
                      C         F++  S      D+     E+ S    S   SST    +
Sbjct: 134 LENENRRLLAICQ--------FNKLQSQKNDTIDNSTTQEEVYSIRSNS--ASST---AI 180

Query: 217 NTGSHXXXXXXXXXXXXXXXXXXXXPHVCDGLCCAG----KLHVKPVSTNLNDPTSV-SF 271
            T S+                       C    C       LH+KPVST    P ++ SF
Sbjct: 181 ETDSNIT--------------------TCLDTNCNNDTHNHLHMKPVSTK--PPQNIISF 218

Query: 272 EQSEAPGLPAVQALTSVATREQSNQLATLVALSVPRSTEEILFIPQLLARIRQIYGFTSK 331
           EQ+EAPGL AV+AL S+A  EQS QLATLVAL++PRST+EILFIPQLL++IRQ +GFTSK
Sbjct: 219 EQNEAPGLSAVKALKSMANHEQSTQLATLVALAIPRSTDEILFIPQLLSKIRQNFGFTSK 278

Query: 332 QCLYTVXXXXXXXXXXPEPHLVKH------EPLETLASTNLWEMDDLEQFFAEIFKFKLE 385
            CLYTV          P P ++ +      + L  L  TNLW+ DDL QF  +  K    
Sbjct: 279 HCLYTVSLLSSLKPNLPPPKMIANNLEMTKKLLNQLKITNLWKFDDLSQFINQYLKL--- 335

Query: 386 SKSPSSYKGGAQL-NXXXXXXXXXXXXXXXXXXXPILVKDEFYHYFNQFKENVLQNLEFL 444
              P + K    L N                   PI+ K+EF   +N FK + L+N E  
Sbjct: 336 --DPLNQKNSNDLLNQIEMDELINFFFQDWNDIIPIINKEEFLSNYNAFKLD-LKNSE-- 390

Query: 445 KTPLQGPALTARRGKI-----ISYKIFGCIILMLCQLGLLSKIKAENLGATSKHH--RLA 497
                       R K+     ++YKIFGCI++++CQ+GLL+KIKA N  ++   H   + 
Sbjct: 391 ------------RDKLSSNLKMNYKIFGCILVLMCQMGLLTKIKATNGKSSPNIHLKSIM 438

Query: 498 SYYHKAISLVYMNPYFGXXXXXXXXXXXXXXXXXXXXNIGNVSAIYELRGRVVSMAQQLR 557
           +YYH+ I+ + +N +F                     N+G++SAIYELRGR++SM+QQLR
Sbjct: 439 AYYHQLIANLPINNFFQIATISIPQLKLYVLILFYNLNVGDISAIYELRGRIISMSQQLR 498

Query: 558 LHRCPSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVA 617
           LHRCPSAVL G+  TMNK +Q +RR+LFW IY LD  S+LQLGVPRL+KD+EIECALP+ 
Sbjct: 499 LHRCPSAVLSGSSLTMNKLDQSNRRILFWTIYSLDALSSLQLGVPRLLKDYEIECALPIT 558

Query: 618 DND---DRTVNLAGQQIRLEGQVTNYSLAIIRFSKVLGNILDSIFKRGMTESITKQVSLI 674
             D   D+T      +I+LEG V+ +SLAI RFSK+LGNILD IFKR MTES+TK VSLI
Sbjct: 559 MEDKERDKT------KIKLEGTVSPFSLAIFRFSKILGNILDMIFKRNMTESMTKSVSLI 612

Query: 675 HENALDNWRHGLPKELIFELDVNGTINIDEFNRLKQMNVTVERSENMTLLVMYFLAKCMI 734
           HENALD WR+ LP++L F+L++ G+I   + N + Q N T  + +N+ L+  YF A  MI
Sbjct: 613 HENALDQWRYDLPEDLTFKLNIQGSI---DLNVMHQGNSTPGK-KNLILMFFYFFAVSMI 668

Query: 735 HLPVVATRPLPTNDSNDTGETSNATSNGNNVRARDPSTERNQAAADRSSSSYVLLQQATN 794
           HLPVVA RPL   +                            A  DRSSSSY+ LQ A N
Sbjct: 669 HLPVVAARPLDVKN----------------------------AMPDRSSSSYIALQHAIN 700

Query: 795 TMLNVLESL----KTLFLPLPLNISRTKARFALLSARGSLEYTKGGALFLDNKSLLLDVI 850
           TMLNVLE L    K  +LP+P+N+SR + R AL+S+RG L+Y KGGALFLDNK+LLL VI
Sbjct: 701 TMLNVLELLNNQPKNYYLPVPINMSRLQIRSALISSRGMLDYIKGGALFLDNKTLLLQVI 760

Query: 851 KDLEEDRKLDLPGVISWNSLKLLDMSINLLLQPPNTEVGXXXXXXXXXXXXXXXXMGRP 909
           K+LE DR LDLPGV+SW+SLKL D++I L +Q  N ++                 MG+P
Sbjct: 761 KNLERDRTLDLPGVVSWHSLKLFDLTITLFIQNSNIKLEKLDKILEKKSNYYNKLMGKP 819

>KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.845
            YMR280C
          Length = 1237

 Score =  621 bits (1601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/1100 (37%), Positives = 568/1100 (51%), Gaps = 151/1100 (13%)

Query: 99   RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGYXXXXXXXXXXXX 158
            R +QACDRCR KK +CD KRPQCS CA+VGFECK+SD+L+R +FPRGY            
Sbjct: 171  RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYTESLEERIRELE 230

Query: 159  XXXXXXXXXCDIKEQQIHLFSQQHSPGGRRKDDERMLRELQSANGGSLNISSTNLYLLNT 218
                      D+KEQQ+                 ++  ++QS       ++S+N      
Sbjct: 231  SENRRLLAMNDLKEQQLF----------------KIPEDIQSVVDVDAELNSSN------ 268

Query: 219  GSHXXXXXXXXXXXXXXXXXXXXPHVCDGLCCAG-KLHVKPVSTN--LNDPTSVSFEQSE 275
                                    HVCDG+CC   KLH +PV+TN  LNDPTSVSFEQ+E
Sbjct: 269  ----------------QTKNMYATHVCDGICCQDTKLHSRPVATNFNLNDPTSVSFEQNE 312

Query: 276  APGLPAVQALTSVATREQSNQLATLVALSVPRSTEEILFIPQLLARIRQIYGFTSKQCLY 335
            APGL A +A+  ++  EQS QLA LV+LS+PRSTEEILFIPQLLA+IRQ++GFTSKQCLY
Sbjct: 313  APGLMAARAIDQISNHEQSTQLAILVSLSIPRSTEEILFIPQLLAKIRQVFGFTSKQCLY 372

Query: 336  TVXXXXXXXXXXPEPHLVKHEPL--------ETLASTNLWEMDDLEQFFAEIFKFK-LES 386
            TV          P P+L+K+  +        + L S NLW +++L  FF  + K   L  
Sbjct: 373  TVSLLSSLKDDLPPPNLLKNSKMILQNSSNFDILTSVNLWHLENLSNFFQNVLKLNILPD 432

Query: 387  KSPSSYKGGAQLNXXXXXXXXXXXXXXXXXXXPILVKDEFYHYFNQFKENVLQNLEFLKT 446
                  K    L                    PI  + EF   +  FK +++      K 
Sbjct: 433  DDDHLKKNDDHLALSEIDELVALYFKYWSDSIPIFNEKEFNSNYRVFKADLM------KL 486

Query: 447  PLQGPALTARRGKIISYKIFGCIILMLCQLGLLSKIKAENLGATS-KHHRLASYYHKAIS 505
               GP+       I++ KIFGC++ ++CQ+G+L  IK +N    S K  +L SYYH  + 
Sbjct: 487  SKNGPS---SLENILNIKIFGCLLTVICQMGIL--IKYKNFKNKSPKFEKLLSYYHHLMY 541

Query: 506  LVYMNPYFGXXXXXXXXXXXXXXXXXXXXNIGNVSAIYELRGRVVSMAQQLRLHRCPSAV 565
            ++  N YFG                    N G++  IY+LRG ++SMAQQLRLHRCPSAV
Sbjct: 542  VLPKNSYFGVITTSIKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAV 601

Query: 566  LGGAGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVADNDDRTVN 625
            L G+GS M++ EQG+RR LFW IYYLDVF +LQLGVPRLIKD EIECALP++     T  
Sbjct: 602  LTGSGSKMDRLEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDK 661

Query: 626  LAGQQIRLEGQVTNYSLAIIRFSKVLGNILDSIFKRGMTESITKQVSLIHENALDNWRHG 685
            + G  ++LEG ++ +SL+++R +KVLGNILDSIFKR M+ESIT+QV  IHENALD+WR  
Sbjct: 662  MDG--VQLEGTMSEFSLSVVRCAKVLGNILDSIFKRNMSESITEQVYTIHENALDSWRTK 719

Query: 686  LPKELIFELDVNGTINIDEFNRLKQMNVTVERSENMTLLVMYFLAKCMIHLPVVATRPLP 745
            LPK+  F+L+ NG ++++  N            EN+ L++++FL K MI++P+       
Sbjct: 720  LPKKYQFKLNANGMVDLEHLNH-----------ENLILVLLFFLVKSMIYMPL------- 761

Query: 746  TNDSNDTGETSNATSNGNNVRARDPSTERNQAAADRSSSSYVLLQQATNTMLNVLESLKT 805
                     +S  T   NN + ++     ++        S+  LQQ+ N +L+V +++  
Sbjct: 762  ---------SSAITELANNPKVKNDYYMNHKV-------SHTSLQQSINALLSVFKNINN 805

Query: 806  LFLPLPLNISRTKARFALLSARGSLEYTKGGALFLDNKSLLLDVIKDLEEDRKLDLPGVI 865
             +LPLPLN SRT  RFAL+SA+GSLEY KGG LF DNK LLL VI+++E+DRKL+LPG+I
Sbjct: 806  QYLPLPLNSSRTMTRFALVSAKGSLEYKKGGLLFEDNKVLLLSVIQEIEKDRKLELPGII 865

Query: 866  SWNSLKLLDMSINLLLQPPNTEVGXXXXXXXXXXXXXXXXMGRPTVKQEPASKGHDLTPA 925
             W+SLKLLD+++NL L  P                     MG+P +   P+SK       
Sbjct: 866  PWHSLKLLDLAVNLFLLGPTINSDKLEKFLQKKINYYNKIMGKPLITSLPSSKTKR---K 922

Query: 926  SSKDEEDTPAAKRIKIEETSIPLXXXXXXXXXXXXXXXXVQEKXXXXXXXXXXXXXXXXX 985
             SK++  T   KR +  +T +                   Q                   
Sbjct: 923  QSKEDLFTANKKRKQQVKTELSTLEVKREPQQVQLLKREGQ------------------- 963

Query: 986  XXXXXXXXXXXTAFAEALQLDPVLNSNV-SFQNAPPTTLY--DGPHDQPHQYQHHAQTQP 1042
                       +AF EALQLDP+LN+N+ +F     +  +  +   D P + +  A  QP
Sbjct: 964  ---GNTTESTQSAFVEALQLDPILNANIYNFSGTDLSNFFISNQNGDVPRESREPAVQQP 1020

Query: 1043 QDPHLDTRSSDKLHGLFKVPSTADFLMD--DSANSQLNFLLGTTELG-VLDPSQPSYT-- 1097
                +  R+S        +P+T   ++   DS     N       +G  L    PS+   
Sbjct: 1021 ----IPDRTS--------LPATNTSVVTGFDSLPKPENSKPAKDAIGPSLKKGYPSFIGT 1068

Query: 1098 ---NNPGSGSAIGINN-MP-SGLNLSNLFDLEG---STDXXXXXXXXXXXXXXXSGGFNF 1149
               NN  S   + +NN  P S +NL+ L+  +G   S+                +  F  
Sbjct: 1069 KSHNNSVSTMMMFLNNDYPFSSMNLNALYAPDGYKESSAQPGKQFTLNTGEPHSTYDFGM 1128

Query: 1150 AVDASLGLAPLLAWTPDHNG 1169
             VDASLGLAPLL   P+  G
Sbjct: 1129 IVDASLGLAPLLNEAPEIPG 1148

>KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa] {ON}
           Anc_8.845 YMR280C
          Length = 1246

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/704 (47%), Positives = 445/704 (63%), Gaps = 53/704 (7%)

Query: 243 HVCDGLCCAGKLHVKPVSTNLNDPTSVSFEQSEAPGLPAVQALTSVATREQSNQLATLVA 302
           HVCDG+CC  KLH +PV+TN NDPTS+SFEQSEAPGL A +AL S+  +E++ QLA LV+
Sbjct: 243 HVCDGICCTDKLHPQPVATNYNDPTSISFEQSEAPGLVAAKALKSINNQEEATQLAILVS 302

Query: 303 LSVPRSTEEILFIPQLLARIRQIYGFTSKQCLYTVXXXXXXXXXXPEPH----LVKHEPL 358
           LSVPRSTEEILFIPQLLA+IRQ++GFTSKQCLYTV          P P     +   +  
Sbjct: 303 LSVPRSTEEILFIPQLLAKIRQVHGFTSKQCLYTVSLLSSLKNSLPSPKSDFLMDNSQNS 362

Query: 359 ETLASTNLWEMDDLEQFFAEIFKFKLESKSPSSYKGGAQLNXXXXXXXXXXXXXXXXXXX 418
             L +TN+W+++DL  FF ++ KF + + S +S      L+                   
Sbjct: 363 LLLKNTNIWQINDLNVFFTDLLKFNISNDSKTS----TLLSFDDIDDLTNLYFNHWSNLI 418

Query: 419 PILVKDEFYHYFNQFKENVLQNLEFLKTPLQGPALTARRGKIISYKIFGCIILMLCQLGL 478
           P+L ++EF++ +N FK   +Q   F    +QG     +   +  YK FGC ++++CQ+GL
Sbjct: 419 PVLNEEEFFNRYNNFK---IQCQSF----IQG----NQSNNLRDYKFFGCFLMVMCQMGL 467

Query: 479 LSKIKAENLGATSKHHRLASYYHKAISLVYMNPYFGXXXXXXXXXXXXXXXXXXXXNIGN 538
           L K+K     + +   ++ +YYH+   ++  NP +                     N+GN
Sbjct: 468 LIKLKEH--KSNNSLFKILTYYHQLTYILPKNPVYDFATTSIKSVQLLALLLFYHLNMGN 525

Query: 539 VSAIYELRGRVVSMAQQLRLHRCPSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSALQ 598
           +  IYELRG ++SMA QLRLHRCPSAVL G+GSTM K EQ +RR+LFW IYYLDVFS+LQ
Sbjct: 526 IEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQ 585

Query: 599 LGVPRLIKDFEIECALPVADNDDRTVNLAGQQIRLEGQVTNYSLAIIRFSKVLGNILDSI 658
           LGVPRL+KD+EIECALPV DN      + G  I+LEG V+  SL + RF+KVLGNI+DSI
Sbjct: 586 LGVPRLLKDYEIECALPV-DNTTTMDAIDGTSIKLEGTVSQISLTLFRFAKVLGNIVDSI 644

Query: 659 FKRGMTESITKQVSLIHENALDNWRHGLPKELIFELDVNGTINIDEFNRLKQMNVTVERS 718
           FKR M+ SI++QV+LIHENALDNWR  LP++  F+LDVNGTIN+++ +         E S
Sbjct: 645 FKRNMSTSISRQVALIHENALDNWRSRLPEQFQFKLDVNGTINLNDLD--------TENS 696

Query: 719 ENMTLLVMYFLAKCMIHLPVVATRPLPTNDSNDTGETSNATSNGNNVRARDPSTERNQAA 778
           + + L+V YFLAKCMIHLPV +T+     D  D       T  GN+V             
Sbjct: 697 DTIFLIVFYFLAKCMIHLPVCSTKV----DLEDK-----VTETGNDV-----------IY 736

Query: 779 ADRSSSSYVLLQQATNTMLNVLESLKTLFLPLPLNISRTKARFALLSARGSLEYTKGGAL 838
            DR S+SYV LQQ+TNTMLN L  ++  +LP+P N+SRT  RF L+SA+GSL+Y KGG+L
Sbjct: 737 NDRFSTSYVSLQQSTNTMLNALRMIRDKYLPMPFNVSRTLTRFTLISAKGSLDYIKGGSL 796

Query: 839 FLDNKSLLLDVIKDLEEDRKLDLPGVISWNSLKLLDMSINLLLQPPNTEVGXXXXXXXXX 898
           F+DNK LLLD ++D+E +RKLDLPG+ISW+SLKLLD+++NL LQ  NT+           
Sbjct: 797 FIDNKKLLLDCVQDIEANRKLDLPGIISWHSLKLLDLTLNLFLQNSNTKPEKIEKLLQKK 856

Query: 899 XXXXXXXMGRPTVKQEPASKGHDLTPASSKDEEDTPAAKRIKIE 942
                  MG+P VK  P  K  +    ++ DE   P+ K++K E
Sbjct: 857 LNYYNKLMGKPLVKNLPIQKRTNQNKGNNNDE---PSRKKVKKE 897

 Score =  127 bits (318), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 67/147 (45%), Positives = 78/147 (53%), Gaps = 23/147 (15%)

Query: 94  GSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGYXXXXXXX 153
            S N RV QACDRCRSKKTRCDG++PQCSQCAAVGFECK+SD+L R+A+PRGY       
Sbjct: 22  SSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESIEER 81

Query: 154 XXXXXXXXXXXXXXCDIKEQQIHLFSQQHSPGGRRKDDERMLRELQS------------- 200
                         CD+KEQQI L ++  S        +R + EL S             
Sbjct: 82  VRELEAENRRLLALCDLKEQQISLVAKYSSNKSNILPTDRCIIELNSDSDCTNNIKGELN 141

Query: 201 ----------ANGGSLNISSTNLYLLN 217
                      N   LNIS TNLYLLN
Sbjct: 142 KDRQNDVTTIPNSLPLNISQTNLYLLN 168

>Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {ON}
            similar to Ashbya gossypii ABL121C
          Length = 1577

 Score =  564 bits (1454), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 280/473 (59%), Positives = 348/473 (73%), Gaps = 26/473 (5%)

Query: 419  PILVKDEFYHYFNQFKENVLQNLEFLKTPLQGPALTARRGKIISYKIFGCIILMLCQLGL 478
            PI  K EF +Y+ +FKENV    EF  +   G  + A+R K ISYKIF C+++ + Q+GL
Sbjct: 615  PIFDKSEFDNYWQKFKENV-STPEFFTS---GDTIFAKRHKSISYKIFACLLVTVVQMGL 670

Query: 479  LSKIKAENLGATSKHHRLASYYHKAISLVYMNPYFGXXXXXXXXXXXXXXXXXXXXNIGN 538
            ++K+K ENLG   K + L +YY +A+S +  NPYFG                    N+G+
Sbjct: 671  MTKVKRENLGRRHKLNILMTYYDRALSHIITNPYFGSNSTSIQSLQLLSLLLFYFLNVGD 730

Query: 539  VSAIYELRGRVVSMAQQLRLHRCPSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSALQ 598
            +S IYELRG+VVS AQQLRLHRCPSAVLGG G T+++ +QG+RRVLFWG+YYLDVF++LQ
Sbjct: 731  ISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGERRVLFWGVYYLDVFASLQ 790

Query: 599  LGVPRLIKDFEIECALPVADNDDRTVNLAGQQIRLEGQVTNYSLAIIRFSKVLGNILDSI 658
            LGVPRL+KD EIECALPV+ + DR VNLAGQ I LEG+++ +SL++IRFSKVLGN+LDSI
Sbjct: 791  LGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEGKMSPFSLSVIRFSKVLGNVLDSI 850

Query: 659  FKRGMTESITKQVSLIHENALDNWRHGLPKELIFELDVNGTINIDEFNRLKQMNVTVERS 718
            FKRGMT SITK+V+L+HENALDNWRHGLP  L F+LDVNGTIN+DEFN+LK   +  + S
Sbjct: 851  FKRGMTISITKEVALVHENALDNWRHGLPDGLRFQLDVNGTINMDEFNQLKHEYLNNDNS 910

Query: 719  ----ENMTLLVMYFLAKCMIHLPVVATRPLPTNDSNDTGETSNATSNGNNVRARDPSTER 774
                EN   + +YFLAK MIH+PVVA +P P + S                   DP+  R
Sbjct: 911  KFNKENFIFMTLYFLAKSMIHIPVVAGKP-PVDTSVQ--------------EKNDPAISR 955

Query: 775  NQAAADRSSSSYVLLQQATNTMLNVLESLKTLFLPLPLNISRTKARFALLSARGSLEYTK 834
                ADRSSSSY+LLQQATNT LNVL S++T +LPLP+NISR K RF L SARGSLEYTK
Sbjct: 956  Q---ADRSSSSYILLQQATNTFLNVLTSMRTAYLPLPINISRAKTRFGLFSARGSLEYTK 1012

Query: 835  GGALFLDNKSLLLDVIKDLEEDRKLDLPGVISWNSLKLLDMSINLLLQPPNTE 887
            GGALF DNKSLLL++IK+LE DRKL +PG ISW+SLKL DM+INL+LQPPNT+
Sbjct: 1013 GGALFQDNKSLLLNLIKELEVDRKLGIPGTISWHSLKLFDMAINLILQPPNTK 1065

