Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0G14256g8.844ON1259124757880.0
TDEL0B005408.844ON111597123880.0
YML117W (NAB6)8.844ON1134113116620.0
CAGL0B02365g8.844ON105088616330.0
KAFR0A028508.844ON104277016230.0
Smik_13.178.844ON113177015960.0
NDAI0E002708.844ON119895215750.0
Suva_13.268.844ON112275915650.0
TPHA0I002708.844ON103972515490.0
SAKL0D01364g8.844ON108284515520.0
TBLA0B032808.844ON136284415630.0
NCAS0B002808.844ON108178115130.0
KNAG0G034408.844ON105372514540.0
Kwal_27.102398.844ON91472914291e-179
KLTH0C03784g8.844ON99769813681e-169
ABL122C8.844ON104378512831e-156
Ecym_46158.844ON106773012411e-150
Kpol_1068.58.844ON103232111251e-134
KLLA0D01485g8.844ON115171711091e-130
TBLA0B052106.183ON7102254945e-51
NCAS0H010406.183ON6292274852e-50
Ecym_22336.183ON5762614805e-50
AFL061C6.183ON5232614749e-50
SAKL0A05280g6.183ON5822014752e-49
KLLA0E19031g6.183ON6522564764e-49
Kwal_27.111586.183ON5672014716e-49
Kpol_1002.696.183ON5902014682e-48
CAGL0C01419g6.183ON6392014693e-48
Suva_16.1236.183ON5962014648e-48
KAFR0B066906.183ON5332014581e-47
KLTH0H04906g6.183ON5692034592e-47
Smik_6.3906.183ON6252014603e-47
Skud_16.946.183ON6142014594e-47
YPL184C (MRN1)6.183ON6122014586e-47
NDAI0F022606.183ON6802014616e-47
TDEL0G016206.183ON5842014522e-46
KNAG0M004306.183ON4432254405e-46
TPHA0J022106.183ON5932014461e-45
ZYRO0G08140g6.183ON6322014444e-45
Skud_13.248.844ON1128331614e-10
ZYRO0F07238g8.670ON3892201291e-06
Ecym_24038.670ON375691000.003
NDAI0E011908.670ON358206980.006
KLTH0D11088g8.670ON42268930.023
KAFR0A038308.670ON37465930.025
ACR135C8.670ON37669920.031
TDEL0A061608.670ON378214880.097
Suva_8.2928.670ON37069860.17
YOR242C (SSP2)8.670ON37169860.17
Smik_15.4268.670ON371231860.18
TPHA0D012108.670ON36470850.20
KAFR0D016608.797ON21255800.62
TBLA0C018208.670ON39467810.71
TDEL0C016007.387ON1105112820.73
Kwal_26.87638.670ON42668801.0
YDR160W (SSY1)8.342ON85294801.1
Kpol_1013.18.670ON39470771.8
NCAS0B009508.797ON219169752.5
Kpol_543.175.486ON42875763.0
KLLA0F11275g8.670ON38573763.1
KAFR0D026003.379ON28853734.7
Kpol_1069.88.822ON449181744.9
Skud_4.4188.342ON85189745.3
TBLA0J018707.157ON47041735.9
Kpol_1044.37.86ON93269738.3
Suva_14.3402.419ON67953728.5
Smik_4.4048.342ON85284729.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0G14256g
         (1259 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa...  2234   0.0  
TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8....   924   0.0  
YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putati...   644   0.0  
CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] ...   633   0.0  
KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {...   629   0.0  
Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W ...   619   0.0  
NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844     611   0.0  
Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W ...   607   0.0  
TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON...   601   0.0  
SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} simil...   602   0.0  
TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {...   606   0.0  
NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844     587   0.0  
KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {...   564   0.0  
Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117...   555   e-179
KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} simila...   531   e-169
ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON} ...   498   e-156
Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {...   482   e-150
Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,...   437   e-134
KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} simil...   431   e-130
TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa] ...   194   5e-51
NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {O...   191   2e-50
Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}...   189   5e-50
AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON} S...   187   9e-50
SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {...   187   2e-49
KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} simi...   187   4e-49
Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184...   186   6e-49
Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa] ...   184   2e-48
CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {...   185   3e-48
Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {...   183   8e-48
KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON} Anc_6...   181   1e-47
KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {...   181   2e-47
Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C ...   181   3e-47
Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {O...   181   4e-47
YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON} ...   181   6e-47
NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183    182   6e-47
TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {O...   178   2e-46
KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON...   174   5e-46
TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6....   176   1e-45
ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} simila...   175   4e-45
Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W ...    67   4e-10
ZYRO0F07238g Chr6 complement(586327..587496) [1170 bp, 389 aa] {...    54   1e-06
Ecym_2403 Chr2 (785307..786434) [1128 bp, 375 aa] {ON} similar t...    43   0.003
NDAI0E01190 Chr5 (237093..238169) [1077 bp, 358 aa] {ON} Anc_8.6...    42   0.006
KLTH0D11088g Chr4 complement(906439..907707) [1269 bp, 422 aa] {...    40   0.023
KAFR0A03830 Chr1 complement(779143..780267) [1125 bp, 374 aa] {O...    40   0.025
ACR135C Chr3 complement(585997..587127) [1131 bp, 376 aa] {ON} S...    40   0.031
TDEL0A06160 Chr1 complement(1078577..1079713) [1137 bp, 378 aa] ...    39   0.097
Suva_8.292 Chr8 complement(527751..528863) [1113 bp, 370 aa] {ON...    38   0.17 
YOR242C Chr15 complement(788742..789857) [1116 bp, 371 aa] {ON} ...    38   0.17 
Smik_15.426 Chr15 complement(738453..739568) [1116 bp, 371 aa] {...    38   0.18 
TPHA0D01210 Chr4 complement(253331..254425) [1095 bp, 364 aa] {O...    37   0.20 
KAFR0D01660 Chr4 (330013..330651) [639 bp, 212 aa] {ON} Anc_8.79...    35   0.62 
TBLA0C01820 Chr3 complement(429227..430411) [1185 bp, 394 aa] {O...    36   0.71 
TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7....    36   0.73 
Kwal_26.8763 s26 complement(934672..935952) [1281 bp, 426 aa] {O...    35   1.0  
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...    35   1.1  
Kpol_1013.1 s1013 complement(54..1238) [1185 bp, 394 aa] {ON} co...    34   1.8  
NCAS0B00950 Chr2 (150330..150989) [660 bp, 219 aa] {ON} Anc_8.797      33   2.5  
Kpol_543.17 s543 (37962..39248) [1287 bp, 428 aa] {ON} (37962..3...    34   3.0  
KLLA0F11275g Chr6 (1038770..1039927) [1158 bp, 385 aa] {ON} weak...    34   3.1  
KAFR0D02600 Chr4 complement(514523..515369,515443..515462) [867 ...    33   4.7  
Kpol_1069.8 s1069 (14170..15519) [1350 bp, 449 aa] {ON} (14170.....    33   4.9  
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...    33   5.3  
TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa] {...    33   5.9  
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    33   8.3  
Suva_14.340 Chr14 complement(596181..598220) [2040 bp, 679 aa] {...    32   8.5  
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...    32   9.4  

>ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa]
            {ON} similar to uniprot|Q03735 Saccharomyces cerevisiae
            YML117W NAB6 Putative RNA-binding protein based on
            computational analysis of large-scale protein-protein
            interaction data
          Length = 1259

 Score = 2234 bits (5788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1116/1247 (89%), Positives = 1116/1247 (89%)

Query: 13   GHWNAPYRSRERIQEXXXXXXXXXXXXXXXPTRVMANSPMAFPPVGSLXXXXXXXXXXXX 72
            GHWNAPYRSRERIQE               PTRVMANSPMAFPPVGSL            
Sbjct: 13   GHWNAPYRSRERIQEHQHQHQHQYQYQQQHPTRVMANSPMAFPPVGSLQAQYAPPQPAYY 72

Query: 73   XXXGPPLMNPPPTPFDTAYGITLLPSHLLIGSPFVSSPDLFXXXXXXXXXXXXXXXXXXI 132
               GPPLMNPPPTPFDTAYGITLLPSHLLIGSPFVSSPDLF                  I
Sbjct: 73   AAAGPPLMNPPPTPFDTAYGITLLPSHLLIGSPFVSSPDLFQSQQQSQHHHHHQNHQHQI 132

Query: 133  GMVNSNASHQSLNQRHRRSANQRNKGSYNNNSDTNISTNGHSRLSEASYXXXXXXXXXXX 192
            GMVNSNASHQSLNQRHRRSANQRNKGSYNNNSDTNISTNGHSRLSEASY           
Sbjct: 133  GMVNSNASHQSLNQRHRRSANQRNKGSYNNNSDTNISTNGHSRLSEASYPVPPPLKNPPV 192

Query: 193  XARNRHRRRAQNEQADKMFKEPFVVTYRMLPKGDDEYRTRSLLFENVNGSVDLYSFVSKY 252
             ARNRHRRRAQNEQADKMFKEPFVVTYRMLPKGDDEYRTRSLLFENVNGSVDLYSFVSKY
Sbjct: 193  VARNRHRRRAQNEQADKMFKEPFVVTYRMLPKGDDEYRTRSLLFENVNGSVDLYSFVSKY 252

Query: 253  SRYGPVESIYMFKDRNDKTKHSVLLSFLSRKICLDSYNSVLQRLAEFKTGLKSKSLTVSF 312
            SRYGPVESIYMFKDRNDKTKHSVLLSFLSRKICLDSYNSVLQRLAEFKTGLKSKSLTVSF
Sbjct: 253  SRYGPVESIYMFKDRNDKTKHSVLLSFLSRKICLDSYNSVLQRLAEFKTGLKSKSLTVSF 312

Query: 313  VSLKYRKHVDENEVDQNDNSSSTPMNETDDTDASKTPVATSNVQDDAYNVTVVASLQYDI 372
            VSLKYRKHVDENEVDQNDNSSSTPMNETDDTDASKTPVATSNVQDDAYNVTVVASLQYDI
Sbjct: 313  VSLKYRKHVDENEVDQNDNSSSTPMNETDDTDASKTPVATSNVQDDAYNVTVVASLQYDI 372

Query: 373  VNRGATRSVALELDGEYDKTKLLDQELDFLSPANNQRYVLESIYLINAKEPFKHFPKNYA 432
            VNRGATRSVALELDGEYDKTKLLDQELDFLSPANNQRYVLESIYLINAKEPFKHFPKNYA
Sbjct: 373  VNRGATRSVALELDGEYDKTKLLDQELDFLSPANNQRYVLESIYLINAKEPFKHFPKNYA 432

Query: 433  ILTFLNISMAVEVLDYVRNNETARSKFQKCFFVSVSSCPQTSSDGGIVTTSNSITPVASG 492
            ILTFLNISMAVEVLDYVRNNETARSKFQKCFFVSVSSCPQTSSDGGIVTTSNSITPVASG
Sbjct: 433  ILTFLNISMAVEVLDYVRNNETARSKFQKCFFVSVSSCPQTSSDGGIVTTSNSITPVASG 492

Query: 493  GSAGIATNGDLGGYTSKNASLSSLNSVGSYISLDQEIDFLSSSLKGSHTITVAVDEYPKP 552
            GSAGIATNGDLGGYTSKNASLSSLNSVGSYISLDQEIDFLSSSLKGSHTITVAVDEYPKP
Sbjct: 493  GSAGIATNGDLGGYTSKNASLSSLNSVGSYISLDQEIDFLSSSLKGSHTITVAVDEYPKP 552

Query: 553  FFAEFSDHLSNASVLEASALDTQISSPHPQEVIVPSQDSPLVGGAPPLDAVHPAATPALS 612
            FFAEFSDHLSNASVLEASALDTQISSPHPQEVIVPSQDSPLVGGAPPLDAVHPAATPALS
Sbjct: 553  FFAEFSDHLSNASVLEASALDTQISSPHPQEVIVPSQDSPLVGGAPPLDAVHPAATPALS 612