 Score =  154 bits (388), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 94/240 (39%), Positives = 130/240 (54%), Gaps = 45/240 (18%)

Query: 190 DDERMLRELQSANGGSLNISSTNLYLLNTGSHXXXXXXXXXXXXXXXXXXXXP------- 242
           +++R+L++L  ++GG+L +SSTNLYLLN  +                     P       
Sbjct: 271 EEDRILQQLSKSDGGTLRVSSTNLYLLNKKTSGQQQLLLPGSANKSEAFPIQPDSYKLQQ 330

Query: 243 --------HVCDGLCCA--GKLHVKPVS-----------------------TNLNDPTSV 269
                   HV D    A   K H++P +                        NLNDPTS+
Sbjct: 331 RSQSTASSHVADSDNPAEFQKEHLQPRTLPNIPVASTAIPSAPPGVTAYSLANLNDPTSI 390

Query: 270 SFEQSEAPGLPAVQALTSVATREQSNQLATLVALSVPRSTEEILFIPQLLARIRQIYGFT 329
           SFEQ +APGL AV+AL+++A  EQS+QLATLVA+S+PR+TEEILF+PQLLARI Q++GFT
Sbjct: 391 SFEQDQAPGLSAVKALSTMANHEQSSQLATLVAMSIPRTTEEILFVPQLLARIGQVHGFT 450

Query: 330 SKQCLYTVXXXXXXXXXXPEPHLVKHEP-LETLASTNLWEMDDLEQFFAEIFKFKLESKS 388
           SKQCLYT           P     +  P LE L S +LWE+DD++ F ++  +F   S +
Sbjct: 451 SKQCLYTASVLASLKEIVP----YQTSPELELLRSKSLWEIDDVDSFLSKGLRFSFPSAT 506

 Score =  123 bits (309), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 54/82 (65%), Positives = 59/82 (71%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGYXXXXXXXXXXXX 158
           RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD+LSRRAFPRGY            
Sbjct: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYTETLEERVRELE 183

Query: 159 XXXXXXXXXCDIKEQQIHLFSQ 180
                    CD+KE+Q+ L S+
Sbjct: 184 AENRRLVALCDLKEEQLRLVSK 205

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 46/125 (36%), Gaps = 17/125 (13%)

Query: 1057 GLFKVPSTADFLMD-----DSANSQLNFLLGTTELGVLDPS-QPSYTNNPGSGSAIGINN 1110
            GLFKVPS  DFL D      SA     F+ G TE  +  P+    Y  +   G  + +  
Sbjct: 1296 GLFKVPSNGDFLKDYYSGMSSAQLASLFVNGNTENALQKPTDHRRYQPSQSQGQQLHLQP 1355

Query: 1111 MPSGLNLSNL----------FDLEGSTDXXXXXXXXXXXXXXXSGGFNFAVDASLGLAPL 1160
             P                  + LE                    G + F VDASLGLA L
Sbjct: 1356 HPEPQRQRQQQQQQHPDHQRYPLEDEPGICEQSKIRTEKKNQQQG-YGFVVDASLGLASL 1414

Query: 1161 LAWTP 1165
            L W+P
Sbjct: 1415 LGWSP 1419

>CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]
           {ON} similar to uniprot|P39113 Saccharomyces cerevisiae
           YMR280c CAT8 transcription factor involved in
           gluconeogenesis
          Length = 1254

 Score =  545 bits (1403), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 355/872 (40%), Positives = 483/872 (55%), Gaps = 110/872 (12%)

Query: 83  GGGNGSIASPAGSQ----NLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLS 138
             GN    S  GS+      RVAQACDRCR KKT+CDGK PQCSQCA VGFECKISDRL+
Sbjct: 35  ANGNSVSGSNTGSRGSTPTYRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLN 94

Query: 139 RRAFPRGYXXXXXXXXXXXXXXXXXXXXXC--DIKEQQIHLFSQQHSPGGRRKDDERMLR 196
           R++FPRGY                     C  D+         ++ SP  +RK    M R
Sbjct: 95  RKSFPRGYTETLEERVRELETENKRLMALCNSDLGSNTRSDGLEKQSPS-KRKRSPSMER 153

Query: 197 ELQSANGGSLNISSTNLYLLNTGSHXXXXXXXXXXXXXXXXXXXXPHVCDGLCCAGKLHV 256
           +  S  G + N+    L L  + S                      H C        +H+
Sbjct: 154 D--SERGFTENME---LQLQQSCSSCGNSDPN--------------HRC--------VHL 186

Query: 257 KPVSTNL--NDPTSVSFEQSEAPGLPAVQALTSVATREQSNQLATLVALSVPRSTEEILF 314
           KPV +N+  +  T VSFEQ+ APGLPAV+AL S+A RE+S QLA LV+L++PRSTEEILF
Sbjct: 187 KPVVSNIIVDSNTDVSFEQNVAPGLPAVKALNSMAEREESAQLAMLVSLALPRSTEEILF 246

Query: 315 IPQLLARIRQIYGFTSKQCLYTVXXXXXXXXXXPEPHLVKHEPLETLASTNLWEMDDLEQ 374
           IPQL+A I++ +GF+SKQ LYTV          P P+   +   E L S N +  +D   
Sbjct: 247 IPQLMANIQKTFGFSSKQSLYTVSLLSSLKKNLPTPN--SNSSDENL-SPNYYVSEDFRP 303

Query: 375 FFAEIFKFKL-----------ESKSPSSY----KGGAQLNXXXXXXXXXXXXXXXXXXXP 419
           FF E+ KF +            ++SP S     +    L+                   P
Sbjct: 304 FFYEVLKFDILGETETENGSNRNESPDSTIPNSRSDDLLSWMEIQRLVDVYFECWSNTIP 363

Query: 420 ILVKDEFYHYFNQFKENVLQN----LEFLKTPLQGPALTARRGKIISYKIFGCIILMLCQ 475
           I  +  F      FK  V +      E  KT          + KI   KIF  ++ ++CQ
Sbjct: 364 IFSRKLFIKQMKAFKTEVDKFGDRLFEVYKT---------EQIKINFLKIFATVLAVMCQ 414

Query: 476 LGLLSKIKAENLGATSKH------HRLASYYHKAISLVYMNPYF-GXXXXXXXXXXXXXX 528
           + LLS++K   L AT++         L ++Y++ I  ++++ +F                
Sbjct: 415 MALLSRLK--QLEATTQELECKRTQNLIAHYNQLIEKIHLDSFFQDMSTTTVQSLQLLSF 472

Query: 529 XXXXXXNIGNVSAIYELRGRVVSMAQQLRLHRCPSAVL-GGAGSTMNKREQGDRRVLFWG 587
                 N+G++  +Y+LRG V+SMAQQLRLHRCPSAVL   +GSTM K EQG+RR+LFW 
Sbjct: 473 ISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWA 532

Query: 588 IYYLDVFSALQLGVPRLIKDFEIECALPVADNDDRTVNLAGQQIRLEGQVTNYSLAIIRF 647
           IYYLDVF +LQLGVPRLIKD EIECALPV++ +D          +LEG+V+++SLA+IR+
Sbjct: 533 IYYLDVFYSLQLGVPRLIKDHEIECALPVSEEEDS---------QLEGRVSDFSLAVIRY 583

Query: 648 SKVLGNILDSIFKRGM-TESITKQVSLIHENALDNWRHGLPKELIFELDVNGTINIDEFN 706
           +KVLGNILDSIFKR M +E+ T+ ++ +HE ALD W++ LP++  F L+ NG  N DE  
Sbjct: 584 AKVLGNILDSIFKRNMMSEAATESMAFVHEKALDIWKNRLPEKYGFRLEANGLFNFDELT 643

Query: 707 RLKQMNVTVERSENMTLLVMYFLAKCMIHLPVVATRP------LPTNDSNDTGETSNATS 760
            +K  N   +  E  ++L+ YFLAKCMIHLPV+ATR       L    S+DT ET   + 
Sbjct: 644 VVK--NSEKDLIEKSSILLFYFLAKCMIHLPVIATRSASLEQQLQPGTSSDTSETPKESQ 701

Query: 761 NGNNVRARDPSTERNQAAADRSSSSYVLLQQATNTMLNVLESLKTLFLPLPLNISRTKAR 820
           N      + P+         R   SY+L+Q+A +TML V+      +LP P+NISRTKAR
Sbjct: 702 N------KTPT---------RVCPSYILMQKAASTMLQVMHYTSEYYLPSPINISRTKAR 746

Query: 821 FALLSARGSLEYTKGGALFLDNKSLLLDVIKDLEEDRKLDLPGVISWNSLKLLDMSINLL 880
           FALL+A  ++EY KGG+L+++ K+LL ++I  LE +RKLDLPG+ISW+SLKLLDM++ LL
Sbjct: 747 FALLTACSAVEYLKGGSLYVETKNLLENLIIKLELERKLDLPGIISWHSLKLLDMALMLL 806

Query: 881 LQPPNTEVGXXXXXXXXXXXXXXXXMGRPTVK 912
           LQ P T++                 MG P +K
Sbjct: 807 LQSPTTKMEKLDKLVQKKINHYNRQMGIPAMK 838

>NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845
          Length = 1495

 Score =  550 bits (1416), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 310/735 (42%), Positives = 430/735 (58%), Gaps = 82/735 (11%)

Query: 254 LHVKPVSTNLNDPTSVSFEQSEAPGLPAVQALTSVATREQSNQLATLVALSVPRSTEEIL 313
           LH KPVSTN N   S+SFEQ+EAPGL  V+AL S+   E++ QLATLV+L++PRSTEEIL
Sbjct: 290 LHPKPVSTNSNGLNSISFEQNEAPGLSTVKALKSMVNDEKNTQLATLVSLAIPRSTEEIL 349

Query: 314 FIPQLLARIRQIYGFTSKQCLYTVXXXXXXXXXXPEPH------LVKHEPLETLASTNLW 367
           FIPQ+LA++RQ +GFTSK CLYTV             +         ++ LETL +TNLW
Sbjct: 350 FIPQILAKVRQNFGFTSKHCLYTVSLLSSLKSFLSNSNNSISAASADNKNLETLKNTNLW 409

Query: 368 EMDDLEQFFAEIFKFKLESKS-------------------PSSYKGGAQLNXXXXXXXXX 408
           + + L QFF    K      S                    ++  G + L+         
Sbjct: 410 KFNALFQFFTAFLKLDFLDSSLEKQNKGKKNGKVNNNNNNSANQDGISPLSSSEIDELLK 469

Query: 409 XXXXXXXXXXPILVKDEFYHYFNQFKENVLQNLEFLKTPLQGPALTARRGKIISYKIFGC 468
                      ++ + EFY Y++ FK + LQN    K  L           +++YKIFG 
Sbjct: 470 LFFQNWSDFVLMINEKEFYQYYSVFKSD-LQNNNISKMSL---------STLMNYKIFGL 519

Query: 469 IILMLCQLGLLSKIKAENLGATSKH-------HRLASYYHKAISLVYMNPYFGXXXXXXX 521
           IIL+ CQ+GLLSKIK  +    SK+        ++ +YYH  I+ +  N +F        
Sbjct: 520 IILLFCQMGLLSKIKLSSNNTKSKNFKQQYHLKKVMNYYHNLINKLMWNEFFKISNVTLQ 579

Query: 522 XXXXXXXXXXXXXNIGNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGAGSTMNKREQGDR 581
                        ++GN+S IYELR +V+SM+QQLRLHRCPSAVL G+   ++K EQ +R
Sbjct: 580 SLKLLSLILFYNLHMGNISNIYELRSKVISMSQQLRLHRCPSAVLCGSTLKIHKLEQSNR 639

Query: 582 RVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPV-ADNDDRTVNLAGQ----------- 629
           R+LFW IYYLD+F++LQLGVPRL+KD EIECALP+  D D ++ N + +           
Sbjct: 640 RLLFWNIYYLDIFASLQLGVPRLLKDHEIECALPIPMDTDSKSDNQSQRSAATNAENDDN 699

Query: 630 QIRLEGQVTNYSLAIIRFSKVLGNILDSIFKRGMTESITKQVSLIHENALDNWRHGLPKE 689
           +I+LEG V++ SL IIR+S+++GNILD IFKR MTES+TK ++LIH +ALD+WR+ LP  
Sbjct: 700 KIKLEGCVSHLSLVIIRYSQIVGNILDMIFKRNMTESMTKSIALIHIHALDDWRNTLPSN 759

Query: 690 LIFELDVNGTINIDEFNRLKQMNVTVERSENMTLLV--MYFLAKCMIHLPVVATRPLPTN 747
           L F+L+VNG+I++  F   + +N   +R++   LLV  +YF    MIH+PVVA+RPLP  
Sbjct: 760 LKFDLNVNGSIDLSSFIDQQNLNEEEQRTQQQKLLVIFLYFFGVNMIHMPVVASRPLPLV 819

Query: 748 DSNDTGETSNATSNGNNVRARDPSTERNQAAADRSSSSYVLLQQATNTMLNVLESLKTLF 807
           +++   +                         DRSSSSY+ LQ ATNTMLNVL+ L   +
Sbjct: 820 ENDSLNQ-----------------------IPDRSSSSYIALQHATNTMLNVLDLLSPTY 856

Query: 808 LPLPLNISRTKARFALLSARGSLEYTKGGALFLDNKSLLLDVIKDLEEDRKLDLPGVISW 867
           +PLP+N+SRT  RF+++SA G L++ KGG+LFL+NK+LL  V+K++E DR LDLPGVISW
Sbjct: 857 VPLPINMSRTMVRFSMISACGMLDFIKGGSLFLENKALLAQVVKNIETDRFLDLPGVISW 916

Query: 868 NSLKLLDMSINLLLQPPNTEVGXXXXXXXXXXXXXXXXMGRPTVKQEPASKGHDLTPA-- 925
           +SLKL D+++ L  Q  N ++                 MG+P V+  PA K     PA  
Sbjct: 917 HSLKLFDLTLTLFFQNTNIKLEKLDKLLEKKSNYYNRLMGKPIVRN-PAEKNSTTVPASM 975

Query: 926 SSKDEEDTPAAKRIK 940
           S+ DE D P A + K
Sbjct: 976 SAVDETDLPRADKKK 990

 Score =  110 bits (276), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 60/77 (77%)

Query: 70  SMTGSSSQNAQREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGF 129
           S++ SSS + + +        S +G+ + R++QACDRCRSKKTRCDGKRPQCSQCA VGF
Sbjct: 74  SISNSSSTDTKDDSVSISITDSTSGNYSKRISQACDRCRSKKTRCDGKRPQCSQCAIVGF 133

Query: 130 ECKISDRLSRRAFPRGY 146
           ECK+SD+L R+++PRGY
Sbjct: 134 ECKVSDKLQRKSYPRGY 150

>Kpol_1016.20 s1016 (51828..55088) [3261 bp, 1086 aa] {ON}
           (51828..55088) [3261 nt, 1087 aa]
          Length = 1086

 Score = 89.0 bits (219), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 60/114 (52%), Gaps = 24/114 (21%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGYXXXXXXXXXXXX 158
           R++QACDRCR KK +CDG +P CSQC  V F CK SD+L+RR FPRGY            
Sbjct: 93  RLSQACDRCRLKKIKCDGLKPNCSQCLKVNFICKTSDKLTRRGFPRGYTEMLEKEVV--- 149

Query: 159 XXXXXXXXXCDIKEQQIHLFSQQHSPGGRRKDDERMLRELQSANGGSLNISSTN 212
                      + ++++ LF + HS          M  ++Q+   GS NI STN
Sbjct: 150 -----------LLQKKLKLFEENHS---------NMKIDIQTTTDGS-NIISTN 182

>ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa]
           {ON} weakly similar to uniprot|P46954 Saccharomyces
           cerevisiae YJL089W SIP4 Possibly involved in Snf1p
           regulated transcriptional activation shows homology to
           DNA binding domain of Gal4p has a leucine zipper motif
           and acidic region lexA-Sip4p activates transcription
          Length = 1027

 Score = 87.8 bits (216), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 41/54 (75%)

Query: 93  AGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           A ++ +R +QACDRCR KK +CDG +P CSQC  V F C+ SDRL+RR FPRGY
Sbjct: 27  AKNKKMRQSQACDRCRLKKIKCDGMKPTCSQCTKVNFTCRTSDRLTRRGFPRGY 80

>TPHA0I02820 Chr9 complement(620925..624059) [3135 bp, 1044 aa] {ON}
           Anc_1.277 YJL089W
          Length = 1044

 Score = 86.7 bits (213), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 40/50 (80%)

Query: 97  NLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           N+R++QACDRCR KK +CDG +P C+ C+ + F CK SDRL+RR FP+GY
Sbjct: 77  NIRLSQACDRCRLKKIKCDGLKPSCTHCSKIKFACKTSDRLTRRGFPKGY 126

>KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly
           similar to uniprot|P46954 Saccharomyces cerevisiae
           YJL089W SIP4 Possibly involved in Snf1p regulated
           transcriptional activation shows homology to DNA binding
           domain of Gal4p has a leucine zipper motif and acidic
           region lexA-Sip4p activates transcription
          Length = 862

 Score = 84.7 bits (208), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 45/65 (69%), Gaps = 5/65 (7%)

Query: 87  GSIASPAGSQNL-----RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRA 141
           GS  SP  +Q L     R++QACDRCR KK +CDG +P C+ C  +GF C+ SD+LSRR 
Sbjct: 7   GSPLSPKATQLLLSKHARMSQACDRCRLKKIKCDGIKPTCTPCTKIGFHCQTSDKLSRRG 66

Query: 142 FPRGY 146
           FPRGY
Sbjct: 67  FPRGY 71

>AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL089W (SIP4)
          Length = 852

 Score = 84.3 bits (207), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 38/48 (79%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           R +QACDRCR KK +CDG RP C+ C  +G++CK SD+L+RR FPRGY
Sbjct: 24  RSSQACDRCRLKKIKCDGLRPSCTSCKKIGYQCKTSDKLTRRGFPRGY 71

>SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly
           similar to uniprot|P46954 Saccharomyces cerevisiae
           YJL089W SIP4 Possibly involved in Snf1p regulated
           transcriptional activation shows homology to DNA binding
           domain of Gal4p has a leucine zipper motif and acidic
           region lexA-Sip4p activates transcription
          Length = 919

 Score = 84.3 bits (207), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 35/65 (53%), Positives = 44/65 (67%), Gaps = 5/65 (7%)

Query: 87  GSIASPAG-----SQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRA 141
           G+  SP G     S+  R +QACDRCR KK +CDG +P C+ C  VGF C+ SD+L+RR 
Sbjct: 7   GTPTSPKGHPLLLSRQERSSQACDRCRLKKIKCDGLKPNCTSCKKVGFHCQTSDKLTRRG 66

Query: 142 FPRGY 146
           FPRGY
Sbjct: 67  FPRGY 71

>KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.277
           YJL089W
          Length = 725

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 37/49 (75%)

Query: 98  LRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
            RV+QACDRCR KK +CDG++P+CS C  + F C IS +LSRR  P+GY
Sbjct: 10  FRVSQACDRCRLKKIKCDGQKPRCSNCKKINFNCAISTKLSRRGLPKGY 58

>KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON}
           uniprot|Q7Z8R2 Kluyveromyces lactis Sip4 protein
          Length = 717

 Score = 82.8 bits (203), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 30/54 (55%), Positives = 39/54 (72%)

Query: 93  AGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           A ++  R +QACDRCR KK +CDG +P CS C  +G+ C  SD+L+RR FPRGY
Sbjct: 52  ASTKVKRFSQACDRCRLKKIKCDGIKPSCSNCKKIGYHCSTSDKLTRRGFPRGY 105

>Kwal_26.7397 s26 complement(342483..343085) [603 bp, 201 aa] {OFF}
           YJL089W (SIP4) - shows homology to DNA binding domain of
           Gal4p, has a leucine zipper motif and acidic region;
           lexA-Sip4p activates transcription [contig 304] PARTIAL
          Length = 201

 Score = 77.0 bits (188), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 35/65 (53%), Positives = 44/65 (67%), Gaps = 5/65 (7%)

Query: 87  GSIASPAGSQNL-----RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRA 141
           GS  SP  +Q L     R++QACDRCR KK +CDG +P C  C+ + F C+ SD+LSRR 
Sbjct: 7   GSPLSPKATQLLLSNQARMSQACDRCRLKKIKCDGVKPTCGPCSKIKFHCQTSDKLSRRG 66

Query: 142 FPRGY 146
           FPRGY
Sbjct: 67  FPRGY 71

>Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}
           similar to Ashbya gossypii AFR096W
          Length = 952

 Score = 82.0 bits (201), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           R +QACDRCR KK +CDG RP C+ C  +G++C+ SD+L+RR FPRGY
Sbjct: 25  RSSQACDRCRLKKIKCDGVRPSCTSCKKIGYQCRTSDKLTRRGFPRGY 72

>Smik_10.153 Chr10 (257677..260166) [2490 bp, 829 aa] {ON} YJL089W
           (REAL)
          Length = 829

 Score = 81.6 bits (200), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 35/49 (71%)

Query: 98  LRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           +R A ACDRCR KK RCDG +P CS C  + F CK SD+LSRR  P+GY
Sbjct: 40  VRKAHACDRCRLKKIRCDGLKPNCSNCTKINFPCKTSDKLSRRGLPKGY 88

>YJL089W Chr10 (265926..268415) [2490 bp, 829 aa] {ON}  SIP4C6 zinc
           cluster transcriptional activator that binds to the
           carbon source-responsive element (CSRE) of gluconeogenic
           genes; involved in the positive regulation of
           gluconeogenesis; regulated by Snf1p protein kinase;
           localized to the nucleus
          Length = 829

 Score = 81.3 bits (199), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 43/75 (57%), Gaps = 13/75 (17%)

Query: 72  TGSSSQNAQREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           TG SS NA  +               +R A ACDRCR KK +CDG +P CS CA + F C
Sbjct: 27  TGQSSSNAITDFS-------------VRKAHACDRCRLKKIKCDGLKPNCSNCAKIDFPC 73

Query: 132 KISDRLSRRAFPRGY 146
           K SD+LSRR  P+GY
Sbjct: 74  KTSDKLSRRGLPKGY 88

>TDEL0D01450 Chr4 (284869..287706) [2838 bp, 945 aa] {ON} Anc_1.277
           YJL089W
          Length = 945

 Score = 81.6 bits (200), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 53/101 (52%), Gaps = 25/101 (24%)

Query: 71  MTGSSSQNAQREGG-GN----------------GSIASPAGSQNL--------RVAQACD 105
           MTGS S + +  GG GN                G++ +P   + L        R + ACD
Sbjct: 1   MTGSVSASEKESGGAGNSEEGSAAKQQVTKRKYGNLEAPVKEKTLLVTKNERVRHSHACD 60

Query: 106 RCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           RCR KK RCDG +P CSQC+   F C  SD+L+RR FP+GY
Sbjct: 61  RCRLKKVRCDGLKPSCSQCSRANFRCTTSDKLTRRGFPKGY 101

>Skud_10.125 Chr10 (233921..236422) [2502 bp, 833 aa] {ON} YJL089W
           (REAL)
          Length = 833

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/89 (42%), Positives = 48/89 (53%), Gaps = 13/89 (14%)

Query: 58  DSKESSSVPQSASMTGSSSQNAQREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGK 117
           D  +SSS       TG S+ NA  +               +R A ACDRCR KK +CDG 
Sbjct: 13  DDTDSSSNKVLIMPTGQSTSNAITDFS-------------VRKAHACDRCRLKKIKCDGL 59

Query: 118 RPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           +P CS C+ + F CK SD+LSRR  P+GY
Sbjct: 60  KPNCSNCSKIDFPCKTSDKLSRRGLPKGY 88

>Suva_6.161 Chr6
           complement(283370..284500,284547..284764,284948..285781,
           285812..286127) [2499 bp, 832 aa] {ON} YJL089W (REAL)
          Length = 832

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 31/59 (52%), Positives = 39/59 (66%)

Query: 88  SIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           S A+     ++R A ACDRCR KK +CDG +P CS C  + F CK SD+LSRR  P+GY
Sbjct: 30  STANAVPDFSVRKAHACDRCRLKKIKCDGLKPNCSNCGKIDFPCKTSDKLSRRGLPKGY 88

>CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]
           {ON} some similarities with uniprot|P46954 Saccharomyces
           cerevisiae YJL089w SIP4 interacts with SNF1 protein
           kinase
          Length = 1209

 Score = 77.4 bits (189), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 37/48 (77%), Gaps = 1/48 (2%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           R +QACDRCRSKK +CDG +P CS CA +G+ C  SD+LSRR  P+GY
Sbjct: 24  RHSQACDRCRSKKIKCDGLQP-CSNCAKIGYNCVTSDKLSRRGLPKGY 70

>NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON} 
          Length = 1186

 Score = 76.6 bits (187), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 34/48 (70%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           R  QACDRCR KK +CD  +P CSQC    F+CK +D+L+RR F RGY
Sbjct: 117 RKIQACDRCRLKKIKCDDLKPSCSQCLKADFQCKTTDKLARRGFSRGY 164

>KNAG0B01840 Chr2 (345204..348422) [3219 bp, 1072 aa] {ON} Anc_1.277
           YJL089W
          Length = 1072

 Score = 74.7 bits (182), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 34/49 (69%)

Query: 98  LRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
            R  QACDRCR KK +CDG +P C+ CA + F CK S +LSRR  P+GY
Sbjct: 22  FRKNQACDRCRLKKIKCDGLKPTCTNCAKINFLCKTSHKLSRRGLPKGY 70

>TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa]
           {ON} Anc_1.277 YJL089W
          Length = 757

 Score = 72.4 bits (176), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 33/48 (68%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           R +QACDRCR KK +CDG  P C+ C  + F C+ + +LSRR  P+GY
Sbjct: 96  RHSQACDRCRLKKIKCDGLIPHCTNCRKINFNCQTTHKLSRRGLPKGY 143

>NCAS0A09410 Chr1 complement(1865924..1868722) [2799 bp, 932 aa]
           {ON} Anc_1.277
          Length = 932

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 42/72 (58%), Gaps = 1/72 (1%)

Query: 75  SSQNAQREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKIS 134
           ++ N Q++   +G +     S  ++  QACDRCR KK +CD + P C+ C   G  C+ +
Sbjct: 17  NANNLQKKRKNSGQVFV-QDSIFIKRKQACDRCRLKKIKCDDRTPDCTPCMKAGIPCRTT 75

Query: 135 DRLSRRAFPRGY 146
           +RL RR F +GY
Sbjct: 76  ERLKRRGFAKGY 87

>KLLA0E13993g Chr5 complement(1239566..1241602) [2037 bp, 678 aa]
           {ON} some similarities with uniprot|P07272 Saccharomyces
           cerevisiae YLR014C PPR1 Zinc finger transcription factor
           containing a Zn(2)-Cys(6) binuclear cluster domain
           positively regulates transcription of genes involved in
           uracil biosynthesis activity may be modulated by
           interaction with Tup1p
          Length = 678

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 25/44 (56%)

Query: 103 ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           AC  C+ ++ RCDG  PQC  C   G +C   D+++ R  PR Y
Sbjct: 66  ACCFCKRRRKRCDGGFPQCGACVNAGIQCTFVDKITGRELPRDY 109

>TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {ON}
           Anc_2.231 YIL130W
          Length = 1000

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 90  ASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRR 140
            +P   +  RV +ACD CR KK +CDG++P C  C    +EC  +   +RR
Sbjct: 52  GNPIQLKRRRVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPSTRR 101

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 76/162 (46%), Gaps = 14/162 (8%)

Query: 539 VSAIYELRGRVVSMAQQLRLHRC-PSAVLG-GAGSTMNKREQGDRRVLFWGIYYLDVFSA 596
           +S  Y   G  +  A +  LHR  P+  +G G  S  N  E   R+ LF+ IY LD++  
Sbjct: 394 LSTCYSYIGVALRSALREGLHRVIPTNKIGTGTDSRFNCIEIEMRKRLFYTIYKLDIYVN 453

Query: 597 LQLGVPRLIKDFEIECALPVADNDDRTVNLAGQQIRLEGQVTNYSLAII--RFSKVLGNI 654
             LG+PR I   + + +LP   +D+   N+   +I  + Q    S A I  + +K++  I
Sbjct: 454 AMLGLPRSISPNDFDQSLPFDLSDE---NITKDEIFFDRQNNVLSSAGIANQHTKLMM-I 509

Query: 655 LDSIFKRGMTESITKQVSLIHEN------ALDNWRHGLPKEL 690
            DSI         T +  + H++       L++W + LP EL
Sbjct: 510 FDSIITELYPIKKTSKFFISHDSITNFELKLNHWLNNLPIEL 551

>NCAS0D02540 Chr4 complement(484060..486732) [2673 bp, 890 aa] {ON}
           Anc_5.235
          Length = 890

 Score = 52.0 bits (123), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 43/87 (49%), Gaps = 5/87 (5%)

Query: 60  KESSSVPQSASMTGSSSQNAQREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRP 119
           ++ +++    SM      N+ + G  + S  + + S++     AC RCRSKK +CD K P
Sbjct: 2   RKQNTITDGKSMRKKDDGNSLKNGSPSSSTFNTSKSKS-----ACKRCRSKKIKCDQKFP 56

Query: 120 QCSQCAAVGFECKISDRLSRRAFPRGY 146
            C +CA +   C   D  + +  PR Y
Sbjct: 57  SCDRCAHLKVPCVSVDPATGQDVPRSY 83

>Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON}
           (71447..74704) [3258 nt, 1086 aa]
          Length = 1085

 Score = 52.4 bits (124), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 37/79 (46%), Gaps = 5/79 (6%)

Query: 58  DSKESSSVPQSAS-MTGSSSQNAQREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDG 116
           DS  ++ +P +   M  +   N    G    S  S    Q  RVA+ACDRCR +K +CD 
Sbjct: 76  DSNVNTMIPNNNDLMMKNIKDNQHVVGSAIKSNVSTTKVQKRRVARACDRCRKRKIKCDE 135

Query: 117 ----KRPQCSQCAAVGFEC 131
               K  +CS C   G EC
Sbjct: 136 IKNLKVNKCSNCVKYGAEC 154

>Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}
           similar to Ashbya gossypii AER183C
          Length = 898

 Score = 52.0 bits (123), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 33/60 (55%), Gaps = 4/60 (6%)

Query: 84  GGNGSIASPAGSQNL---RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRR 140
           G +G    P  S  L   RV++ACD CR+KK +C+G+ P CS C     EC  +  + RR
Sbjct: 4   GVHGQYMMPEKSMQLPRKRVSKACDTCRAKKIKCNGEEP-CSNCGKHDLECAYTHVIKRR 62

>SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa]
           {ON} some similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 1020

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 71  MTGSSSQNAQREGGGNGSIASPAGSQNL-RVAQACDRCRSKKTRCDGKR--PQCSQCAAV 127
           M  SS Q+++    GNG+  S   ++   +V++ACD+CR KK +CD     P CS C  V
Sbjct: 2   MNDSSDQDSRVLQSGNGTTYSTTETKKRSKVSRACDQCRKKKIKCDVSEDNPVCSGCFKV 61

Query: 128 GFECKISDRLSRRAFPRGY 146
           G  C       +R   +GY
Sbjct: 62  GDRCTFERVPLKRGPSKGY 80

>SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {ON}
           similar to uniprot|P07272 Saccharomyces cerevisiae
           YLR014C PPR1 Zinc finger transcription factor containing
           a Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 898

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           R   AC+RCR+KKT+CD   P C++CA++G  C   D  + R   R Y
Sbjct: 48  RSIVACERCRTKKTKCDQNFPSCARCASLGEPCISVDPATGRVVSRSY 95

>KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {ON}
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 916

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           RV +ACD CR KK +CDGK+P C  C    +EC
Sbjct: 9   RVTRACDECRKKKVKCDGKQP-CIHCTVYNYEC 40

 Score = 40.8 bits (94), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 54/118 (45%), Gaps = 11/118 (9%)

Query: 581 RRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVADNDDRTVNLAGQQIRLEGQVTNY 640
           R+ LF+ IY +D++    LG+PR I   + +  LP+  NDD     A   I  E Q    
Sbjct: 461 RKRLFYTIYKMDIYINTMLGLPRTISPRDFDQELPLELNDDYITEDA---IYPEEQGDVL 517

Query: 641 SLAII--RFSKVLGNILDSIFK-----RGMTESITKQVSLIHENALDNWRHGLPKELI 691
           S A I  + +K+L  ILD I       +     I+ Q+    E  L  W   LP ELI
Sbjct: 518 SSAGIANQHTKILM-ILDQIMADLYPIKKTNNLISHQMVTNLELKLRQWLDQLPPELI 574

>SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 906

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 26/48 (54%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           R   AC RCR KK +CD K P CS+CA+    C   D  + R  PR Y
Sbjct: 38  RSIAACKRCRLKKVKCDQKFPSCSKCASANEPCVSLDPATGRDVPRSY 85

>NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {ON}
           Anc_6.279
          Length = 960

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 27/45 (60%)

Query: 102 QACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           QACD CR KK +C  ++P+C++C   G+EC  S +  R    R +
Sbjct: 10  QACDICRIKKLKCSREKPKCAKCMKNGWECCYSPKAKRSPLTRAH 54

>YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON}
           PDR1Zinc cluster protein that is a master regulator
           involved in recruiting other zinc cluster proteins to
           pleiotropic drug response elements (PDREs) to fine tune
           the regulation of multidrug resistance genes
          Length = 1068

 Score = 50.8 bits (120), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 35/65 (53%), Gaps = 5/65 (7%)

Query: 72  TGSSSQNAQREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           T SS+ ++    G +G I  P      +V++ACD CR +K +C+GK P C+ C     EC
Sbjct: 18  TESSADSSNFSTGFSGKIRKPRS----KVSKACDNCRKRKIKCNGKFP-CASCEIYSCEC 72

Query: 132 KISDR 136
             S R
Sbjct: 73  TFSTR 77

>KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa] {ON}
           weakly similar to uniprot|P07272 Saccharomyces
           cerevisiae YLR014C PPR1 Zinc finger transcription factor
           containing a Zn(2)-Cys(6) binuclear cluster domain
           positively regulates transcription of genes involved in
           uracil biosynthesis activity may be modulated by
           interaction with Tup1p
          Length = 775

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 25/48 (52%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           R   AC RCR +K +CD K P C++C      C   D  +RR  PR Y
Sbjct: 15  RSVAACKRCRIRKIKCDNKFPSCTKCIQAQEPCITIDPSTRREIPRSY 62

>TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa] {ON}
           Anc_6.279 YPL248C
          Length = 1154

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 48/106 (45%), Gaps = 2/106 (1%)

Query: 102 QACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGYXXXXXXXXXXXXXXX 161
           QACD CR KK +C  ++P+C++C    +EC  S R  R    R +               
Sbjct: 16  QACDSCRLKKLKCSKEKPKCAKCLKNIWECCYSPRAKRSPLTRNHLTKVENRLSILELLF 75

Query: 162 XXXXXXCDIKEQQIHLFS-QQHSPGGRRKDDERMLRELQSANGGSL 206
                  DI E+ + L S  + S   +R    ++L+ELQS N  +L
Sbjct: 76  REIFPQTDI-EKILKLDSISKMSDLLKRSVRIQLLKELQSTNPTAL 120

>TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {ON}
           Anc_2.231 YIL130W
          Length = 890

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 61/126 (48%), Gaps = 7/126 (5%)

Query: 570 GSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVADNDDRTVNLAGQ 629
            +T+N  E   R+ +F+ IY LDV+    +G+PR + + + +  LP+  +D+  +   G 
Sbjct: 462 NTTLNPIEIEMRKRIFYTIYKLDVYVNSMMGLPRSLSEDDFDQELPIEISDE-CITENGY 520

Query: 630 QIRLEGQVTNYSLAIIRFSKVLGNILDSIFKR-----GMTESITKQVSLIHENALDNWRH 684
               EGQ  + S++I  +   L  IL  I +R         SIT+   +  EN L  W  
Sbjct: 521 LSEQEGQQLS-SISIANYHTKLYLILADIVQRLYSIKKKNRSITENTVISLENKLRKWAD 579

Query: 685 GLPKEL 690
            LP EL
Sbjct: 580 SLPHEL 585

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 87  GSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
            ++AS    +  RV +ACD CR KK +CDG+ P C  C    ++C
Sbjct: 55  SNVASVTQKKRRRVTRACDECRKKKVKCDGQNP-CIHCTVYSYKC 98

>YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}
           GAL4DNA-binding transcription factor required for the
           activation of the GAL genes in response to galactose;
           repressed by Gal80p and activated by Gal3p
          Length = 881

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 100 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           + QACD CR KK +C  ++P+C++C    +EC+ S +  R    R +
Sbjct: 7   IEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAH 53

>KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {ON}
           Anc_2.231 YIL130W
          Length = 848

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 13  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 44

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 54/115 (46%), Gaps = 7/115 (6%)

Query: 581 RRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVADNDDRTVNLAGQQIRLEGQVTNY 640
           ++ LF+ +Y +D++    LG+PR ++  + +  LP+  +D+          R +G+++  
Sbjct: 372 KKRLFYNVYKMDIYINAMLGLPRSLRVEDFDQTLPIELSDENITAEGYFYERQKGELS-- 429

Query: 641 SLAI----IRFSKVLGNILDSIFKRGMTESITKQVSLIH-ENALDNWRHGLPKEL 690
           S+AI     +   V   I+  ++    T ++    ++   E  L  W   LP EL
Sbjct: 430 SIAISNQHTKLIMVFDTIVSELYPLKKTNNMISHETVTRLEAKLTEWVDNLPVEL 484

>Kpol_1018.30 s1018 complement(81534..83840,83842..84180) [2646 bp,
           881 aa] {ON} complement(81534..83840,83842..84180) [2646
           nt, 882 aa]
          Length = 881

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%)

Query: 97  NLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           N+   Q CD CR KK +C  ++P+C +C    +EC  S ++ R    R +
Sbjct: 3   NIITNQVCDSCRLKKLKCSKEKPKCFKCLKHNWECNYSPKIKRSPLTRAH 52

>Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C
           (REAL)
          Length = 878

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 100 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           + QACD CR KK +C  ++P+C++C    +EC+ S +  R    R +
Sbjct: 7   IEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAH 53

>NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa]
           {ON} Anc_2.231
          Length = 906

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 32  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 63

 Score = 38.9 bits (89), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 54/118 (45%), Gaps = 3/118 (2%)

Query: 581 RRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVADNDDRTVNLAGQQIRLEGQVTNY 640
           R+ LF+ IY LD++    LG+PR I   + +  LP+  +D+             G +++ 
Sbjct: 408 RKRLFYTIYKLDIYVNAMLGLPRSISPDDFDQTLPIELSDENITEHGYLPENQNGVLSST 467

Query: 641 SLA--IIRFSKVLGNILDSIFKRGMTESITKQVSLIH-ENALDNWRHGLPKELIFELD 695
            +A    +   +L +I+  ++    T ++    ++   E  L  W   LP EL+  L+
Sbjct: 468 GIANQHTKLLMILNSIVRELYPIKKTNNLISHETVTRLELKLRTWMDELPTELVPNLE 525

>KNAG0D00690 Chr4 (105640..108267) [2628 bp, 875 aa] {ON} Anc_6.279
           YPL248C
          Length = 875

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 24/45 (53%)

Query: 102 QACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           QACD CR KK +C   +P C +CA  G+ C  S +  R    R +
Sbjct: 19  QACDLCRIKKLKCSKDKPACRKCAKNGWNCTYSPKAKRSPLTRAH 63

>SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {ON}
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 823

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 24/37 (64%), Gaps = 1/37 (2%)

Query: 95  SQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           S+  RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 6   SKRRRVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 41

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 73/161 (45%), Gaps = 13/161 (8%)

Query: 537 GNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSA 596
             +S  Y   G  +  A +  LHR  +  +G  G T  + E   R+ LF+ IY +D++  
Sbjct: 294 ARLSTCYAYIGVAMRSALREGLHR--NLTMGAPGFTPIEIEM--RKRLFFTIYKMDIYLN 349

Query: 597 LQLGVPRLIKDFEIECALPVADNDDRTVNLAGQQIRLEGQVTNYSLAII-----RFSKVL 651
             LG+PR I   + + + P+ + DD  +   G  I  E Q    S A I     +   +L
Sbjct: 350 TMLGLPRAISQRDFDQSFPL-EIDDEYITEDG--IYPERQGDELSSAGIANQHTKLIMIL 406

Query: 652 GNILDSIFKRGMTES-ITKQVSLIHENALDNWRHGLPKELI 691
            NI+  ++    T + I+ +V    E  L  W + LP ELI
Sbjct: 407 DNIVSELYPIKKTNNLISHEVVTNLELKLRQWLNQLPPELI 447

>TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.279
           YPL248C
          Length = 993

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 26/47 (55%)

Query: 100 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           V QACD CR KK RC  + P+C++C    +EC  S R  R    R +
Sbjct: 8   VDQACDSCRIKKLRCSKENPKCAKCLKNKWECCYSPRKRRSPLTRAH 54

>Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W
           (REAL)
          Length = 1012

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 68/160 (42%), Gaps = 12/160 (7%)

Query: 537 GNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSA 596
             +S  Y   G  +  A +   HR  S+  G +   +  R++     LF+ IY LDV+  
Sbjct: 363 ARLSTCYTYIGVAMRSALRAGFHRKLSSSSGFSPIEIEMRKR-----LFYTIYKLDVYIN 417

Query: 597 LQLGVPRLIKDFEIECALPVADNDDRTVNLA----GQQIRLEGQVTNYSLAIIRFSKVLG 652
             LG+PR I   + +  LP+  +D+    +A     Q   L    T  S    +   +L 
Sbjct: 418 AMLGLPRSISPDDFDQTLPLDLSDENITEVAYLPENQHSVLSS--TGISNEHTKLFLILN 475

Query: 653 NILDSIFKRGMTESITKQVSLIH-ENALDNWRHGLPKELI 691
            I+  ++    T +I    ++   E  L NW   LPKELI
Sbjct: 476 EIISELYPIKKTSNIISHETVTSLELKLRNWLDSLPKELI 515

>NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {ON}
           Anc_2.231 YIL130W
          Length = 930

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 34  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 65

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 66/158 (41%), Gaps = 14/158 (8%)

Query: 539 VSAIYELRGRVVSMAQQLRLHRCPSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSALQ 598
           +S  Y   G  +  A +  LHR       G  S  N  E   R+ LF+ IY LD++    
Sbjct: 394 LSTCYSYIGVAMRSALREGLHR-----QVGPNSGFNPIEIEMRKRLFYTIYKLDIYVNAM 448

Query: 599 LGVPRLIKDFEIECALPVADNDDRTVNLAGQQIRLEGQ-----VTNYSLAIIRFSKVLGN 653
           LG+PR I   + +  LP+  +D+   N+  Q    E Q      T  +    +   +L  
Sbjct: 449 LGLPRSISANDFDQTLPLELSDE---NITEQGYFPENQNGVLSSTGIANEHTKLLMILDA 505

Query: 654 ILDSIFKRGMTES-ITKQVSLIHENALDNWRHGLPKEL 690
           I+  ++    T + I+ +     E  L NW   LP EL
Sbjct: 506 IVGELYPIKKTNTFISHETIATLEQKLRNWLDDLPNEL 543

>YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc
           cluster protein proposed to function as a
           transcriptional regulator involved in the stress
           response; null mutants have a respiratory deficiency,
           calcofluor white sensitivity and slightly increased
           cycloheximide resistance
          Length = 964

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 53/116 (45%), Gaps = 7/116 (6%)

Query: 581 RRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVADNDDRTVNLA----GQQIRLEGQ 636
           R+ LF+ IY LDV+    LG+PR I   + +  LP+  +D+    +A     Q   L   
Sbjct: 399 RKRLFYTIYKLDVYINAMLGLPRSISPDDFDQTLPLDLSDENITEVAYLPENQHSVLSS- 457

Query: 637 VTNYSLAIIRFSKVLGNILDSIFKRGMTESITKQVSLIH-ENALDNWRHGLPKELI 691
            T  S    +   +L  I+  ++    T +I    ++   E  L NW   LPKELI
Sbjct: 458 -TGISNEHTKLFLILNEIISELYPIKKTSNIISHETVTSLELKLRNWLDSLPKELI 512

>Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)
          Length = 954

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 65/160 (40%), Gaps = 12/160 (7%)

Query: 537 GNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSA 596
             +S  Y   G  +  A +   HR       G  S  +  E   R+ LF+ IY LDV+  
Sbjct: 361 ARLSTCYTYIGVAMRSALRAGFHR-----KLGTNSGFSPIEIEMRKRLFYTIYKLDVYIN 415

Query: 597 LQLGVPRLIKDFEIECALPVADNDDRTVNLA----GQQIRLEGQVTNYSLAIIRFSKVLG 652
             LG+PR I   + +  LP+  +D+     A     Q   L    T  S    +   +L 
Sbjct: 416 AMLGLPRSISPDDFDQTLPLDLSDENITETAYLPENQNAVLSS--TGISNEHTKLFLILN 473

Query: 653 NILDSIFKRGMTESITKQVSLIH-ENALDNWRHGLPKELI 691
            I+  ++    T +I    ++   E  L NW   LPKELI
Sbjct: 474 EIISELYPIKKTSNIISHETVTSLELKLRNWLDSLPKELI 513

>KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly
           similar to uniprot|P52960 Saccharomyces cerevisiae
           YOR363C PIP2 peroxisome induction pathway 2 (PIP2)
           transcriptional activator of peroxisome proliferation
           may form heterodimer with Oaf1 to activate
           oleate-inducible gene expression activator of peroxisome
           proliferation
          Length = 847

 Score = 49.7 bits (117), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 89  IASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK--ISDRLSRRAFP 143
           +A  +    LR++  C  CR +K +CD  +P+C +CA +G EC   +S+++S +  P
Sbjct: 17  LAVRSKKSRLRLSFVCRNCRKRKIKCDKAQPKCGRCAKLGLECNYDLSEQISLKKTP 73

>NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2.547
          Length = 1141

 Score = 49.7 bits (117), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 44/91 (48%), Gaps = 6/91 (6%)

Query: 62  SSSVPQSASMTGSSSQNAQRE----GGGNGSIASPAGSQNLRVAQACDRCRSKKTRCD-- 115
           +SS P+ A M GS     +R      G N +  S +  +  + ++ACD+CR KK +CD  
Sbjct: 29  NSSSPEKAIMEGSQIHMDRRHSISAAGTNAASNSSSQKKRTKASRACDQCRKKKIKCDFS 88

Query: 116 GKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
            ++  CS C   G +C       +R   +GY
Sbjct: 89  EEKTLCSNCQRNGEKCTFERVPLKRGPSKGY 119

>KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON} 
          Length = 888

 Score = 49.7 bits (117), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 30/61 (49%), Gaps = 2/61 (3%)

Query: 88  SIASPAGSQNL--RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRG 145
           SI S A   N   +   AC RCRSKKT+CD K P C +C  +   C   D  +    PR 
Sbjct: 28  SIESAAKRSNSIPKSRSACKRCRSKKTKCDQKLPSCGKCTKLNTPCISVDPATGEDVPRS 87

Query: 146 Y 146
           Y
Sbjct: 88  Y 88

>NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279
          Length = 890

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%)

Query: 100 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPR 144
           + QACD CR KK +C  + P+CS+C   G +C  S ++ R    R
Sbjct: 16  IEQACDNCRLKKLKCSKETPKCSKCLKNGMKCLYSPKVKRSPLTR 60

>Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W
           (REAL)
          Length = 926

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 69/160 (43%), Gaps = 12/160 (7%)

Query: 537 GNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSA 596
             +S  Y   G  +  A +   HR  SA    +G T  + E   R+ LF+ IY LDV+  
Sbjct: 360 ARLSTCYTYIGVAMRSALRAGFHRKLSA---NSGFTPIEIEM--RKRLFYTIYKLDVYIN 414

Query: 597 LQLGVPRLIKDFEIECALPVADNDDRTVNLA----GQQIRLEGQVTNYSLAIIRFSKVLG 652
             LG+PR I   + +  LP+  +D+    +A     Q   L    T  S    +   +L 
Sbjct: 415 AMLGLPRSISPEDFDQTLPLDLSDENITEVAYLPENQNAVLSS--TGISNEHTKLFLILN 472

Query: 653 NILDSIFKRGMTESITKQVSLIH-ENALDNWRHGLPKELI 691
            I+  ++    T +I    ++   E  L NW   LPKEL+
Sbjct: 473 EIISELYPIKKTNNIISHETVTSLELKLRNWLDSLPKELM 512

>TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.231
           YIL130W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 852

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 15  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 46

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 69/159 (43%), Gaps = 14/159 (8%)

Query: 539 VSAIYELRGRVVSMAQQLRLHRCPSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSALQ 598
           +S  Y   G  +  A +  LHR  S   G +   +  R++     LF+ IY LDV+    
Sbjct: 348 LSTCYAYIGVAMRSALREGLHRSVSPDSGFSPIEIEMRKR-----LFYTIYKLDVYVNAM 402

Query: 599 LGVPRLIKDFEIECALPVADNDDRTVNLAGQQIRLEGQVTNYSLAII-----RFSKVLGN 653
           LG+PR I   + +  LP+  +D+   N+  +    E Q    S A I     +   +L  
Sbjct: 403 LGLPRSISSNDFDQTLPIELSDE---NITEEGYFPENQKGKLSSAEIANQHTKLIMILNV 459

Query: 654 ILDSIFK-RGMTESITKQVSLIHENALDNWRHGLPKELI 691
           I+  ++  R     I  +V    E  L  W  GLP+ELI
Sbjct: 460 IVGELYPIRKTNNLIRHEVVTELELKLRQWLDGLPRELI 498

>ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} similar
           to uniprot|P04386 Saccharomyces cerevisiae YPL248C GAL4
           DNA-binding transcription factor required for the
           activation of the GAL genes in response to galactose
           repressed by Gal80p and activated by Gal3p
          Length = 794

 Score = 48.9 bits (115), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%)

Query: 100 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           +  ACD CR KK RC  + P+C++C   G+EC  S + +R    R +
Sbjct: 7   IDHACDSCRQKKLRCSKEEPKCAKCIQNGWECCYSPKANRTPLTRAH 53

>KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 782

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 10  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 41

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 70/160 (43%), Gaps = 13/160 (8%)

Query: 537 GNVSAIYELRGRVVSMAQQLR--LHRCPSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVF 594
             +S  Y   G  V+M   LR  +HR     L     + N  E   R+ LF+ IY +DV+
Sbjct: 308 ARLSTCYTYIG--VAMRNALREGMHRN----LNADTHSYNPIEIEMRKRLFYTIYKMDVY 361

Query: 595 SALQLGVPRLIKDFEIECALPVADNDDRTVNLAGQQIRLEGQVTNYSLAIIRFSK---VL 651
               LG+PR +   + + ALP A+  D  +   G     +G V + +    + +K   +L
Sbjct: 362 VNTMLGLPRSVSQRDFDQALP-AELTDEFITKDGLHFEKQGNVLSSAGIANQHTKLIMIL 420

Query: 652 GNILDSIFKRGMTES-ITKQVSLIHENALDNWRHGLPKEL 690
            NI+  ++    T + I+  V    E  L  W   LP EL
Sbjct: 421 DNIVAELYPVKKTNNLISHDVVTQLELKLRQWLDNLPPEL 460

>Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W
           (GIN1) - 1:1 [contig 5] FULL
          Length = 812

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 10  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 41

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 54/114 (47%), Gaps = 5/114 (4%)

Query: 581 RRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVADNDDRTVNLAGQQIRLEGQVTNY 640
           R+ LF+ IY +DV+    LG+PR +   + + ALP A+  D  +   G     +G V + 
Sbjct: 379 RKRLFYTIYKMDVYVNTMLGLPRSVSQRDFDQALP-AELTDEYITEDGLHPEKQGDVLSS 437

Query: 641 SLAIIRFSK---VLGNILDSIFKRGMTES-ITKQVSLIHENALDNWRHGLPKEL 690
           +    + +K   +L NI+  ++    T + I+  V    E  L  W   LP EL
Sbjct: 438 AGIANQHTKLIMILDNIVAELYPVKKTNNLISHDVVTQLEFKLRQWLDNLPPEL 491

>KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {ON}
           some similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 979

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 41/83 (49%), Gaps = 9/83 (10%)

Query: 68  SASMTGSSSQNAQR--EGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCD--GKRPQCSQ 123
           SAS   S  + A+   E GG  S       +  + ++ACD+CR KKTRCD   +RP CS 
Sbjct: 2   SASRRESEPKEAETSPEAGGAAS-----DRRRSKTSRACDQCREKKTRCDFSDERPICSA 56

Query: 124 CAAVGFECKISDRLSRRAFPRGY 146
           C  +G  C       +R   +GY
Sbjct: 57  CQRMGKTCTFERVPMKRGPTKGY 79

>CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {ON}
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130w
          Length = 847

 Score = 48.9 bits (115), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSR 139
           +V +ACD CR KK +CDG +P C  C    +EC  +  L R
Sbjct: 15  KVTRACDDCRKKKVKCDGNQP-CIHCTVYSYECTYNHPLKR 54

 Score = 35.8 bits (81), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 51/114 (44%), Gaps = 3/114 (2%)

Query: 581 RRVLFWGIYYLDVFSALQLGVPRLI--KDFEIECALPVADNDDRTVNLAGQQIRLEGQVT 638
           R+ LF+ IY LDV+    LG+P  +  +DF+ E  L + D       +   Q       T
Sbjct: 404 RKRLFYTIYKLDVYVNAMLGLPGSLDREDFDQELPLDLPDEALTEQGINYDQNPYSLSST 463

Query: 639 NYSLAIIRFSKVLGNILDSIFK-RGMTESITKQVSLIHENALDNWRHGLPKELI 691
             +    +   +LG+IL  ++  + +   I+ +     E  L  W   LP+EL+
Sbjct: 464 GIANEHTKLFMILGDILKHLYPIKKINIFISHKTVTDLELKLKMWLEELPRELV 517

>KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.231
           YIL130W
          Length = 902

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 32  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 63

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 69/157 (43%), Gaps = 8/157 (5%)

Query: 537 GNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSA 596
             +S  Y   G  +  A +   HR       G  S ++  E   R+ LF+ IY LDV+  
Sbjct: 392 ARLSTCYAYIGVAMRSALREGFHR-----KVGPESDLSPLEIEIRKRLFYTIYKLDVYVN 446

Query: 597 LQLGVPRLIKDFEIECALPVADNDDRTVNLAGQQIRLEGQVTNYSLA--IIRFSKVLGNI 654
             LG+PR I   + +  LP+  +D+     A    R +G +++  +A    R   +L  I
Sbjct: 447 AMLGLPRSISPEDFDQVLPLELSDENITEQAYYPEREDGSLSSTGIANCHTRLIMILDTI 506

Query: 655 LDSIFKRGMTESITKQVSLIH-ENALDNWRHGLPKEL 690
           +  ++      ++    ++ + E  L +W + LP EL
Sbjct: 507 MRKLYPIKRPNNVISHETVTNLEKLLRDWTNTLPAEL 543

>KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.17
           YOR363C
          Length = 951

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 5/77 (6%)

Query: 63  SSVPQSASMTGSSSQNAQREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCS 122
           SS P +    GS + ++Q   G  G +         R++  C  CR  KT+CD ++P CS
Sbjct: 29  SSSPDNIVRAGSVN-DSQEWFGKAGKVVKKRN----RISFVCQACRKAKTKCDKEKPMCS 83

Query: 123 QCAAVGFECKISDRLSR 139
           +C     EC     L R
Sbjct: 84  RCRKQDLECVYDIELQR 100

>KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {ON}
           Anc_1.128 YJL206C
          Length = 658

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 28/49 (57%), Gaps = 5/49 (10%)

Query: 98  LRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           LRV +AC  CR KK RCDGK P CS CA     C+ ++     A PR +
Sbjct: 26  LRVFKACIACRKKKRRCDGKSP-CSHCARTSIICEYTN----TARPRSH 69

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 72/163 (44%), Gaps = 21/163 (12%)

Query: 537 GNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSA 596
           G++ A Y   G  + +A +  LHR PS  L G  +     E   ++ LFW IY +D++  
Sbjct: 257 GDLKACYYYIGIALRIAIRENLHRKPS--LTGPTAI----EDETKKRLFWSIYKVDIYMN 310

Query: 597 LQLGVPRLIKDFEIECALPVADNDDRTV------NLAGQQIR---LEGQVTNYSLAIIRF 647
             LG+P  + +  I+  LP   +D++ V      N     I    +  + T   L +++ 
Sbjct: 311 CTLGLPASLNESFIDQELPYDVDDEKIVSDGVIFNENSNIISSCGMNNEHTKLILIMLKI 370

Query: 648 SKVLGNILDSIFKRGMTESITKQVSLIHENALDNWRHGLPKEL 690
            + L +I   I K      I   V L  E+ L  W + LP +L
Sbjct: 371 YRTLYSIDVEILK------IDANVVLHLEDILFTWYNNLPLQL 407

>NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {ON}
           Anc_6.279
          Length = 935

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%)

Query: 102 QACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           QACD CR KK +C  ++P+C++C    +EC  S +  R    R +
Sbjct: 11  QACDLCRVKKLKCSKEKPKCAKCLKNNWECCYSPKTRRSPLTRAH 55

>Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON}
           (29727..32705) [2979 nt, 993 aa]
          Length = 992

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           RV +ACD CR KK +CDG++P C  C    + C
Sbjct: 31  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYNC 62

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 70/155 (45%), Gaps = 7/155 (4%)

Query: 539 VSAIYELRGRVVSMAQQLRLHRCPSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSALQ 598
           +S  Y   G  +  A +  LHR     +    S +N  +   R+ +F+ IY  D++    
Sbjct: 486 LSNCYSYIGIALRNALREGLHR----FVNPKSSNLNPLDIEMRKRVFYTIYKCDLYLNSM 541

Query: 599 LGVPRLIKDFEIECALPVADNDDRTVNLAGQQIRLEGQVTNYSLAI--IRFSKVLGNILD 656
           LG+P+ +   + +  LPV  +D+          +  G+V++ ++A    +   +L +I  
Sbjct: 542 LGLPKSLSSADFDQVLPVELSDENITEEGYFPDKQNGEVSSAAIANYHTKLMLILADITK 601

Query: 657 SIFKRGMTESITKQVSLIH-ENALDNWRHGLPKEL 690
            ++    + +I    ++   E  L+NW   LP++L
Sbjct: 602 ELYPNKKSNNIVSHETVTQLEMRLENWIQSLPQQL 636

>SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {ON}
           weakly similar to uniprot|P40467 Saccharomyces
           cerevisiae YIL130W ASG1 Proposed transcriptional
           activator member of the Gal4p family of zinc cluster
           proteins and to YJL206C uniprot|P39529 Saccharomyces
           cerevisiae YJL206C
          Length = 780

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 24/36 (66%), Gaps = 1/36 (2%)

Query: 96  QNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           + LRV++ACD CR +K RCDG++P C  C    + C
Sbjct: 24  KRLRVSRACDVCRQRKVRCDGRQP-CIHCTVYSYNC 58

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 76/179 (42%), Gaps = 19/179 (10%)

Query: 566 LGGAGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVADNDDRTVN 625
           +  AG +  + E   R  LFW IY +DV+    LG+PR I + +++  LP   +DDR  +
Sbjct: 380 VSTAGKSPVEAETCKR--LFWTIYKMDVYMNCILGLPRSISEEDVDQDLPQDLDDDRITD 437

Query: 626 LAGQQIRLEGQVT-----NYSLAIIRFSKVLGNILDSIFKRGMTESITKQVSLIHENALD 680
           L G + +  G+++     N    +I     +   L  +       ++  +     EN L 
Sbjct: 438 L-GIEPQPAGKISSCGMNNQHTKLIVIMNHIHCKLSPLKNDAPPATLLLESVHELENELQ 496

Query: 681 NWRHGLPKELIFELDVNGTINIDEFNRLKQMNVTVERSENMTLLVMYFLAKCMIHLPVV 739
           NW   LP     +L  N T        L Q    +    N  LL+ +  AK M++ P +
Sbjct: 497 NWTLQLP----LQLRPNYTF-------LDQAEADLYLKPNKLLLLDFLHAKIMLYRPFI 544

>Smik_12.327 Chr12 (590984..595495) [4512 bp, 1503 aa] {ON} YLR256W
           (REAL)
          Length = 1503

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 38/80 (47%), Gaps = 14/80 (17%)

Query: 63  SSVPQSASMTGSSSQNAQREGGG-----NGSIASP----AGSQNL-----RVAQACDRCR 108
           SSVP  ASMT SS Q +    G      NGS + P    + S  +     R+  +C  CR
Sbjct: 8   SSVPSIASMTQSSVQRSPNMHGATTPGTNGSNSPPLHMSSDSSKIKRKRNRIPLSCTICR 67

Query: 109 SKKTRCDGKRPQCSQCAAVG 128
            +K +CD  RP C QC   G
Sbjct: 68  KRKVKCDKFRPHCQQCTKTG 87

>SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {ON}
           similar to uniprot|P04386 Saccharomyces cerevisiae
           YPL248C GAL4 DNA-binding transcription factor required
           for the activation of the GAL genes in response to
           galactose repressed by Gal80p and activated by Gal3p
          Length = 745

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 25/45 (55%)

Query: 100 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPR 144
           V QACD CR +K RC  + P+CS+C    +EC  S +  R    R
Sbjct: 5   VQQACDSCRKRKLRCSKELPKCSKCLKHNWECCYSPKAVRSPLTR 49

>CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa]
           {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051w OAF1 peroxisome proliferating transcription
           factor or uniprot|P52960 Saccharomyces cerevisiae
           YOR363c PIP2
          Length = 994

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 38/63 (60%), Gaps = 7/63 (11%)

Query: 87  GSIASPAGS-----QNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRA 141
           GS +SP G+     +  R++  C  CR  KTRCD ++P C++C  +  EC + D +++++
Sbjct: 5   GSGSSPEGNAARTRKRNRISFVCQACRRSKTRCDKEKPICTRCKKLKLEC-VYD-MAKQS 62

Query: 142 FPR 144
            PR
Sbjct: 63  APR 65

>ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar to
           uniprot|P39720 Saccharomyces cerevisiae YAL051W OAF1
           Oleate-activated transcription factor acts alone and as
           a heterodimer with Pip2p activates genes involved in
           beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 1035

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 7/72 (9%)

Query: 73  GSSSQNAQREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 132
            SSSQ+  + G  + SI      +  R++  C  CR  KT+CD ++P+C +C   G  C 
Sbjct: 34  ASSSQDGSQNGDESNSI-----KKRNRISFVCKACRRSKTKCDREKPKCGRCVQHGIAC- 87

Query: 133 ISDRLSRRAFPR 144
           + D + ++A PR
Sbjct: 88  VYD-VEKQAAPR 98

>TDEL0E00160 Chr5 (16083..17978) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 25/43 (58%)