Query: 613  SQVLPLQPHMAMNSGIYMEPFGRRNKTMIKPITQSLQKQFATSAEVANSMGGGIGNRTVY 672
            SQVLPLQPHMAMNSGIYMEPFGRRNKTMIKPITQSLQKQFATSAEVANSMGGGIGNRTVY
Sbjct: 613  SQVLPLQPHMAMNSGIYMEPFGRRNKTMIKPITQSLQKQFATSAEVANSMGGGIGNRTVY 672

Query: 673  IGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPIVLHG 732
            IGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPIVLHG
Sbjct: 673  IGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPIVLHG 732

Query: 733  NMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYSDEYKLPA 792
            NMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYSDEYKLPA
Sbjct: 733  NMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYSDEYKLPA 792

Query: 793  EEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKSFDNRYR 852
            EEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKSFDNRYR
Sbjct: 793  EEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKSFDNRYR 852

Query: 853  GLIIGYGKDRCGNVNKNLISGKNSRFYKKVKKPSYNIRLSRMEEERKKHEETLRSQNQNN 912
            GLIIGYGKDRCGNVNKNLISGKNSRFYKKVKKPSYNIRLSRMEEERKKHEETLRSQNQNN
Sbjct: 853  GLIIGYGKDRCGNVNKNLISGKNSRFYKKVKKPSYNIRLSRMEEERKKHEETLRSQNQNN 912

Query: 913  DEKMLQFGSLGIHLEGNDNNKTSYERSLNGXXXXXXXXXXXXXXXKANGEGGREKDEDNN 972
            DEKMLQFGSLGIHLEGNDNNKTSYERSLNG               KANGEGGREKDEDNN
Sbjct: 913  DEKMLQFGSLGIHLEGNDNNKTSYERSLNGEEEEEQEEVEPNEAEKANGEGGREKDEDNN 972

Query: 973  QEPMNPISKDGNSENHGSGXXXXXXXXXXXXXSNKSQIIDGLGIAAVAGNGKDMVASQDQ 1032
            QEPMNPISKDGNSENHGSG             SNKSQIIDGLGIAAVAGNGKDMVASQDQ
Sbjct: 973  QEPMNPISKDGNSENHGSGEKYQEEEKELLKLSNKSQIIDGLGIAAVAGNGKDMVASQDQ 1032

Query: 1033 DILDRAHESGDEESLDSGVSSNVELILHSPLEGDSNNQKKHEKNNKPFKSKKLENVSATG 1092
            DILDRAHESGDEESLDSGVSSNVELILHSPLEGDSNNQKKHEKNNKPFKSKKLENVSATG
Sbjct: 1033 DILDRAHESGDEESLDSGVSSNVELILHSPLEGDSNNQKKHEKNNKPFKSKKLENVSATG 1092

Query: 1093 TGDVSNYNSSLGEGASAVSNPSISMNPPIAPSTISRNYSLMMKTQNGHPHPRRDSSDRXX 1152
            TGDVSNYNSSLGEGASAVSNPSISMNPPIAPSTISRNYSLMMKTQNGHPHPRRDSSDR  
Sbjct: 1093 TGDVSNYNSSLGEGASAVSNPSISMNPPIAPSTISRNYSLMMKTQNGHPHPRRDSSDRQN 1152

Query: 1153 XXXXXXXXXXXXXXXXXXXXXXXXXXXXPNPSSSHNSGDRMSSHVGNSXXXXXXXXXXXX 1212
                                        PNPSSSHNSGDRMSSHVGNS            
Sbjct: 1153 QQQQQQQQQQQQQQQQQQQQHQQQQQQQPNPSSSHNSGDRMSSHVGNSRGQQGKGRNKRR 1212

Query: 1213 XAKAIPGSDVMAQYLAQLQHSTFMYAANILGATAEGDVDYYEDNTEN 1259
             AKAIPGSDVMAQYLAQLQHSTFMYAANILGATAEGDVDYYEDNTEN
Sbjct: 1213 NAKAIPGSDVMAQYLAQLQHSTFMYAANILGATAEGDVDYYEDNTEN 1259

>TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8.844
            YML117W
          Length = 1115