Query: 102 QACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPR 144
           +ACD CR KK +C   RP+C +C   G++C  S R+ R    R
Sbjct: 6   RACDSCRHKKLKCSKTRPKCKKCLKNGWDCCYSPRIKRSPLTR 48

>ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly
           similar to uniprot|P50104 Saccharomyces cerevisiae
           YMR019W STB4 Protein that binds Sin3p in a two- hybrid
           assay
          Length = 912

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 28/47 (59%), Gaps = 1/47 (2%)

Query: 98  LRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPR 144
           LRV +AC+ C+ +K +CDG +P C+ C   G ECK      RR + R
Sbjct: 11  LRVRKACEICKRRKVKCDGSQP-CANCVKHGQECKYISGTVRRRYRR 56

>NDAI0I02350 Chr9 (536448..539117) [2670 bp, 889 aa] {ON} Anc_5.235
          Length = 889

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 23/44 (52%)

Query: 103 ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           AC RCR KK +CD   P CS+CA +   C   D  +    PR Y
Sbjct: 21  ACKRCRLKKIKCDNNVPSCSRCAKLRVPCVAVDSATGEDVPRSY 64

>TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.235
           YLR014C
          Length = 862

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 31/65 (47%)

Query: 82  EGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRA 141
           E G +    S A +   +   AC RCR KK +CD + P C +CA V   C   D  + R 
Sbjct: 8   EDGSSKKRPSSAVAGITKSISACKRCRLKKIKCDQEFPSCLKCARVKVPCVSLDPATGRD 67

Query: 142 FPRGY 146
            PR Y
Sbjct: 68  VPRSY 72

>KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]
           {ON} some similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger; overexpression increases salt
           tolerance through increased expression of the
           ENA1(Na+/Li+ extrusion pump) gene while gene disruption
           decreases both salt tolerance and ENA1 expression
          Length = 902

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFP 143
           RV++ACD CR+KK +CDG  P CS C  V  EC  +  + +R  P
Sbjct: 9   RVSKACDACRAKKIKCDGCDP-CSNCKKVSQECGYTYVVKKRQKP 52

>YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON}
           Putative protein of unknown function; similar to
           transcriptional regulators from the Zn[2]-Cys[6]
           binuclear cluster protein family; mRNA is weakly cell
           cycle regulated, peaking in S phase; induced rapidly
           upon MMS treatment
          Length = 758

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/158 (29%), Positives = 74/158 (46%), Gaps = 17/158 (10%)

Query: 537 GNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSA 596
            N+ A Y   G  +  A +  LHR  S V    G T  + E   R  LFW +Y LD++  
Sbjct: 303 ANLKACYSFIGIALRAALKEGLHRRSSIV----GPTPIQDETKKR--LFWSVYKLDLYMN 356

Query: 597 LQLGVPRLIKDFEIECALPVADNDDRTVNLAG------QQIRLEGQVTNYSLAIIRFSKV 650
             LG P  I + +I+   P+ D DD  ++  G      + I   G    ++  I+  S++
Sbjct: 357 CILGFPSGIDESDIDQEFPL-DVDDENISTIGIKFQDWRTISSCGMNNKHTKLILIMSRI 415

Query: 651 LGNILDSIFKRGMTE-SITKQVSLIHENALDNWRHGLP 687
              ++ S+ ++ + E S T+ VSL   + LDNW   LP
Sbjct: 416 Y-KLMYSLRRKPLEEDSRTQIVSL--NDQLDNWYAQLP 450

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 1/34 (2%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 132
           R  +AC  CR +K RC G  P C  C    +ECK
Sbjct: 42  RAHRACIACRKRKVRCSGNIP-CRLCQTNSYECK 74

>ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some
           similarities with uniprot|P39529 Saccharomyces
           cerevisiae YJL206C
          Length = 571

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 26/41 (63%), Gaps = 1/41 (2%)

Query: 96  QNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDR 136
           + LRV+ ACD CR KK +CDG++P C  C     EC  SDR
Sbjct: 20  KRLRVSHACDNCRLKKKKCDGQQP-CKLCKNSENECIYSDR 59

 Score = 35.4 bits (80), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 41/92 (44%), Gaps = 7/92 (7%)

Query: 537 GNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSA 596
           GN+   Y   G  +  A    LHR  S+++G         E   ++ LFW +Y +D++  
Sbjct: 203 GNLKRCYSYMGIALRAAIAEGLHR-KSSLMGPTPI-----EDESKKRLFWTVYKVDIYMN 256

Query: 597 LQLGVPRLIKDFEIECALPVADNDDRTVNLAG 628
             +G+P+ I    +   LP  D DD  +   G
Sbjct: 257 CIMGLPQSISQKTVNMELP-KDLDDENITNQG 287

>NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]
           {ON} Anc_7.17
          Length = 1059

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           R++  C  CR  KT+CD ++P CS+C  +G  C
Sbjct: 48  RLSFVCQECRKSKTKCDKEKPSCSRCLKIGITC 80

>KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5.235
           YLR014C
          Length = 864

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%)

Query: 103 ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           AC RCR+KK +CD + P C +CA V   C   D  +    PR Y
Sbjct: 33  ACKRCRAKKIKCDQEFPSCGKCAKVNEPCVSIDPATGEDIPRSY 76

>KAFR0F01040 Chr6 complement(195192..197696) [2505 bp, 834 aa] {ON}
           Anc_6.279 YPL248C
          Length = 834

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 23/47 (48%)

Query: 100 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           + QACD CR KK RC  ++P C +C      C  S R  R    R +
Sbjct: 1   MEQACDICRVKKLRCSKEKPSCFKCLKNNLTCTYSPRAKRSPLTRAH 47

>KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa]
           {ON} weakly similar to uniprot|P12383 Saccharomyces
           cerevisiae YGL013C PDR1 Zinc cluster protein that is a
           master regulator involved in recruiting other zinc
           cluster proteins to pleiotropic drug response elements
           (PDREs) to fine tune the regulation of multidrug
           resistance genes
          Length = 1082

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 36/76 (47%), Gaps = 6/76 (7%)

Query: 59  SKESSSVPQSASMTGSSSQNAQREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKR 118
           S+E++    ++S          R+  GNG+     G    +V++ACD CR KK +C G  
Sbjct: 15  SEEAARSDSASSGVNGDRTAIPRDSNGNGT-----GKPRRKVSRACDSCRKKKIKCSGTL 69

Query: 119 PQCSQCAAVGFECKIS 134
           P C  C   G EC  S
Sbjct: 70  P-CKSCETYGCECVYS 84

>Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C
           (PPR1) - zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type [contig 246]
           FULL
          Length = 881

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 25/48 (52%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           R   AC RCR +K +CD K P CS+C +    C   D  + R  PR Y
Sbjct: 44  RSIAACKRCRIRKVKCDQKFPSCSRCVSANEPCVSIDPATGRDVPRSY 91

>Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}
           YPL248C (REAL)
          Length = 895

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%)

Query: 100 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPR 144
           + QACD CR KK +C  ++P+CS+C    +EC  S +  R    R
Sbjct: 7   MEQACDICRLKKLKCSKEKPKCSKCLKNNWECCYSPKTKRSPLTR 51

>Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {ON}
           YLR014C (REAL)
          Length = 906

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 103 ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           AC RCR KK +CD + P C +CA +   C   D  + +  PR Y
Sbjct: 33  ACKRCRQKKIKCDQEFPSCKRCAKLKVPCVSLDPATGKDVPRSY 76

>YOR162C Chr15 complement(639560..641992) [2433 bp, 810 aa] {ON}
           YRR1Zn2-Cys6 zinc-finger transcription factor that
           activates genes involved in multidrug resistance;
           paralog of Yrm1p, acting on an overlapping set of target
           genes
          Length = 810

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 67  QSASMTGSSSQNAQREGGGNGSIA----SPAGSQNLRVAQACDRCRSKKTRCDGKRPQCS 122
           Q+ ++T  S  +    GG NGS +    S +G +  ++ ++C  CR +K RCD ++P CS
Sbjct: 13  QATNVTPPSDNSNSTAGGANGSNSGTPTSTSGKKRNKLIKSCGFCRRRKLRCDQQKPMCS 72

Query: 123 QCAA 126
            C +
Sbjct: 73  TCIS 76

>KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 866

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 24/48 (50%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           R   AC RCR +K +CD K P CS+C      C   D  + R  PR Y
Sbjct: 33  RSIAACKRCRVRKVKCDQKFPSCSRCVTANEPCVSVDPATGRDVPRSY 80

>KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17
           YOR363C
          Length = 948

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (66%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           R++  C  CR+ K +CD ++PQC +C  +G EC
Sbjct: 24  RLSYVCKACRTAKAKCDKEKPQCGRCYKLGVEC 56

>Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {ON}
           YGL013C (REAL)
          Length = 1069

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 5/65 (7%)

Query: 72  TGSSSQNAQREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           T SS+ +     G +G +  P      +V++ACD CR +K +C+GK P C+ C     EC
Sbjct: 15  TESSADSYNFTIGLSGKVRKPRS----KVSKACDNCRKRKIKCNGKFP-CASCEIYSCEC 69

Query: 132 KISDR 136
             + R
Sbjct: 70  TFTTR 74

>ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 855

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%)

Query: 103 ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           AC RCR+KK +CD + P C +CA     C   D  + R  PR Y
Sbjct: 32  ACKRCRTKKIKCDHEFPSCKKCARANKPCVSLDPATGRDVPRSY 75

>KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {ON}
           Anc_4.113 YGL013C
          Length = 995

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 25/38 (65%), Gaps = 1/38 (2%)

Query: 98  LRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 135
           ++V QACD CR +K +C GK+P CS C A   +C  S+
Sbjct: 17  IKVRQACDNCRKRKLKCTGKQP-CSTCEAYSCDCIYSE 53

>KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {ON}
           some similarities with uniprot|P35995 Saccharomyces
           cerevisiae YKL222c
          Length = 658

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 73  GSSSQNAQREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-EC 131
           GS + + +     N S ++    +  +V ++C  CR +K +CD KRP C+ C   G  EC
Sbjct: 59  GSHNNDEEHYSDKNASTSNGKVRKRRKVIKSCTFCRKRKLKCDRKRPMCTGCKMRGLSEC 118

Query: 132 KISD 135
             +D
Sbjct: 119 VYTD 122

>TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.17
           YOR363C
          Length = 1232

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           R++  C  CR  KT+CD K+P C++C   G +C
Sbjct: 47  RISFVCQHCRKSKTKCDKKQPHCARCIKHGIQC 79

>Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {ON}
           YOL089C (REAL)
          Length = 1029

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 26/49 (53%), Gaps = 5/49 (10%)

Query: 93  AGSQNL--RVAQACDRCRSKKTRCDGKRPQ---CSQCAAVGFECKISDR 136
           A S+NL  RV++ACD CR +K RCD   PQ   CS C      C    R
Sbjct: 120 ASSKNLKKRVSKACDHCRKRKIRCDEVDPQTNKCSNCVKFQSACTFKHR 168

>AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL130W
          Length = 801

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 22/38 (57%), Gaps = 1/38 (2%)

Query: 94  GSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           G +  RV +ACD CR KK +CD + P C  C    +EC
Sbjct: 8   GLKRRRVTRACDECRKKKVKCDSRHP-CIHCTVYSYEC 44

 Score = 33.9 bits (76), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 56/120 (46%), Gaps = 7/120 (5%)

Query: 577 EQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVADND----DRTVNLAGQQ-I 631
           EQ  R+ LF+ +Y ++VF    LG+P  +   + + +LP+  +D    D  ++   Q+ I
Sbjct: 358 EQEMRKRLFYTLYKMEVFVNTMLGLPSSLSKDDYDQSLPLEISDKYISDSGIHAEQQRDI 417

Query: 632 RLEGQVTNYSLAIIRFSKVLGNILDSIFKRGMTESITKQVSLIHENALDNWRHGLPKELI 691
                V N    +I   + +   L  + + G  + I+ +V    E  L +W   LP EL+
Sbjct: 418 LSSSGVANQHTKLIMIMEEIAAQLYPVKRTG--KFISHKVISALELKLRSWLDQLPAELV 475

>Kpol_538.42 s538 complement(89752..93018) [3267 bp, 1088 aa] {ON}
           complement(89752..93018) [3267 nt, 1089 aa]
          Length = 1088

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 69  ASMTGSSSQNAQREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVG 128
           ++ T SS+        G+ S       +N R++  C +CR  KTRCD ++P C++C    
Sbjct: 5   SATTLSSTSKTNHSNAGDRSTDGIVKRRN-RISFVCQQCRKAKTRCDKEQPNCTRCIKNN 63

Query: 129 FECKISDRLSRR 140
             C     L ++
Sbjct: 64  LNCIYDIELQKK 75

>KNAG0K00820 Chr11 complement(153470..156622) [3153 bp, 1050 aa]
           {ON} Anc_3.109 YOL089C
          Length = 1050

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 34/78 (43%), Gaps = 6/78 (7%)

Query: 71  MTGSSSQNAQREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRC---DGKRPQCSQCAAV 127
           + GS   N Q     NG+   PA     RV+ ACD CR +K +C   +    +CS C   
Sbjct: 118 IMGSPLGNFQYSSSSNGASVIPAKK---RVSMACDHCRKRKIKCGPINTVENKCSHCIKY 174

Query: 128 GFECKISDRLSRRAFPRG 145
             EC    R + +A  R 
Sbjct: 175 NAECTFQHRDAMQARKRN 192

>SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]
           {ON} conserved hypothetical protein
          Length = 971

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 4/65 (6%)

Query: 552 MAQQLRLHRCPSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIE 611
           +AQ++ L R P++  G    T+ +     RR+LFW I+ LD  ++L   +P LIK  E +
Sbjct: 388 LAQRVMLTRDPTSYHGITDPTLVQ----SRRILFWQIFQLDTLTSLHNNLPPLIKLDEFD 443

Query: 612 CALPV 616
            ALPV
Sbjct: 444 TALPV 448

>KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]
           {ON} some similarities with uniprot|P52960 Saccharomyces
           cerevisiae YOR363C PIP2 peroxisome induction pathway 2
           (PIP2) transcriptional activator of peroxisome
           proliferation may form heterodimer with Oaf1 to activate
           oleate-inducible gene expression activator of peroxisome
           proliferation
          Length = 619

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           R    CD CR +K +CD  +P CS+CA  G EC
Sbjct: 10  RRLHVCDACRIRKLKCDKAKPNCSRCAKHGLEC 42

>NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {ON}
           Anc_6.279 YPL248C
          Length = 1033

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 23/45 (51%)

Query: 100 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPR 144
           + QACD CR KK +C    P+C QC    + C  S ++ R    R
Sbjct: 7   IEQACDNCRLKKLKCSKHFPKCGQCLKNNWPCIYSPKVKRSPLTR 51

>SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]
           {ON} similar to gnl|GLV|KLLA0A03421g Kluyveromyces
           lactis KLLA0A03421g and weakly similar to YAL051W
           uniprot|P39720 Saccharomyces cerevisiae YAL051W OAF1
           Oleate- activated transcription factor acts alone and as
           a heterodimer with Pip2p activates genes involved in
           beta- oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 946

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 26/43 (60%)

Query: 89  IASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           I +  G +  +++  C  CR  KT+CD ++P CS+C  +G +C
Sbjct: 14  IGAAIGKKRNKLSFVCQSCRKSKTKCDKQKPSCSRCLRLGHQC 56

>SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa] {ON}
           some similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 878

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 30/49 (61%), Gaps = 5/49 (10%)

Query: 96  QNL----RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRR 140
           QNL    RV++ACD CRSKK +C+G++  CS C   G  C  +  + +R
Sbjct: 4   QNLHSRRRVSKACDSCRSKKIKCNGEQ-TCSNCLKYGCPCTYTHTIKKR 51

>ADR405C Chr4 complement(1435702..1438125) [2424 bp, 807 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YAL051W
           (OAF1) and YOR363C (PIP2); Tandem gene triplication in
           this genome
          Length = 807

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 78  NAQREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           +++R+ G +G +    G +N +++  C  CR  KT+CD  +P C++C   G  C
Sbjct: 14  SSRRDEGVSGKVTKTKGRRN-KLSFVCQSCRRSKTKCDKVKPSCTRCVKNGSVC 66

>Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W
           (REAL)
          Length = 1046

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 30/46 (65%), Gaps = 2/46 (4%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPR 144
           R++  C  CR  KT+CD ++P+CS+C   G +C + D +S++  PR
Sbjct: 61  RISFVCQACRKSKTKCDREKPECSRCIKHGLKC-VYD-VSKQPAPR 104

>NCAS0A08840 Chr1 (1746841..1751277) [4437 bp, 1478 aa] {ON}
           Anc_1.380
          Length = 1478

 Score = 46.2 bits (108), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 1/63 (1%)

Query: 66  PQSASMTGSSSQNAQREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCA 125
           P S S T  S+ ++      NG+       +N RV  +C  CR +K +CD  RP C QC 
Sbjct: 6   PVSFSNTPLSATDSSSHANANGTSTKVKRKRN-RVPLSCTICRKRKVKCDKIRPHCQQCT 64

Query: 126 AVG 128
             G
Sbjct: 65  KTG 67

>KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {ON}
           conserved hypothetical protein
          Length = 370

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 135
           RV++ACD CR  KT+CDG+RP CS+C      C  S+
Sbjct: 17  RVSKACDACRKSKTKCDGERP-CSRCLKENKLCTYSN 52

>Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W
           (REAL)
          Length = 469

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 100 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRA 141
           V  ACD CR ++ +CDGK+P CS+C    FEC     L +R 
Sbjct: 4   VKYACDFCRVRRVKCDGKKP-CSRCIQHDFECTYQQPLRKRG 44

>KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} some
           similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 1007

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 52/105 (49%), Gaps = 13/105 (12%)

Query: 54  EQDDDSKESSSVPQSASMTGSSS----QNAQREG-GGNGSIASPAGSQNLRVAQACDRCR 108
           +QD  + + ++ P+S + TG+S+     N +R+    N S A+    +  +V++ACD+CR
Sbjct: 63  KQDPSAVDEATTPRSIN-TGASTVPEPDNTRRDSVSSNVSTATTESRRRSKVSRACDQCR 121

Query: 109 SKKTRCD-------GKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
            KK +CD            C+ C  +G +C       +R   +GY
Sbjct: 122 KKKIKCDFIEGHDINPDQSCTGCRKIGEKCSFERIPLKRGPSKGY 166

>Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa] {ON}
           YLR014C (REAL)
          Length = 903

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 103 ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           AC RCR KK +CD + P C +CA +   C   D  + +  PR Y
Sbjct: 32  ACKRCRLKKIKCDQEFPSCKRCAKLQVPCVSLDPATGKDVPRSY 75

>YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}
           RDR1Transcriptional repressor involved in the control of
           multidrug resistance; negatively regulates expression of
           the PDR5 gene; member of the Gal4p family of zinc
           cluster proteins
          Length = 546

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 27/49 (55%), Gaps = 3/49 (6%)

Query: 87  GSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 135
           GS A P   Q  RV +AC  CR +K +C+GK P C  C A G+ C   D
Sbjct: 5   GSTALPHKRQ--RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYID 50

>YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}
           MAL33MAL-activator protein, part of complex locus MAL3;
           nonfunctional in genomic reference strain S288C
          Length = 468

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 100 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRR 140
           V  ACD CR ++ +CDGK+P CS+C    F+C     L +R
Sbjct: 4   VKYACDYCRVRRVKCDGKKP-CSRCIEHNFDCTYQQPLKKR 43

>KLLA0C18953g Chr3 (1682246..1684357) [2112 bp, 703 aa] {ON} some
           similarities with uniprot|P25502 Saccharomyces
           cerevisiae YKL015W PUT3 Positive regulator of PUT
           (proline utilization) genes zinc-finger transcription
           factor of the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 703

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 69/154 (44%), Gaps = 27/154 (17%)

Query: 543 YELRGRVVSMAQQLRLHRCPSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVP 602
           Y + G  + +A  L +H+        + +  N R       +FW  +  D   A++ G P
Sbjct: 330 YVMVGNAIRIAFTLGIHKT-------SATPKNNR-------IFWLCFLYDRLLAIRFGFP 375

Query: 603 RLIKDFEIEC-ALPVADNDDRTVNLAGQQIRLEGQVTNYSLAIIRFSKVLGNILDSIFKR 661
            LI + EIE  +    D D  +++L  ++   E QV+         +K+  NI+  I+ +
Sbjct: 376 LLINEIEIEIPSCSSFDTDFLSISL--EKYHFEAQVS--------LAKITTNIIKRIYTK 425

Query: 662 GMTESITKQVSLIHENALDNWRHGLPKELIFELD 695
             +  +    +++ E  L +W  GLP EL F+ +
Sbjct: 426 NSSSFVHNCHAVLKE--LKDWFDGLPSELKFDYN 457

 Score = 36.6 bits (83), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 3/46 (6%)

Query: 97  NLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFE--CKISDRLSRR 140
           N +  +AC+ C+ +K RC G  P C  C  +G    C+   RL+++
Sbjct: 11  NAKSKRACETCKRRKKRCSGGLP-CEYCVKIGNPQGCEYKTRLTKK 55

>CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa]
           {ON} similar to uniprot|Q12180 Saccharomyces cerevisiae
           YOL089c HAL9
          Length = 1053