 Score =  924 bits (2388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/971 (51%), Positives = 644/971 (66%), Gaps = 103/971 (10%)

Query: 195  RNRHRRRAQNEQADKMFKEPFVVTYRMLPKGDDEYRTRSLLFENVNGSVDLYSFVSKYSR 254
            R  H +  Q+  A K FK+PF++TYR+LPKG+DE+RTRSLLFENV+GS+DL+SFV+ ++ 
Sbjct: 146  RGSHYKSIQSSDASKRFKDPFILTYRVLPKGNDEFRTRSLLFENVDGSIDLHSFVTNFTN 205

Query: 255  YGPVESIYMFKDRNDKTKHSVLLSFLSRKICLDSYNSVLQRLAEFKTGLKSKSLTVSFVS 314
            YGPVES+Y+FK   D    S+LLSF S+ ICLD YNSVLQRL+E+K+ L SK+LT+SFVS
Sbjct: 206  YGPVESVYLFKSEGDHV--SILLSFFSKAICLDFYNSVLQRLSEYKSDLDSKALTLSFVS 263

Query: 315  LKYR-KHVDENEVDQNDNSSSTPMNETDDTDASKTPVATSNVQDDAYNVTVVASLQYDIV 373
            L+Y+     E ++D+ D+S                       + DA+N+T   SL+YD++
Sbjct: 264  LEYKVSDTSEEDIDKEDDS-----------------------KPDAFNITAAGSLRYDVI 300

Query: 374  NRGATRSVALELDGEYDKTKLLDQELDFLSPANNQRYVLESIYLINAKEPFKHFPKNYAI 433
            NRGATRS+ +       K +L+D++L+FL   NN RYVLESI L+ A EP KHFP+NYA+
Sbjct: 301  NRGATRSIMITFKTPCSKDELIDKKLEFLKKENNTRYVLESIDLVTADEPSKHFPQNYAV 360

Query: 434  LTFLNISMAVEVLDYVRNNETARSKFQKCFFVSVSSCPQTSSDGGIVTTSNSITPVASGG 493
            LTFLNI MAVE+LDY+R + + +    KCFF+S+   PQ   DG  ++ S++        
Sbjct: 361  LTFLNIFMAVEILDYIRLH-SQKLDISKCFFISIQ--PQIP-DGKRLSVSSA-------- 408

Query: 494  SAGIATNGDLGGYTSKNASLSSLNSVGSYISLDQEIDFLSSSLKGSHT----ITVAVDEY 549
            S G +     G Y SKNAS++SL S GS ISLDQEID ++  L+  ++    + V  + Y
Sbjct: 409  SNGRSMESISGNYRSKNASVTSLESSGSIISLDQEIDEMTYKLQSVNSKKNILEVTTNNY 468

Query: 550  PKPFFAEFSDHLSNASVLEASALDTQISSPHPQEV-----IVPSQDSPL---VGGAPPL- 600
              P F   +DHL+N +V EA++LD+Q++ P PQEV     ++P+QD PL   +  AP + 
Sbjct: 469  KDPSFEGHTDHLTNVTVSEAASLDSQLTMPSPQEVTVNEYVLPNQDMPLPNDMNYAPSVQ 528

Query: 601  --DAVHPAATPALSSQVLPLQPHMAMNSGIYMEPFG-RRNKTMIKPITQSLQKQFATSAE 657
              DAV P+  P      +P  P+     G YM P   R+N  M KPITQSLQ+Q+ATSAE
Sbjct: 529  DVDAVPPSMVPM---STMPNTPY-----GCYMPPPNVRQNGNMTKPITQSLQRQYATSAE 580

Query: 658  VANSMGGGIGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAV 717
            VA+SMGGGIGNRTVYIGNIHPRS+ EDICNVVRGGILQ+++FL +K ICFVTF+EAS AV
Sbjct: 581  VASSMGGGIGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAV 640

Query: 718  QFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYIN 777
            QFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKS++LAVTVGASRNVYVSLP+FAFKDKYI 
Sbjct: 641  QFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIY 700