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 34/81 (41%), Gaps = 20/81 (24%)

Query: 71  MTGSSSQNAQREGGGNGSIASPA-----------------GSQNLRVAQACDRCRSKKTR 113
           M+GSS   A      NG+   P                    +  R A+AC+ CR +KT+
Sbjct: 128 MSGSSVAYANTSANANGTPLPPQPVSANYMNNISQMPGQLHKEKRRAAKACEYCRKRKTK 187

Query: 114 CDGKRP---QCSQCAAVGFEC 131
           CD   P   +CS C+  G +C
Sbjct: 188 CDEVSPYTNKCSNCSKAGVDC 208

>Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380W
           (REAL)
          Length = 542

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 31/60 (51%), Gaps = 3/60 (5%)

Query: 85  GNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPR 144
            +GS + P   Q  RV +AC  CR +K +C+GK P C  C A G+ C  +D       PR
Sbjct: 3   SSGSNSQPYKRQ--RVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTDVDGSSTSPR 59

>TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1.380
           YLR256W
          Length = 1422

 Score = 45.8 bits (107), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 128
           R+  +C  CR +K +CD KRP C+QC   G
Sbjct: 113 RIPLSCTICRKRKVKCDKKRPHCNQCTKTG 142

>YLR256W Chr12 (646415..650923) [4509 bp, 1502 aa] {ON}  HAP1Zinc
           finger transcription factor involved in the complex
           regulation of gene expression in response to levels of
           heme and oxygen; the S288C sequence differs from other
           strain backgrounds due to a Ty1 insertion in the carboxy
           terminus
          Length = 1502

 Score = 45.8 bits (107), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 38/82 (46%), Gaps = 15/82 (18%)

Query: 62  SSSVPQSASMTGSS-----SQNAQREGGGNGSIASP-----AGSQNL-----RVAQACDR 106
           +SSVP  ASMT SS     + +     G N S  SP     + S  +     R+  +C  
Sbjct: 7   NSSVPSIASMTQSSVSRSPNMHTATTPGANTSSNSPPLHMSSDSSKIKRKRNRIPLSCTI 66

Query: 107 CRSKKTRCDGKRPQCSQCAAVG 128
           CR +K +CD  RP C QC   G
Sbjct: 67  CRKRKVKCDKLRPHCQQCTKTG 88

>Smik_18.8 Chr18 (12069..14396) [2328 bp, 775 aa] {ON} YOR172W
           (REAL)
          Length = 775

 Score = 45.4 bits (106), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 9/53 (16%)

Query: 102 QACDRCRSKKTRCDGKRPQCSQCA---------AVGFECKISDRLSRRAFPRG 145
           ++C+ CR +K RCDGKRP+CS C          A+GFE  +  R   +A    
Sbjct: 10  RSCELCRKRKLRCDGKRPRCSTCVRKKSSECTYAIGFEQDVEFREKLKALKEA 62

>TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa]
           {ON} 
          Length = 847

 Score = 45.4 bits (106), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 21/40 (52%)

Query: 92  PAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           P   +  R+   C  CR+KK +CD K+P C +C   G  C
Sbjct: 2   PMAMKKRRLNNGCWTCRTKKVKCDSKKPFCDKCKDSGLHC 41

>Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}
           YJL206C (REAL)
          Length = 833

 Score = 45.4 bits (106), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 72/157 (45%), Gaps = 15/157 (9%)

Query: 537 GNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSA 596
            N+ A Y   G  +  A +  LHR  S V    G T  + E   R  LFW +Y LD++  
Sbjct: 291 ANLKACYSFIGIALRAALKEGLHRKSSIV----GPTPIQDETKKR--LFWSVYKLDLYMN 344

Query: 597 LQLGVPRLIKDFEIECALPVADNDDRTVNLAG------QQIRLEGQVTNYSLAIIRFSKV 650
             LG P  I + +I+   P+ D DD  ++  G      + I   G    ++  I+  S++
Sbjct: 345 CILGFPSGIDESDIDQEFPL-DVDDENISTMGIKFQDWRTISSCGMNNKHTKLILIMSRI 403

Query: 651 LGNILDSIFKRGMTESITKQVSLIHENALDNWRHGLP 687
              ++ S+ ++ + E    Q+  +++  L+NW   LP
Sbjct: 404 Y-KLMYSLRRKPLEEDSRSQIVSLNDQ-LENWYTQLP 438

 Score = 40.0 bits (92), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 10/61 (16%)

Query: 81  REGGGNGS----IASPAGSQNL-----RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           ++G G  S    ++  AG+  L     R  +AC  CR +K RC G+ P C  C    FEC
Sbjct: 2   KKGNGKRSKVLVLSRDAGTNELKPTRGRAHRACVACRKRKVRCSGQTP-CRLCQNNSFEC 60

Query: 132 K 132
           K
Sbjct: 61  K 61

>KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON} Anc_2.565
           YMR019W
          Length = 707

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 89  IASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDR-LSRRAFPR 144
           ++     Q LRV +ACD C+ +K +CDG  P CS C     +C    R  + R  PR
Sbjct: 1   MSKSTTKQRLRVQKACDICKRRKVKCDGLSP-CSNCIRHNVDCTYDYRTFASRKKPR 56

>Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}
           YJL206C (REAL)
          Length = 772

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 73/160 (45%), Gaps = 15/160 (9%)

Query: 537 GNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSA 596
            N+ A Y   G  +  A +  LHR  S V    G T  + E   R  LFW +Y LD++  
Sbjct: 315 ANLKACYSFIGIALRAALKDGLHRKSSIV----GPTPIEDETKKR--LFWSVYKLDLYMN 368

Query: 597 LQLGVPRLIKDFEIECALPVADNDDRTVNLAG------QQIRLEGQVTNYSLAIIRFSKV 650
             LG P  I + +I+   P+ D DD  ++  G      + I   G    ++  I+  S++
Sbjct: 369 CILGFPSGIDESDIDQEFPL-DVDDENISTTGIKFQDWRTISSCGMNNKHTKLILIMSRI 427

Query: 651 LGNILDSIFKRGMTESITKQVSLIHENALDNWRHGLPKEL 690
              ++ S+ ++ + E    Q+  +++  LD+W   LP  L
Sbjct: 428 Y-KLMYSLRRKPLEEDSRLQIVSLNDQ-LDDWYTQLPDTL 465

 Score = 39.3 bits (90), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 132
           R  +AC  CR +K RC G+ P C  C    FECK
Sbjct: 53  RAHRACVACRKRKVRCSGQTP-CRLCQNNSFECK 85

>Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {ON}
           YGL013C (REAL)
          Length = 1080

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 1/64 (1%)

Query: 73  GSSSQNAQREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 132
           G  ++++   G  + S++        +V++ACD CR +K +C+GK P C+ C     EC 
Sbjct: 12  GPDAESSVDSGNFSMSLSGRVRKPRSKVSKACDNCRKRKIKCNGKFP-CASCEIYSCECT 70

Query: 133 ISDR 136
            + R
Sbjct: 71  FTSR 74

>KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON}
           weakly similar to uniprot|P25611 Saccharomyces
           cerevisiae YCR106W RDS1 Regulator of drug sensitivity
           transcriptional regulator
          Length = 934

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 23/43 (53%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRA 141
           R +  C  CR +K +CD KRP+CS+C   G  C      SR A
Sbjct: 14  RPSFVCQECRRRKIKCDKKRPRCSRCVDTGLPCTYLASGSRSA 56

>CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar to
           uniprot|P12383 Saccharomyces cerevisiae YGL013c PDR1
           transcription factor
          Length = 1107

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 90  ASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRR 140
           A    ++  +V +ACD CR +K +C+G +P C  C   G EC  +D  S +
Sbjct: 17  AQKPSTRRTKVGKACDSCRRRKIKCNGLKP-CPSCTIYGCECTYTDAKSTK 66

>Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {ON}
           YLR014C (REAL)
          Length = 899

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 94  GSQNLRVAQ---ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           GS N+  ++   AC RCR KK +CD + P C +CA +   C   D  + +  PR Y
Sbjct: 21  GSPNIGFSKSRTACKRCRLKKIKCDQEFPSCKRCANLEVPCVSLDPATGKDVPRSY 76

>Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar to
           Ashbya gossypii AER370W
          Length = 826

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           R+ +ACD CR KK +CD + P C  C    +EC
Sbjct: 17  RITRACDECRKKKVKCDNRHP-CIHCTVYSYEC 48

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 55/116 (47%), Gaps = 8/116 (6%)

Query: 581 RRVLFWGIYYLDVFSALQLGVPRLI--KDFEIECALPVADN---DDRTVNLAGQQIRLEG 635
           R+ +F+ IY +DV     LG+PR I  +DF+ E  L ++D+   ++  +   G  I    
Sbjct: 366 RKRVFYTIYRMDVMLNTMLGLPRSISKEDFDQELPLTISDSCITEEGILRNKGSDILGST 425

Query: 636 QVTNYSLAIIRFSKVLGNILDSIFKRGMTESITKQVSLIHENALDNWRHGLPKELI 691
            VTN    ++    ++  I ++++   +   ++  V    E  L  W   LP EL+
Sbjct: 426 GVTNQHTKLVM---IMDEIANTLYSPRLDNVVSHSVISDLELKLRAWLDQLPPELV 478

>YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON}
           PPR1Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain, positively
           regulates transcription of URA1, URA3, URA4, and URA10,
           which are involved in de novo pyrimidine biosynthesis,
           in response to pyrimidine starvation; activity may be
           modulated by interaction with Tup1p
          Length = 904

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 103 ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           AC RCR KK +CD + P C +CA +   C   D  + +  PR Y
Sbjct: 33  ACKRCRLKKIKCDQEFPSCKRCAKLEVPCVSLDPATGKDVPRSY 76

>TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {ON}
           Anc_4.113 YGL013C
          Length = 1207

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKIS 134
           +V++ACD CR +K +C G+RP C+ C     EC  S
Sbjct: 12  KVSKACDNCRRRKIKCSGERP-CAGCKTYNCECIFS 46

>SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]
           {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051W OAF1 Oleate-activated transcription factor acts
           alone and as a heterodimer with Pip2p activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 983

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 94  GSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
            S+  R++  C  CR  KT+CD ++P C++C   G EC
Sbjct: 18  SSKRNRISFVCKACRKSKTKCDREKPSCTRCIKNGIEC 55

>NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON} 
          Length = 865

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (66%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           R +  C  C+++K RCD +RP CS+C  +G +C
Sbjct: 26  RRSHVCITCKNQKLRCDRERPSCSRCRRIGRDC 58

>AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YOL089C
           (HAL9)
          Length = 879

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRR 140
           RV++ACD CR+KK RC+G+ P C  C      C  +  + RR
Sbjct: 76  RVSKACDICRAKKIRCNGEEP-CVNCEKFNLGCTYTHVIKRR 116

>KAFR0I00230 Chr9 (48095..51232) [3138 bp, 1045 aa] {ON} Anc_7.17
           YOR363C
          Length = 1045

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           R++  C  CR  KT+CD ++P+CS+CA     C
Sbjct: 24  RISLVCQACRKSKTKCDREKPRCSRCAKNNLRC 56

>NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]
           {ON} Anc_7.17
          Length = 1022

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 6/68 (8%)

Query: 64  SVPQSASMTGSSSQNAQREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQ 123
           S PQ    +G+S+ ++   GG N  I      +  R++  C  CR  KT+CD ++P C++
Sbjct: 12  SPPQEQVSSGNST-SSPAAGGSNRQI-----KKRNRISFVCQECRKAKTKCDKEKPACTR 65

Query: 124 CAAVGFEC 131
           C      C
Sbjct: 66  CVKQNLAC 73

>SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {ON}
           conserved hypothetical protein
          Length = 362

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 135
           RV++ACD CR  KT+CDG+RP C +C +    C  S+
Sbjct: 6   RVSKACDTCRKSKTKCDGERP-CQRCLSENKICTYSN 41

>Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W
           (REAL)
          Length = 1045

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 29/46 (63%), Gaps = 2/46 (4%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPR 144
           R++  C  CR  KT+CD ++P+C +C   G +C + D +S++  PR
Sbjct: 61  RISFVCQACRKSKTKCDREKPECGRCTKHGLKC-VYD-VSKQPAPR 104

>TPHA0H01240 Chr8 (274496..277129) [2634 bp, 877 aa] {ON} Anc_5.59
           YHR178W
          Length = 877

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 94  GSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRA 141
           G Q L+ + +C RCR  K +C  + P+CS C A  + C+   RL RR+
Sbjct: 89  GGQQLQ-SYSCSRCRRLKKKCLRQMPKCSNCVASHYACEYIGRLPRRS 135

>Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 aa]
           {ON} YMR019W (REAL)
          Length = 911

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 89  IASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPR 144
           ++   G   LRV +AC+ C+ +K +CDG RP C  C+    EC+   + + R   R
Sbjct: 31  VSKENGRGRLRVQKACEICKRRKVKCDGNRP-CLNCSKHKKECRYDFKATNRRKKR 85

>YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}
           OAF1Oleate-activated transcription factor, acts alone
           and as a heterodimer with Pip2p; activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 1047

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 50/99 (50%), Gaps = 10/99 (10%)

Query: 52  PYEQDDDSKESSSVPQS-ASMTGSSSQNAQREGGGNGSIASPAGSQNL-----RVAQACD 105
           P+  +DD+  SS+ P S A   G ++     E   + +  +P  S+       R+   C 
Sbjct: 10  PHAGNDDN--SSTKPYSEAFFLGFNNPTPGLEAEHSSTSPAPENSETHNRKRNRILFVCQ 67

Query: 106 RCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPR 144
            CR  KT+CD ++P+C +C   G +C + D +S++  PR
Sbjct: 68  ACRKSKTKCDREKPECGRCVKHGLKC-VYD-VSKQPAPR 104

>Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380W
           (REAL)
          Length = 546

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKI--SDRLSRRAFP 143
           RV +AC  CR +K +C+GK P C  C + G+ C     DR S  +FP
Sbjct: 15  RVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDKDRSSSSSFP 60

>Ecym_5017 Chr5 (36647..39583) [2937 bp, 978 aa] {ON} similar to
           Ashbya gossypii ADR403C
          Length = 978

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 3/52 (5%)

Query: 83  GGGNGSIASPAG---SQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
            G   S  SP     S+  R++  C  CR  KT+CD ++P+CS+CA    +C
Sbjct: 8   SGEQFSAESPERKYVSKRNRISFVCQACRKSKTKCDREKPRCSRCAKNNIKC 59

>SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON}
           weakly similar to uniprot|P33200 Saccharomyces
           cerevisiae YBL005W PDR3 Transcriptional activator of the
           pleiotropic drug resistance network regulates expression
           of ATP-binding cassette (ABC) transporters through
           binding to cis-acting sites known as PDREs (PDR
           responsive elements)
          Length = 940

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 25/38 (65%), Gaps = 1/38 (2%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDR 136
           +V++ACD CR +K +C GK+P CS C A    C+ S R
Sbjct: 23  KVSRACDNCRRRKIKCTGKQP-CSNCQAYQCHCEYSIR 59

>YOR363C Chr15 complement(1020222..1023212) [2991 bp, 996 aa] {ON}
           PIP2Autoregulatory oleate-specific transcriptional
           activator of peroxisome proliferation, contains
           Zn(2)-Cys(6) cluster domain, forms heterodimer with
           Oaf1p, binds oleate response elements (OREs), activates
           beta-oxidation genes
          Length = 996

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 6/60 (10%)

Query: 90  ASPA----GSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRG 145
           +SPA    G +  R++  C  CR  KT+CD ++P+C +C      C I D ++R+A PR 
Sbjct: 7   SSPAMNRVGKKRNRLSFVCQACRKAKTKCDQEKPRCGRCTKQNLFC-IYD-VARQAAPRN 64

>NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}
           Anc_7.17 YAL051W
          Length = 944

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 4/69 (5%)

Query: 63  SSVPQSASMTGSSSQNAQREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCS 122
           SS+P S SM+    Q+  +        +     +  R++  C  CR  K +CD ++P CS
Sbjct: 3   SSLPYSQSMSPKGPQSPSKSIND----SQVTKKKRYRLSFVCQGCRRSKVKCDQEKPVCS 58

Query: 123 QCAAVGFEC 131
           +C+    EC
Sbjct: 59  RCSKHDLEC 67

>TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {ON}
           Anc_7.17 YOR363C
          Length = 1274

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 6/53 (11%)

Query: 85  GNGSIASPAGS------QNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
            N +I SP  S      +  R++  C  CR  KT+C+  +P CS+C  +G  C
Sbjct: 49  SNPTITSPITSPGHITKKRNRISFVCQSCRKSKTKCNKDKPSCSRCKKLGIFC 101

>KLLA0D12672g Chr4 complement(1076011..1078608) [2598 bp, 865 aa]
           {ON} uniprot|P08657 Kluyveromyces lactis LAC9 Lactose
           regulatory protein LAC9
          Length = 865

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 22/45 (48%)

Query: 102 QACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           QACD CR KK +C    P C+ C     +C  S ++ R    R +
Sbjct: 93  QACDACRKKKWKCSKTVPTCTNCLKYNLDCVYSPQVVRTPLTRAH 137

>Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W
           (REAL)
          Length = 1040

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 29/46 (63%), Gaps = 2/46 (4%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPR 144
           R++  C  CR  KT+CD ++P+C +C   G +C + D +S++  PR
Sbjct: 61  RISFVCQACRKSKTKCDREKPECGRCIKHGLKC-VYD-VSKQPAPR 104

>NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa] {ON}
           Anc_2.565
          Length = 803

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 86  NGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           NG   +    Q LRV +AC  C+ +K +CDG +P CS C     +C
Sbjct: 7   NGKEVTNKNRQRLRVQRACAICKKRKVKCDGMKP-CSNCIKRSKDC 51

>ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YAL051W
           (OAF1) and YOR363C (PIP2); Tandem gene triplication in
           this genome
          Length = 970

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 95  SQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPR 144
           S+  R++  C  CR  KT+CD ++P+CS+CA    +C + D   +RA PR
Sbjct: 23  SKRNRISFVCQACRKSKTKCDREKPRCSRCAKNNVKC-VYDIEKQRA-PR 70

>NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON} 
          Length = 508

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           R    C  CR++K +CD +RP+C +C  +G EC
Sbjct: 15  RSYSGCWTCRARKVKCDTQRPKCCRCKQLGIEC 47

>CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]
           {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051w OAF1 peroxisome proliferating transcription
           factor or uniprot|P52960 Saccharomyces cerevisiae
           YOR363c PIP2
          Length = 1022

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRA 141
           R++  C  CR  KT+CD ++P CS+C   G  C + D  S++A
Sbjct: 18  RLSFVCQGCRKAKTKCDKEKPACSRCLKHGIRC-VYDLTSQKA 59

>CAGL0B03421g Chr2 complement(336071..340138) [4068 bp, 1355 aa]
           {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
           YLR256w HAP1 transcription factor
          Length = 1355

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 90  ASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVG 128
           A+P   +N R+  +C  CR +K +CD  RP C+QC   G
Sbjct: 10  AAPKKKRN-RIPLSCTICRKRKVKCDKTRPHCNQCTKTG 47

>Skud_15.326 Chr15 complement(588275..590731) [2457 bp, 818 aa] {ON}
           YOR162C (REAL)
          Length = 818

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 35/65 (53%), Gaps = 5/65 (7%)

Query: 67  QSASMTGSSSQNAQREGGGNGS-----IASPAGSQNLRVAQACDRCRSKKTRCDGKRPQC 121
           ++A +T  S     + GG + S      AS +G +  ++ ++C  CR +K RCD ++P C
Sbjct: 13  EAADVTPPSDNGDGKSGGASASGTVTASASGSGRKRNKLIKSCGFCRRRKLRCDQRKPMC 72

Query: 122 SQCAA 126
           S C +
Sbjct: 73  STCIS 77

>TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON}
           Anc_3.109 YOL089C
          Length = 1178

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 4/37 (10%)

Query: 99  RVAQACDRCRSKKTRCDGKRP----QCSQCAAVGFEC 131
           RV++ACD CR +K +CD KR     +CS C     EC
Sbjct: 248 RVSRACDHCRKRKIKCDEKRDPNTNKCSNCIKYNSEC 284

>SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa]
           {ON} weakly similar to uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 1061

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 3/42 (7%)

Query: 93  AGSQNLRVAQACDRCRSKKTRCDGKRP---QCSQCAAVGFEC 131
           +G+   RV++ACD CR +K +CD  +P   +CS C     EC
Sbjct: 128 SGAPKKRVSKACDHCRKRKIKCDDVKPRTGKCSNCTKFNAEC 169

>TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]
           {ON} Anc_6.75 YLR278C
          Length = 1530

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 23/43 (53%)

Query: 101 AQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFP 143
           +++C  CR +K RCD K P C+ C   G +C    R S  A P
Sbjct: 38  SKSCLLCRRRKQRCDHKLPSCTACLKAGVKCVQPARYSNNAAP 80

>Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C
           (REAL)
          Length = 786

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 71/157 (45%), Gaps = 15/157 (9%)

Query: 537 GNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSA 596
            N+ A Y   G  +  A +  LHR  S      G T  + E   R  LFW +Y LD++  
Sbjct: 324 ANLKACYSFIGIALRAALKEGLHRKSSI----TGPTAIQDETKKR--LFWSVYKLDLYMN 377

Query: 597 LQLGVPRLIKDFEIECALPVADNDDRTVNLAG------QQIRLEGQVTNYSLAIIRFSKV 650
             LG P  I + +I+   P+ D DD  ++  G      + I   G    ++  I+  S++
Sbjct: 378 CILGFPSGIDESDIDQEFPL-DVDDENISTMGIKFQDWRMISSCGMNNEHTKLILIMSRI 436

Query: 651 LGNILDSIFKRGMTESITKQVSLIHENALDNWRHGLP 687
              ++ S+ ++ + E    Q+  +++  L+NW   LP
Sbjct: 437 Y-KLMYSLRRKPLEEDSRLQIVSLNDQ-LENWYAQLP 471

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 35/77 (45%), Gaps = 11/77 (14%)

Query: 73  GSSSQNAQREGGGNGS----IASPAGSQNL-----RVAQACDRCRSKKTRCDGKRPQCSQ 123
           G +S  A ++  G  S    ++  AG+  L     R  +AC  CR +K RC G+ P C  
Sbjct: 27  GQASSRAMKKVKGKKSRVLVLSRDAGTNELKPTRGRAHRACMACRKRKVRCSGQIP-CRF 85

Query: 124 CAAVGFECKISDRLSRR 140
           C     EC   DR  R+
Sbjct: 86  CHTNKLECTY-DRPPRK 101

>SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON}
           similar to uniprot|P05085 Saccharomyces cerevisiae
           YML099C ARG81 Zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type involved in
           the regulation of arginine-responsive genes acts with
           Arg80p and Arg82p
          Length = 848

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 18/29 (62%)

Query: 103 ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
            C  CRS+K +CD  RP C +C   GFEC
Sbjct: 19  GCWTCRSRKVKCDLGRPSCKRCERSGFEC 47

>KLTH0H02684g Chr8 complement(235527..237776) [2250 bp, 749 aa] {ON}
           weakly similar to uniprot|P04386 Saccharomyces
           cerevisiae YPL248C GAL4 DNA-binding transcription factor
           required for the activation of the GAL genes in response
           to galactose repressed by Gal80p and activated by Gal3p
          Length = 749

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 23/45 (51%)

Query: 102 QACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           QACD CR KK +C  + P CS C    ++C  S +  R    R +
Sbjct: 9   QACDWCRRKKLKCSREHPICSNCFKHNWDCHYSPKKVRSPLTRAH 53

>SAKL0D13464g Chr4 (1116277..1118340) [2064 bp, 687 aa] {ON} weakly
           similar to uniprot|P50104 Saccharomyces cerevisiae
           YMR019W STB4 Protein that binds Sin3p in a two- hybrid
           assay
          Length = 687

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 9/64 (14%)

Query: 83  GGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC--KISDRLSRR 140
           G  NGS       Q LRV +AC+ C+ +K +CDG +P C+ C     +C  K +D  S  
Sbjct: 13  GKDNGS------KQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTASPI 65

Query: 141 AFPR 144
           + P+
Sbjct: 66  SKPK 69

>ADR404C Chr4 complement(1432320..1434947) [2628 bp, 875 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YAL051W
           (OAF1) and YOR363C (PIP2); Tandem gene triplication in
           this genome
          Length = 875

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 86  NGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           +GS+  P  +   +++  C  CR  KT+CD  +P CS+CA +G  C
Sbjct: 7   SGSVLKP-NTHKRKLSYVCIPCRKCKTKCDKLKPTCSRCAELGLYC 51

>NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON} 
          Length = 701

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECKISDR 136
           RV ++C  CR +K++CD  +P CS C   G  EC+  DR
Sbjct: 21  RVPKSCTVCRLRKSKCDRIKPYCSSCVLHGIKECRYDDR 59

>Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976 aa]
           {ON} YKL015W (REAL)
          Length = 976

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 67/151 (44%), Gaps = 12/151 (7%)

Query: 541 AIYELRGRVVSMAQQLRLHRCPSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSALQLG 600
           A Y   G+ +     L LH      +     T+ K E    R L+W +Y  +   + + G
Sbjct: 476 ASYFYFGQALRTCLILGLH------VDSQSDTLTKYEIEHHRRLWWTVYMFERMLSSKAG 529

Query: 601 VPRLIKDFEIECALPVADNDDRTVNLAGQQ-IRLEGQVTNYSLAIIRFSKVLGNILDSIF 659
           +P    D+ I  ALP AD DD T+     Q +  + ++ +  + I+   K+   IL  ++
Sbjct: 530 LPLSFTDYTISTALP-ADIDDETIEGKNNQYVFRKAELISNCVTIV---KINAQILSKLY 585

Query: 660 KRGMTESITKQVSLIHENALDNWRHGLPKEL 690
           +R    +I   + ++ +  L+ WR+ L   L
Sbjct: 586 QRQPETNIIITLKVVIKQLLE-WRNNLSDSL 615

>Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {ON}
           YOL089C (REAL)
          Length = 1032

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 3/58 (5%)

Query: 82  EGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQ---CSQCAAVGFECKISDR 136
           E   +  + +   +   RV++ACD CR +K RCD   PQ   CS C      C    R
Sbjct: 114 ESTNSNDLGASGKNSKKRVSKACDHCRKRKIRCDEVDPQTDKCSNCVKFQSVCTFKHR 171

>Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W
           (REAL)
          Length = 545

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 3/52 (5%)

Query: 84  GGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 135
             +GS   P   Q  RV +AC  CR +K +C+GK P C  C A G+ C  ++
Sbjct: 2   ASSGSNPQPYKRQ--RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTE 50

>CAGL0D02904g Chr4 complement(302952..305615) [2664 bp, 887 aa] {ON}
           similar to uniprot|P07272 Saccharomyces cerevisiae
           YLR014c PPR1 transcription factor regulating pyrimidine
           pathway
          Length = 887

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 27/65 (41%)

Query: 82  EGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRA 141
           +G    S   P G +  +   AC  CR KK +CD   P C  C      C   D ++ + 
Sbjct: 3   KGKKRVSKPVPGGVKFTKFPNACKLCRRKKVKCDQGYPSCKGCLRNNVPCVSVDPVTGQD 62

Query: 142 FPRGY 146
            PR Y
Sbjct: 63  IPRSY 67

>Skud_12.335 Chr12 (592952..597391) [4440 bp, 1479 aa] {ON} YLR256W
           (REAL)
          Length = 1479

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 37/82 (45%), Gaps = 16/82 (19%)

Query: 63  SSVPQSASMTGSSSQNA-----QREGGGNGSIASP------AGSQNL-----RVAQACDR 106
           SSVP  +SMT SS+  +         G N S  SP      + S  +     R+  +C  
Sbjct: 8   SSVPSISSMTQSSASRSPNMHIATTPGANTSSNSPPPLHMSSDSSKIKRKRNRIPLSCTI 67

Query: 107 CRSKKTRCDGKRPQCSQCAAVG 128
           CR +K +CD  RP C QC   G
Sbjct: 68  CRKRKVKCDKFRPHCQQCTKTG 89

>Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {ON}
           YKL038W (RGT1) - 1:1 [contig 55] FULL
          Length = 970

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 99  RVAQACDRCRSKKTRCD--GKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           + ++ACD+CR KKTRCD   + P C+ C  +   C       +R   +GY
Sbjct: 34  KTSRACDQCRGKKTRCDFSDENPVCTSCQRMSKTCTFERVPMKRGPTKGY 83

>TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa]
           {ON} Anc_1.128 YJL206C
          Length = 691

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 23/30 (76%), Gaps = 1/30 (3%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 128
           RV++AC+ CRSKK +CDG++P C  C  VG
Sbjct: 125 RVSRACEFCRSKKKKCDGQQP-CDLCKLVG 153

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 71/157 (45%), Gaps = 11/157 (7%)

Query: 537 GNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSA 596
            N+   Y   G  +  A    LHR  S +    G T  + E   R  LFW +Y +D++  
Sbjct: 307 ANLKTCYSYIGIALRAAISEGLHRKNSLI----GPTPIEDETKKR--LFWSVYKVDLYMN 360

Query: 597 LQLGVPRLIKDFEIECALPVADNDDRTVNLAGQQIRLEGQVTNYSL--AIIRFSKVLGNI 654
             LG+PR + +  I   LP  D DD  +   G   +  G++++  +     +   V+  I
Sbjct: 361 CILGLPRTLSESAINQELP-RDVDDEKITTKGILAQDWGKISSCGMNNQHTKLMLVMARI 419

Query: 655 LDSIFKRGMTESITKQVSLIH-ENALDNWRHGLPKEL 690
            +S++     +  T  V++I+ ++ L+ W   LP +L
Sbjct: 420 HESLYPVLKWDQAT-YVNIINLQDKLNEWFIELPMQL 455

>NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3.109
           YBR150C
          Length = 1001

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 38/84 (45%), Gaps = 9/84 (10%)

Query: 66  PQSASMTGSSSQNAQREGGGNGSIASPAGSQNL------RVAQACDRCRSKKTRCDG--- 116
           P S+     + +N +REG  +        S  L      R ++ACD CR +K +CD    
Sbjct: 59  PASSPSLIEAQKNIEREGNNDVHFEINNESNILNHPPKKRASKACDLCRRRKIKCDAFDD 118

Query: 117 KRPQCSQCAAVGFECKISDRLSRR 140
           +  +CS C     EC  S++  R+
Sbjct: 119 RLKKCSNCIKYHSECTFSNQNKRK 142

>Skud_9.220 Chr9 complement(396576..398957) [2382 bp, 793 aa] {ON}
           YER184C (REAL)
          Length = 793

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 24/36 (66%), Gaps = 1/36 (2%)

Query: 96  QNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           QN RV++AC+RC  KK +CD K+P C  CA    +C
Sbjct: 10  QNSRVSKACERCHRKKIKCDSKKP-CFGCAGSRSKC 44

>TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6.60
           YLR266C
          Length = 795

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 21/33 (63%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           ++ +AC  CR +K +CD  +P+C QC++    C
Sbjct: 9   KIIKACVFCRKRKLKCDLTKPKCKQCSSRNLNC 41

>KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2.547
           YKL038W
          Length = 1088

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 2/64 (3%)

Query: 85  GNGSIASPAGSQNLRVAQACDRCRSKKTRCDG--KRPQCSQCAAVGFECKISDRLSRRAF 142
            N +  S +  +  + ++ACD+CR KK +CD    R  C+ C   G +C       +R  
Sbjct: 44  ANNASRSSSNKRRTKASRACDQCRKKKVKCDNGDDRSVCTNCQRNGEKCTFERVPLKRGP 103

Query: 143 PRGY 146
            +GY
Sbjct: 104 SKGY 107

>NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {ON}
           
          Length = 1113

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 135
           +V++AC  CR +K +C G  P CS CAA   EC   D
Sbjct: 32  KVSKACANCRRRKIKCTGTYP-CSNCAAYQCECIFDD 67

>SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON}
           weakly similar to uniprot|P39720 Saccharomyces
           cerevisiae YAL051W OAF1 Oleate-activated transcription
           factor acts alone and as a heterodimer with Pip2p
           activates genes involved in beta-oxidation of fatty
           acids and peroxisome organization and biogenesis
          Length = 922

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 2/46 (4%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPR 144
           R++  C  CR +K +CD +RP C QCA  G  C + D + R+  PR
Sbjct: 20  RLSFVCLECRRRKIKCDKQRPCCIQCAEQGLTC-VYD-IERQPAPR 63

>Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {ON}
           YGL013C (REAL)
          Length = 1000

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 4/55 (7%)

Query: 85  GNGSIASPAG---SQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDR 136
            NG + S  G       +V++ACD CR +K +C+GK P C+ C     EC  + R
Sbjct: 21  ANGFVMSLTGRVRKPRSKVSKACDNCRKRKIKCNGKFP-CASCEIYLCECTFTTR 74

 Score = 36.2 bits (82), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 20/35 (57%)

Query: 581 RRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALP 615
           RR L+W  YY +   A +LG P  I D +I C LP
Sbjct: 519 RRSLWWKAYYFEKTLASKLGYPSNIDDSKINCLLP 553

>Ecym_2732 Chr2 (1410290..1413886) [3597 bp, 1198 aa] {ON} similar
           to Ashbya gossypii AFR117C
          Length = 1198

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 3/43 (6%)

Query: 89  IASPAGS---QNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVG 128
           ++SP G+   +  R+  +C  CR +K RCD  +P C+QC   G
Sbjct: 1   MSSPGGTAKRKRNRIPLSCTICRKRKVRCDKTKPHCTQCVKTG 43

>KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]
           {ON} Anc_2.547 YKL038W
          Length = 1286

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 94  GSQNLRVAQACDRCRSKKTRCD--GKRPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           G +  + ++ACD+CR KK +CD    R  C+ C  +G  C       +R   +GY
Sbjct: 45  GKKRTKASRACDQCRRKKIKCDYNDMRNICTNCQRIGERCSFERVPLKRGPTKGY 99

>SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON}
           similar to uniprot|P35995 Saccharomyces cerevisiae
           YKL222C Hypothetical ORF and similar to uniprot|Q12340
           Saccharomyces cerevisiae YOR172W
          Length = 718

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECKISDRLSRRAFP 143
           +V ++C  CR +K +CD K+P+CS CAA    EC   ++ +    P
Sbjct: 14  KVIKSCLFCRKRKLKCDHKKPKCSTCAARNLPECVYVEKFTHEIDP 59

>KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON}
           uniprot|Q6DR96 Kluyveromyces lactis HAP1
          Length = 1253

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 18/30 (60%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 128
           RV  +C  CR +K +CD  RPQC QC   G
Sbjct: 20  RVPLSCTICRKRKVKCDKGRPQCQQCVKTG 49

>TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa] {ON}
           Anc_7.17 YOR363C
          Length = 989

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           R++  C  CR  KT+CD ++P+C +C   G +C
Sbjct: 40  RISFVCQACRRSKTKCDREKPRCGRCQQHGLQC 72

>Smik_2.383 Chr2 complement(686676..688022) [1347 bp, 448 aa] {ON}
           YBR240C (REAL)
          Length = 448

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 28/58 (48%)

Query: 80  QREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRL 137
           +++ G   +++S A     R    C  CR KK RCD  RP CS CA  G  C    RL
Sbjct: 6   KQQRGKKLAVSSKAPPTKGRTFTGCWACRFKKRRCDENRPICSLCAKHGDNCSYDIRL 63

>ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; No
           homolog in Saccharomyces cerevisiae
          Length = 817

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 44/81 (54%), Gaps = 14/81 (17%)

Query: 538 NVSAIYELRGRVVSMAQQLRLHRCPSAVLGGAGSTMNKREQGD---RRVLFWGIYYLDVF 594
           N+S++ +L      +AQ+L+L   P  V G        RE  D   RR++FW I+ LD  
Sbjct: 269 NISSVAQL----ARLAQRLQLTADPEYVPGS-------REMADVQFRRIIFWQIFQLDTL 317

Query: 595 SALQLGVPRLIKDFEIECALP 615
           ++LQ  +P L++  E E +LP
Sbjct: 318 TSLQNRLPPLLRYNECETSLP 338

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 2/38 (5%)

Query: 104 CDRCRSKKTRCDGKRPQCSQCAAVGFECK--ISDRLSR 139
           C  C  +K +C+  RP C  C    + C   ++DR+SR
Sbjct: 38  CMPCHKRKVKCNRARPVCDHCEKNRYACAYFVNDRVSR 75

>Kpol_260.2 s260 complement(3488..5758) [2271 bp, 756 aa] {ON}
           complement(3488..5758) [2271 nt, 757 aa]
          Length = 756

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 21/41 (51%)

Query: 101 AQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRA 141
           A +C RCR  K +C  +RP C+ C   G  C    R  RR+
Sbjct: 40  AYSCSRCRKLKRKCQKQRPSCANCMNAGATCNYPGRAPRRS 80

>TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON} Anc_8.879
           YML099C
          Length = 1132

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 20/34 (58%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 132
           R    C  CRS+K +CD ++PQC +C     +C+
Sbjct: 11  RTYSGCWTCRSRKIKCDQQKPQCKRCLKANLKCE 44

>YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}
           RGT1Glucose-responsive transcription factor that
           regulates expression of several glucose transporter
           (HXT) genes in response to glucose; binds to promoters
           and acts both as a transcriptional activator and
           repressor
          Length = 1170

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 40/83 (48%), Gaps = 10/83 (12%)

Query: 74  SSSQNAQREGGGNGS--------IASPAGSQNLRVAQACDRCRSKKTRCDGKRPQ--CSQ 123
           ++S ++ + GG + S         AS A  +  + ++ACD+CR KK +CD K  +  CS 
Sbjct: 9   TNSSDSTKNGGTSNSPDDMDSAAAASHAIKKRTKASRACDQCRKKKIKCDYKDEKGVCSN 68

Query: 124 CAAVGFECKISDRLSRRAFPRGY 146
           C   G  C       +R   +GY
Sbjct: 69  CQRNGDRCSFDRVPLKRGPSKGY 91

>Suva_4.499 Chr4 complement(871565..872917) [1353 bp, 450 aa] {ON}
           YBR240C (REAL)
          Length = 450

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 27/60 (45%)

Query: 78  NAQREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRL 137
           N +++     +++S       R    C  CR KK RCD  RP CS CA  G  C    RL
Sbjct: 3   NCKKQRSKKVTLSSKPSPTKGRTFTGCWACRFKKRRCDENRPICSLCAKHGDRCSYDIRL 62

>NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {ON}
           Anc_7.17
          Length = 1161

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           R++  C  CR  KT+CD ++P C++C     +C
Sbjct: 64  RISFVCQECRKAKTKCDKEKPYCTRCVKQNIKC 96

>Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}
           YKL222C (REAL)
          Length = 688

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 19/33 (57%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           +  +AC  CR KK +CD  RPQC QC     EC
Sbjct: 11  KAIKACLNCRRKKQKCDQARPQCYQCRIRKTEC 43

>KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa]
           {ON} weakly similar to uniprot|P25611 Saccharomyces
           cerevisiae YCR106W RDS1 Regulator of drug sensitivity
           transcriptional regulator
          Length = 1040

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKIS 134
           RV+  C  CR +KTRCD   P CS+C A+  EC  S
Sbjct: 70  RVSYVCYACRRRKTRCDRGNP-CSKCVALSTECVYS 104

>Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL038W
           (REAL)
          Length = 1171

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 39/83 (46%), Gaps = 10/83 (12%)

Query: 74  SSSQNAQREGGGNGS--------IASPAGSQNLRVAQACDRCRSKKTRCDGK--RPQCSQ 123
           ++S ++ + GG + S          S A  +  + ++ACD+CR KK +CD K  R  CS 
Sbjct: 9   TNSSDSTKNGGTSNSPEDMDPAAATSHAMKKRTKASRACDQCRKKKIKCDYKDERGVCSN 68

Query: 124 CAAVGFECKISDRLSRRAFPRGY 146
           C   G  C       +R   +GY
Sbjct: 69  CQRNGDRCSFERVPLKRGPSKGY 91

>Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL038W
           (REAL)
          Length = 1171

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 42/86 (48%), Gaps = 9/86 (10%)

Query: 70  SMTGSSSQNAQREGGGN-------GSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQ-- 120
           +++ +SS +A+  G  N        + AS A  +  + ++ACD+CR KK +CD K  +  
Sbjct: 6   TVSTNSSDSAKNGGLSNSPEDMDSAAAASHAIKKRTKASRACDQCRKKKIKCDYKDEKGL 65

Query: 121 CSQCAAVGFECKISDRLSRRAFPRGY 146
           CS C   G  C       +R   +GY
Sbjct: 66  CSNCQRNGDRCSFERVPLKRGPSKGY 91

>Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig
           274] FULL
          Length = 628

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 89  IASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           + +P   +N R++  CD CR +K +C+ ++P CS+C     +C
Sbjct: 1   MQTPKSKKN-RISHVCDACRIRKLKCNKQKPSCSRCVKHDLQC 42

>CAGL0K05841g Chr11 (573144..577262) [4119 bp, 1372 aa] {ON} similar
           to uniprot|P12351 Saccharomyces cerevisiae YLR256w HAP1
           transcription factor
          Length = 1372

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 128
           RV  +C  CR +K +CD  RP C+QC   G
Sbjct: 66  RVPLSCTICRRRKVKCDKSRPNCTQCVKTG 95

>Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340)
           [3870 nt, 1290 aa]
          Length = 1289

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 23/44 (52%)

Query: 85  GNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVG 128
            N S ++    +  R+  +C  CR +K +CD  RP C+QC   G
Sbjct: 8   SNDSASNKVKRKRNRIPLSCTICRKRKVKCDKTRPHCNQCTKTG 51

>Ecym_2263 Chr2 (518089..519615) [1527 bp, 508 aa] {ON} similar to
           Ashbya gossypii AFL033W
          Length = 508

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 33/73 (45%), Gaps = 8/73 (10%)

Query: 72  TGSSSQNAQREGGGNGSIASPAGSQ-------NLRVAQACDRCRSKKTRCDGKRPQCSQC 124
           TG+S   + +  G  G I +PAG+          R    C  CR KK RCD +RP CS C
Sbjct: 4   TGTSCSKSTKNPGETGGI-TPAGASLKALPKSKARSFTGCWACRFKKRRCDERRPFCSLC 62