Query: 778  DPQYQRYSDEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKY 837
            DPQY+ Y+ +++LP EEQLR+DF+ +GDIEQIN+L+DGHCCWVNF NIS+AIKLVEE+KY
Sbjct: 701  DPQYEEYNKKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKY 760

Query: 838  NDGEAFHKSFDNRYRGLIIGYGKDRCGNVNKNLISGKNSRFYKKVKKPSYNIRLSRMEEE 897
              G  F+K    RY GL+IGYGKDRCGNVNKN I+GKNSRFYKKVKKPS+NIRLS+MEEE
Sbjct: 761  EGGGNFYKMLGGRYDGLVIGYGKDRCGNVNKNFIAGKNSRFYKKVKKPSFNIRLSKMEEE 820

Query: 898  RKKHEETLRSQNQNNDEKMLQFGSLGIHLEGNDNNKTSYERSLNGXXXXXXXXXXXXXXX 957
            R++HEETLR Q +NN EK LQFGSLGI ++                              
Sbjct: 821  RRQHEETLRRQQENNSEKFLQFGSLGITID------------------------------ 850

Query: 958  KANGEGGREKDEDNNQEPMNPISKDGNSEN----HGSGXXXXXXXXXXXXXSNKSQIIDG 1013
             +NG+   EK +D + E  + +  D NS        SG             SNKSQ   G
Sbjct: 851  -SNGKEDPEKVDDVDFE--DEVKFDSNSPKKTVEQASGKESDQEEQELLKLSNKSQGAQG 907

Query: 1014 LGIAAVAGNGKDMVASQDQDILDRAHESGDEESLDSGVSSNVELILHSPLEGDSNNQKKH 1073
            L I    G        ++   L R H   DE S  S  SS+VELI++SP E +SN + K 
Sbjct: 908  LNIVESQGQS---TREKEATKLTRNHSENDETSAKSDASSDVELIINSPEEEESNFKSKS 964

Query: 1074 EKNNKPFKSKKLENVSATGTGDVSNYNSSLGEGASAVSNPSISMNPPIAPSTISRNYSLM 1133
             +  +    +KL N  A G      + S+  + +SA+S+ S+  NPP+AP+TISRNYSLM
Sbjct: 965  NRGFRKNDRRKLANC-AEGASSKERFKSTTNDVSSALSSSSLEANPPMAPATISRNYSLM 1023

Query: 1134 MKTQNGHPHPR 1144
             K Q  H   R
Sbjct: 1024 FKQQYNHEKLR 1034

 Score = 72.8 bits (177), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 40/45 (88%)

Query: 1214 AKAIPGSDVMAQYLAQLQHSTFMYAANILGATAEGDVDYYEDNTE 1258
             K+IPGSDVMAQYLAQLQHSTF+YAANILGA+ +GD +Y ++N +
Sbjct: 1070 GKSIPGSDVMAQYLAQLQHSTFIYAANILGASNDGDNNYLDENAD 1114

>YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putative
            RNA-binding protein that associates with mRNAs encoding
            cell wall proteins in high-throughput studies; deletion
            mutants display increased sensitivity to some cell wall
            disrupting agents; expression negatively regulated by
            cAMP
          Length = 1134

 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/1131 (38%), Positives = 608/1131 (53%), Gaps = 202/1131 (17%)

Query: 78   PLMNPPPTPFDTAYGITLLPSHLLIGSPFVS------------SPDLFXXXXXXXXXXXX 125
            PL N PPTPFDTAYG +L PSHLL+GSPFVS            S +L             
Sbjct: 59   PLPNIPPTPFDTAYGASLFPSHLLMGSPFVSSPNMQSGYNSARSSNLKRKAYSRPVSNHN 118

Query: 126  XXXXXXIGMVNSNASHQSLNQRHRRSANQRNKGSYNNNSDTNISTNGHSRLSEASYXXXX 185
                      N+  +       + R    RN  S NNNS  N++ N +            
Sbjct: 119  GYNGNSNSNQNNTNNGMVTPSNYYRMG--RNSFSRNNNSTRNVTHNNNKGCD-------- 168