Query: 125 AAVGFECKISDRL 137
              G  C    RL
Sbjct: 63  TKHGDSCSYDVRL 75

>Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa]
           {ON} YAL051W (REAL)
          Length = 1000

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRG 145
           R++  C  CR  KT+CD ++P+C +C      C I D ++R+A PR 
Sbjct: 20  RLSFVCQACRKAKTKCDQEKPRCGRCTKQNLFC-IYD-VARQAAPRN 64

>Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W
           (REAL)
          Length = 468

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 103 ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRR 140
           ACD CR ++ +CDGK+P C +C    FEC     L +R
Sbjct: 7   ACDYCRVRRVKCDGKKP-CRRCLQHNFECTHQQPLKKR 43

>Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON}
           (11943..14819) [2877 nt, 959 aa]
          Length = 958

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 38/83 (45%), Gaps = 4/83 (4%)

Query: 66  PQSASMTGSSSQNAQREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCD--GKRPQCSQ 123
           P + S T +++   +      GS     G +  +  +ACD+CR +K +CD    +  CS 
Sbjct: 39  PTTGSATSTAAPGKRSRSSSTGSAKGSIGGK--KATRACDQCRKRKIKCDYDNDKNVCSS 96

Query: 124 CAAVGFECKISDRLSRRAFPRGY 146
           C   G  C+ +    +R   +G+
Sbjct: 97  CNRNGDRCQFNRVQLKRGPSKGF 119

>TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.60
           YLR266C
          Length = 935

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 3/77 (3%)

Query: 62  SSSVPQSASMTGSSS--QNAQREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRP 119
           S+++ + ++ TG+ +    +Q+      S  S    +   + + C  CR KK +CD +RP
Sbjct: 38  SNTISRPSTTTGNCNLRNGSQKHYRQRASQISGTRKKRKTIIKTCLFCREKKLKCDKRRP 97

Query: 120 QCSQCAAVGF-ECKISD 135
            CS C A  F EC   D
Sbjct: 98  LCSSCIARNFTECVYVD 114

>TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.109
           YOL089C
          Length = 996

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 5/47 (10%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQ---CSQCAAVGFEC--KISDRLSRR 140
           RVA+ACD CR +K +CD   PQ   CS C      C  ++ D + +R
Sbjct: 113 RVARACDHCRRRKIKCDPVNPQTNKCSNCTKYDANCTFRVRDDVEKR 159

>Ecym_2522 Chr2 (1017930..1020710) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii AGL233C
          Length = 926

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (67%), Gaps = 1/34 (2%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-EC 131
           +V+++C  CR ++ +CD  RP+CS C + G  EC
Sbjct: 14  KVSKSCVFCRKRRVKCDKARPKCSTCVSKGLPEC 47

>Smik_12.6 Chr12 complement(17429..19966) [2538 bp, 845 aa] {ON}
           YLL054C (REAL)
          Length = 845

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 24/41 (58%)

Query: 91  SPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           +PA  + ++ +  C RC+ +KT+CD   P CS+C A    C
Sbjct: 2   NPASRKKVKPSFVCLRCKQRKTKCDKLWPTCSKCKASSSIC 42

>KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {ON}
           
          Length = 1136

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 21/33 (63%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           R++  C  CR  K +CD ++P+C++C   G +C
Sbjct: 45  RISFVCQNCRKSKMKCDREKPECTRCLKQGIKC 77

>NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON} 
          Length = 656

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           R    C  CR++K RC+ +RP CS+C  +G  C
Sbjct: 10  RPTHVCAACRTQKLRCNRERPSCSRCQRIGRTC 42

>TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON} 
          Length = 918

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 1/63 (1%)

Query: 76  SQNAQREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECKIS 134
           S    +    + ++  P   +     ++C  CR +K +CD  +P CS C A  F EC  S
Sbjct: 7   SSKISKNSPESSAVNKPPRKKRRSTIKSCSFCRRRKLKCDKSKPLCSTCRARNFTECIYS 66

Query: 135 DRL 137
           D +
Sbjct: 67  DAI 69

>KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON} conserved
           hypothetical protein
          Length = 639

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 20/39 (51%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRL 137
           R    C +C+S K +CD  +P C  C   GF+C  S  L
Sbjct: 12  RSYMGCQKCKSLKKKCDEVKPHCGYCKKRGFQCDYSRTL 50

>NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879
          Length = 839

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 103 ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
            C  CRS+K +CD +RP C +C   G EC
Sbjct: 20  GCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48

>TBLA0A05860 Chr1 (1449582..1452014) [2433 bp, 810 aa] {ON} 
          Length = 810

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 31/73 (42%), Gaps = 7/73 (9%)

Query: 72  TGSSSQNAQREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           T SS Q AQ           PA  ++ R  Q CDRCR  K +C G   QC+ C      C
Sbjct: 18  TNSSEQPAQ------SGPPDPANWES-RRDQVCDRCRKLKKKCYGLGRQCNNCQLSNNPC 70

Query: 132 KISDRLSRRAFPR 144
                L RR  P+
Sbjct: 71  TTMATLKRRRKPK 83

>CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some
           similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089c HAL9 or uniprot|P38114 Saccharomyces
           cerevisiae YBR150c TBS1
          Length = 1049

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 99  RVAQACDRCRSKKTRCDGKRP---QCSQCAAVGFEC 131
           R  +ACD CR +K RCD   P   +CS C     EC
Sbjct: 36  RSTKACDHCRKRKIRCDEVNPVTNKCSNCVKFKVEC 71

>Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013C
           (PDR1) - zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type [contig 207]
           FULL
          Length = 924

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 38/183 (20%), Positives = 69/183 (37%), Gaps = 24/183 (13%)

Query: 536 IGNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVFS 595
           IG     Y+L       AQ L +HR    V       M++     RR L+W  Y+ D   
Sbjct: 429 IGEYHLFYQLLSLATGYAQNLGIHRWEFYV------GMDEEMAEKRRCLWWKCYFWDKLF 482

Query: 596 ALQLGVPRLIKDFEIECALP-------VADNDDRTVNLAGQQIRLEGQVTNYSLA-IIRF 647
           ++  G   +I +  + C LP       + D ++    +      LEG   +  L  ++  
Sbjct: 483 SIHTGKQAIICEAFVNCLLPKYFQQLGILDAEEFLAKVTTMNENLEGSGKDLILYFVVAL 542

Query: 648 SKVLGNILDSIFKRGMTESITKQVSLIHENALDNWRHGLPKELIFELDVNGTINIDEFNR 707
           S ++G+  D +       +   Q             H L + L+ +L  +  I I  F+ 
Sbjct: 543 SLIVGDFFDGVLYNKKYTNFRNQAK----------PHSLRERLVKDLVKDVNIFISRFDA 592

Query: 708 LKQ 710
           +++
Sbjct: 593 IER 595

 Score = 37.0 bits (84), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKIS 134
           +V++AC+ CR +K +C G +P C  C     EC  S
Sbjct: 14  KVSRACNNCRRRKIKCTGAQP-CLNCQTYRCECTYS 48

>KAFR0I02030 Chr9 complement(416471..420172) [3702 bp, 1233 aa] {ON}
           Anc_1.380 YLR256W
          Length = 1233

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 128
           R+  +C  CR +K +CD  RP C+QC   G
Sbjct: 33  RIPLSCTICRKRKVKCDKIRPHCNQCTKTG 62

>KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene
           extends into a gap in the genome sequence
          Length = 729

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 27/52 (51%), Gaps = 6/52 (11%)

Query: 85  GNGSIASPAGSQNLRVAQ----ACDRCRSKKTRCDGKRPQCSQCAAVGF-EC 131
           G  S   PA +Q+ R  +     C  CR +K RCD  RP CS C A GF EC
Sbjct: 3   GKRSATDPA-TQDTRKKRKHIRTCTFCRQRKVRCDQGRPLCSSCKARGFSEC 53

>KNAG0I01450 Chr9 (277513..281943) [4431 bp, 1476 aa] {ON} 
          Length = 1476

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 128
           R+  +C  CR +K +CD  RP C+QC   G
Sbjct: 47  RIPLSCTICRKRKVKCDKTRPHCNQCTKTG 76

>Smik_4.269 Chr4 complement(491110..493446) [2337 bp, 778 aa] {ON}
           YDR034C (REAL)
          Length = 778

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 34/84 (40%), Gaps = 19/84 (22%)

Query: 51  PPYEQDDDSKESSSVPQSA---SMTGSSSQNAQREGGGNGSIASPAGSQNLRVAQACDRC 107
           P   Q  DS+ SS  P SA   ++T       +R+   NG                C  C
Sbjct: 107 PNTSQQKDSEHSSLTPNSAVTSTVTDKKGNTVKRKYSRNG----------------CSEC 150

Query: 108 RSKKTRCDGKRPQCSQCAAVGFEC 131
           + ++ +CD  +P C QCA +   C
Sbjct: 151 KRRRMKCDETKPTCWQCARLNRHC 174

>ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa]
           {ON} some similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 1066

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 6/72 (8%)

Query: 76  SQNAQREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRC--DGKRPQCSQCAAVGFECKI 133
           SQ++Q   GGN S    A  +  + ++ACD+CR +K RC  D  +  C+ C   G  C  
Sbjct: 44  SQSSQGASGGNTS----ASKRRTKASRACDQCRKRKIRCDYDDDKGVCTSCRKNGESCAF 99

Query: 134 SDRLSRRAFPRG 145
                +R   +G
Sbjct: 100 ERIQLKRGPSKG 111

>KNAG0C05980 Chr3 complement(1164771..1167677) [2907 bp, 968 aa]
           {ON} 
          Length = 968

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 35/75 (46%), Gaps = 7/75 (9%)

Query: 71  MTGSSSQNAQREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFE 130
           M GSSS     +G     +  PA  +  +   AC  CR +K +C GK P CS C A    
Sbjct: 1   MDGSSSVRKWADG-----VQKPAHRRR-KTVLACTNCRRRKIKCTGKWP-CSNCEAYSCV 53

Query: 131 CKISDRLSRRAFPRG 145
           C+  D+ ++  F  G
Sbjct: 54  CEYVDKAAQVKFAGG 68

>TBLA0D00630 Chr4 complement(164651..167884) [3234 bp, 1077 aa] {ON}
           Anc_7.389 YBL066C
          Length = 1077

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 4/47 (8%)

Query: 90  ASPAGSQNLRVAQACDRCRSKKTRCDG--KRPQ-CSQCAAVGFECKI 133
           A PA + N R   +C  CR +K RC+   K+PQ C++CA +  +C I
Sbjct: 18  ALPAAT-NHRPVTSCTHCRQQKIRCNALQKQPQPCTRCAKLNLKCNI 63

>Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON}
           YGR288W (REAL)
          Length = 143

 Score = 39.7 bits (91), Expect = 0.011,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 1/42 (2%)

Query: 100 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRA 141
           V QACD CR ++ +CDGK P C +C      C     L +R 
Sbjct: 37  VKQACDCCRVRRVKCDGKGP-CGRCLQRDLNCTYLQPLRKRG 77

>KAFR0E02330 Chr5 (468300..470414) [2115 bp, 704 aa] {ON} Anc_5.59
           YHR178W
          Length = 704

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 20/38 (52%)

Query: 103 ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRR 140
           +C RCR  K +C  + P C  C  VG EC    R +RR
Sbjct: 14  SCSRCRKLKKKCPREVPVCGHCVRVGAECSYPGRAARR 51

>KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]
           {ON} similar to uniprot|P43634 Saccharomyces cerevisiae
           YLR098C CHA4 Zinc-finger protein with Zn[2]-Cys[6]
           fungal- type binuclear cluster domain DNA-binding
           transcriptional activator or CHA1 and some similarities
           to YOR337W uniprot|P47988 Saccharomyces cerevisiae
           YOR337W TEA1 Mutants are defective in Ty1
           Enhancer-mediated Activation Ty1 enhancer activator
          Length = 603

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 94  GSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           G +  +   AC  CR K+ +CD +RP CS C   G EC
Sbjct: 7   GKRKRKAHLACQNCRIKRRKCDMERP-CSNCLKYGIEC 43

>Suva_10.351 Chr10 (613486..614460) [975 bp, 324 aa] {ON} YLR256W
           (REAL)
          Length = 324

 Score = 41.2 bits (95), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 33/82 (40%), Gaps = 16/82 (19%)

Query: 63  SSVPQSASMTGSS-----SQNAQREGGGNGSIASPAG-----------SQNLRVAQACDR 106
           SS P  ASMT SS       +     G N S  SP              +  R+  +C  
Sbjct: 8   SSAPSIASMTHSSVSRSPDMHTVTTPGTNTSSNSPPSLHMSSESSKIKRKRNRIPLSCTI 67

Query: 107 CRSKKTRCDGKRPQCSQCAAVG 128
           CR +K +CD  RP C QC   G
Sbjct: 68  CRKRKVKCDKFRPHCQQCTKTG 89

>YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}
           PUT3Transcriptional activator of proline utilization
           genes, constitutively binds PUT1 and PUT2 promoter
           sequences as a dimer and undergoes a conformational
           change to form the active state; differentially
           phosphorylated in the presence of different nitrogen
           sources; has a Zn(2)-Cys(6) binuclear cluster domain
          Length = 979

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 67/151 (44%), Gaps = 12/151 (7%)

Query: 541 AIYELRGRVVSMAQQLRLHRCPSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSALQLG 600
           A Y   G+ +     L LH      +     T+++ E    R L+W +Y  +   + + G
Sbjct: 479 ASYFYFGQALRTCLILGLH------VDSQSDTLSRYEIEHHRRLWWTVYMFERMLSSKAG 532

Query: 601 VPRLIKDFEIECALPVADNDDRTVNLAGQQ-IRLEGQVTNYSLAIIRFSKVLGNILDSIF 659
           +P    D+ I  ALP AD DD T+       +  + ++ +  + I+   K+   IL  ++
Sbjct: 533 LPLSFTDYTISTALP-ADIDDETIEEKNSHYVFRKAELISNCVTIV---KINAQILSKLY 588

Query: 660 KRGMTESITKQVSLIHENALDNWRHGLPKEL 690
           +R    +I   + ++ +  L+ WR+ L   L
Sbjct: 589 QRQPETNIIITLKVVIKQLLE-WRNNLSDSL 618

>CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {ON}
           weakly similar to uniprot|P39961 Saccharomyces
           cerevisiae YER184c
          Length = 835

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           RV +ACD CR +K +CDG +P CS C      C
Sbjct: 16  RVIRACDVCRKRKVKCDGDQP-CSSCMTASTVC 47

>ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]
           {ON} weakly similar to uniprot|P39961 Saccharomyces
           cerevisiae YER184C Hypothetical ORF
          Length = 724

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 135
           +V +AC  CR +K RCDG  P CS C ++  EC   D
Sbjct: 8   KVKRACQICRRRKIRCDGYLP-CSSCVSLKKECNYHD 43

>YBR240C Chr2 complement(700490..701842) [1353 bp, 450 aa] {ON}
           THI2Transcriptional activator of thiamine biosynthetic
           genes; interacts with regulatory factor Thi3p to control
           expression of thiamine biosynthetic genes with respect
           to thiamine availability; acts together with Pdc2p to
           respond to thiaminediphosphate demand, possibly as
           related to carbon source availability; zinc finger
           protein of the Zn(II)2Cys6 type
          Length = 450

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 27/67 (40%), Gaps = 4/67 (5%)

Query: 71  MTGSSSQNAQREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFE 130
           M  S  Q   ++   +  +    G    R    C  CR KK RCD  RP CS CA  G  
Sbjct: 1   MVNSKRQQRSKKVASSSKVPPTKG----RTFTGCWACRFKKRRCDENRPICSLCAKHGDN 56

Query: 131 CKISDRL 137
           C    RL
Sbjct: 57  CSYDIRL 63

>NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa] {ON}
           Anc_4.113
          Length = 1118

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRR 140
           +V +ACD CR +K +C GK P C+ C A    C  S +  R+
Sbjct: 58  KVTKACDNCRRRKIKCTGKTP-CATCEAYQCLCIYSTQRGRK 98

>NDAI0A05750 Chr1 complement(1302180..1304459) [2280 bp, 759 aa]
           {ON} Anc_3.264
          Length = 759

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 41/76 (53%), Gaps = 11/76 (14%)

Query: 58  DSKESSSVP--QSASMTGSSSQNAQREGGGNGSIASPAGSQNLRVAQACDRCRSKKTRCD 115
           ++KE+S+ P  ++  ++ S++  + ++G     IA    S+N      C  C+ ++ +CD
Sbjct: 92  ETKENSTPPIIKTEDVSASNASTSDKKG----HIAKRKYSRN-----GCTECKRRRMKCD 142

Query: 116 GKRPQCSQCAAVGFEC 131
             +P C QCA +  EC
Sbjct: 143 ETKPICWQCARLNREC 158

>Suva_8.421 Chr8 complement(757924..760932) [3009 bp, 1002 aa] {ON}
           YOR363C (REAL)
          Length = 1002

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 94  GSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRG 145
           G +  R++  C  CR  KT+CD ++P+C +C      C I D ++R+  PR 
Sbjct: 15  GKKRNRLSFVCQACRKAKTKCDQEKPRCGRCTKQNLFC-IYD-VARQKAPRN 64

>NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON}
           Anc_1.380 YLR256W
          Length = 1581

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 17/30 (56%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 128
           RV  +C  CR +K +CD  RP C QC   G
Sbjct: 61  RVPLSCTICRKRKVKCDKIRPHCQQCTKTG 90

>Suva_10.18 Chr10 complement(36048..38576) [2529 bp, 842 aa] {ON}
           YLL054C (REAL)
          Length = 842

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%)

Query: 91  SPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 131
           +PA  +N + +  C RC+ +K +CD   P CS+C A    C
Sbjct: 2   NPALRKNAKPSFVCLRCKQRKIKCDKLWPTCSKCKASSSAC 42

>KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa]
           {ON} some similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 1148

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 6/50 (12%)

Query: 85  GNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRP---QCSQCAAVGFEC 131
             G    PA     RV++ACDRCR +K +CD   P   +CS C      C
Sbjct: 18  AEGVTTKPAKK---RVSKACDRCRRRKIKCDDLDPVSGKCSNCIKYKVPC 64

>Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL038W
           (REAL)
          Length = 1169

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 93  AGSQNLRVAQACDRCRSKKTRCDGK--RPQCSQCAAVGFECKISDRLSRRAFPRGY 146
           A  +  + ++ACD+CR KK +CD K  R  C+ C   G  C       +R   +GY
Sbjct: 36  AMKKRTKASRACDQCRKKKIKCDYKDERGVCTNCQRNGDRCSFERVPLKRGPSKGY 91

>Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019W
           (REAL)
          Length = 894

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 86  NGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLS 138
           N + ++      LRV +AC+ C+ +K +CDG +P C  C+    EC+   +++
Sbjct: 14  NTAASNENSKTRLRVQKACELCKKRKVKCDGNKP-CLNCSKHQKECRYDFKVT 65

>Skud_5.331 Chr5 complement(543439..543951) [513 bp, 170 aa] {ON}
           YER184C (REAL)
          Length = 170

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 1/41 (2%)

Query: 96  QNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDR 136
           Q  RV++AC+RCR KK +CD K+P C  C     +C+  ++
Sbjct: 10  QGSRVSKACERCRRKKVKCDSKKP-CFGCIGSQSKCRYKNQ 49

>YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putative
           transcription factor; contains a Zn(II)2Cys6 zinc finger
           domain characteristic of DNA-binding proteins;
           computational analysis suggests a role in regulation of
           expression of genes encoding transporters; binds Sin3p
           in a two-hybrid assay;
          Length = 949

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 5/51 (9%)

Query: 94  GSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC----KISDRLSRR 140
           G   LRV +AC+ C+ +K +CDG  P C  C+    EC    K ++R  RR
Sbjct: 77  GKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRR 126

>ZYRO0E05412g Chr5 (410945..414679) [3735 bp, 1244 aa] {ON} similar
           to uniprot|P12351 Saccharomyces cerevisiae YLR256W HAP1
          Length = 1244

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 5/49 (10%)

Query: 85  GNGSIASPAGSQNL-----RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 128
           G  +   PA +  +     R+  +C  CR +K +CD  RP C QC+  G
Sbjct: 11  GTSAATDPAAANKMKRKRNRIPLSCTICRKRKVKCDKTRPNCEQCSKTG 59

>SAKL0D07898g Chr4 complement(653332..657066) [3735 bp, 1244 aa]
           {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
           YLR256W HAP1
          Length = 1244

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 128
           RV  +C  CR +K +CD  RP C QC+  G
Sbjct: 11  RVPLSCTICRKRKVKCDKTRPHCQQCSKTG 40

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 108,842,108
Number of extensions: 4165413
Number of successful extensions: 21427
Number of sequences better than 10.0: 701
Number of HSP's gapped: 21662
Number of HSP's successfully gapped: 771
Length of query: 1250
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1129
Effective length of database: 39,606,813
Effective search space: 44716091877
Effective search space used: 44716091877
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 72 (32.3 bits)