Query: 186  XXXXXXXXARNRHRRR--AQNEQADKMFKE-----PFVVTYRMLPKGDDEYRTRSLLFEN 238
                     RN   RR  A+N   D +  E     PF + Y++LP GDD YRTRSLL EN
Sbjct: 169  --------TRNNSGRRTFARNNIFDDILPEMLLQRPFCINYKVLPTGDDAYRTRSLLIEN 220

Query: 239  VNGSVDLYSFVSKYSRYGPVESIYMFKD-RNDKTKH------SVLLSFLSRKICLDSYNS 291
            V+ S+DL+S V  + +   +ES Y+ +  ++D +K       S+L+SFL++  CL+ YN+
Sbjct: 221  VDHSIDLHSIVKNFVKSNTLESAYLIEGGKSDDSKDVETKNLSILISFLTKGDCLNFYNN 280

Query: 292  VLQRLAEFKTGLKSKSLTVSFVSLKYRKHVDENEVDQNDNSSSTPMNETDDTDASKTPVA 351
            +LQRL+EFKT LKS++L + FV L Y        ++    + +    E D T+ S     
Sbjct: 281  ILQRLSEFKTFLKSEALNLKFVCLNYDPKCLPTFIESEALTENA--EEADITNGS----- 333

Query: 352  TSNVQDDAYNVTVVASLQYDIVNRGATRSVALELDGEYDKTKLLDQELDFLSPANNQRYV 411
                        + ASL ++I N+ ATRS+ +E     +K+ L  ++L FL  + N+RY+
Sbjct: 334  ----------TMISASLHHNIANKDATRSIIIEFKSPVEKSDLFKKKLQFLDRSKNKRYI 383

Query: 412  LESIYLINAKEPFKHFPKNYAILTFLNISMAVEVLDYVRNNETARSKFQKCFFVSVSSCP 471
            LESI L+N   P   FP+NYA+LTFLNISMA+EVLDY++   +      KCF+VS++   
Sbjct: 384  LESIDLVNTDVPSNQFPENYAVLTFLNISMAIEVLDYLKK-YSKNLGISKCFYVSLAPLV 442

Query: 472  QTSSDGGIV------TTSNSITPVASGGSAGIATNGDLGGYTSKNASLSSLN---SVGSY 522
             +S+   +       T+++ ++  +        +N +     S  + +++LN   S+G  
Sbjct: 443  VSSARSSVANIYEGKTSTHRLSVPSVTAGNNNDSNNNGNNNKSNMSGITTLNNNSSIGVS 502

Query: 523  I---------------SLDQEIDFLSSSLKGSHT----ITVAVDEYPKPFFAEFSDHLSN 563
            +               SL++EID L++ L+G       + +   +Y  P   E S HLSN
Sbjct: 503  VYGHSNMSLTSLSSSVSLNEEIDMLATKLQGVELDGTYLEINYRDYQTPTIEEHSTHLSN 562

Query: 564  ASVLEASALDTQIS----SPHPQEVIVPSQDSPLVGGAPPLDAVHPAATPALSSQVLPLQ 619
              + + +    Q S    SP P    +   DS    GA  +      ATP+      P+ 
Sbjct: 563  VKISKTTENSRQFSQDIPSPLPLNEHMFMNDSNQSNGA--IIPQQLIATPS------PVS 614

Query: 620  PHMAMNSGIYMEPFGRRNKTMIKPITQSLQKQFATSAEVANSMGGGIGNRTVYIGNIHPR 679
            P++ MN            + +  PITQSL++ F  SA+VA+SMG  IGNRT+YIGNI+PR
Sbjct: 615  PNLQMNQ-----------RVLPNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPR 663

Query: 680  SKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPIVLHGNMLKVGW 739
            SK EDICNVVRGGILQSI+++ +K ICFVTFIEA +AVQFY N+FIDPIVLHGNML+VGW
Sbjct: 664  SKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGW 723

Query: 740  GHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYSDEYKLPAEEQLRND 799
            GH+SGPLPK +SLAVT+GASRNVYVSLP+FAFK+K+I+DPQY++  +   LP  EQLR D
Sbjct: 724  GHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLRED 783

Query: 800  FNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEE------IKYNDGE-----AFHKSFD 848
            F+ +GDIEQIN+LSD HCCW+NFMNISSAI LVEE      ++   GE     A  + F 
Sbjct: 784  FSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESGEVTLKRATEEKFG 843

Query: 849  NRYRGLIIGYGKDRCGNVNKNLISGKNSRFYKKVKKPSYNIRLSRMEEERKKHEETLRSQ 908
             RY+GL+I YGKDRCGN+NKNLI+GKNSRFYKKVK+PSYNIRLS++EE+R+++E     +
Sbjct: 844  GRYKGLLINYGKDRCGNINKNLIAGKNSRFYKKVKRPSYNIRLSKLEEKRRQNE---IDE 900

Query: 909  NQNNDEKMLQFGSLGIHLEGNDNNKTSYERSLNGXXXXXXXXXXXXXXXKANGEGGREKD 968
             +   +K L   SLGI L+ + +N                              GG E  
Sbjct: 901  KEKAFDKPLNLESLGISLDAHKDN------------------------------GGGETG 930

Query: 969  EDNNQEPMNPISKDGNSENHGSGXXXXXXXXXXXXXSNKSQIIDGLGIAAVAGNGKDMVA 1028
              NN    N    +  +EN                  N++    GLG+A  + + K   +
Sbjct: 931  TANNTGHENESELEAENEN-----------------GNETGSFGGLGLAVASSDVKRATS 973

Query: 1029 SQD--QDILDRAHESGDEESLDSGVSSNVELILHSPLEGDS--NNQKKHEKNNKPFKSK- 1083
             +   +DI +++  S       S  SS+VE+I+HSP + +    +Q     +     SK 
Sbjct: 974  DETDYEDIFNKSSGS-------SDSSSDVEVIMHSPSDPEYALKSQTLRSSSQTVINSKR 1026

Query: 1084 --KLENVS-ATGTGDVSNYNSSLGEGASAVSNPSISMNPPIAPSTISRNYS 1131
              K+E+   A G   + NY SSL +             PP APST+S N+S
Sbjct: 1027 PVKIEDEEEAVGMSQL-NYRSSLRQA------------PPRAPSTLSYNHS 1064

 Score = 66.6 bits (161), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 29/33 (87%), Positives = 32/33 (96%)

Query: 1215 KAIPGSDVMAQYLAQLQHSTFMYAANILGATAE 1247
            + IPGSDVMAQYLAQ+QHSTFMYAANILGA+AE
Sbjct: 1095 RTIPGSDVMAQYLAQVQHSTFMYAANILGASAE 1127

>CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa]
           {ON} some similarities with uniprot|Q03735 Saccharomyces
           cerevisiae YML117w
          Length = 1050

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/886 (41%), Positives = 519/886 (58%), Gaps = 94/886 (10%)

Query: 78  PLMNPPPTPFDTAYGITLLPSHLLIGSPFVSSPDLFXXXXXXXXXXXXXXXXXXI----- 132
           P  N PPTPFDTAYG +LLPSHLL+GSP +S+ +L                         
Sbjct: 45  PYQNVPPTPFDTAYGASLLPSHLLMGSPMISTTNLPRDNNADLLAGGYNRNNRSFQFRRN 104

Query: 133 -GMV---NSNASHQSLNQRHRRSANQRNKGSYNNNSDTNISTNGHSRLSEASYXXXXXXX 188
            G V   N N  + S  +     A    K +  N++D+++ ++G  +L            
Sbjct: 105 SGFVLQSNGNTPYMSSKRSSLSQAPMSQKRAEKNSTDSSVGSHGKKKL------------ 152

Query: 189 XXXXXARNRHRRRAQNEQADKMFKEPFVVTYRMLPKGDDEYRTRSLLFENVNGSVDLYS- 247
                   +H++R   +   K+   P  + YR+LP GDD Y+TRSLLFENV  + ++ S 
Sbjct: 153 --------QHKKRTPIDVTKKLI-SPISINYRVLPSGDDTYKTRSLLFENVQKNDEMLSV 203

Query: 248 FVSKYSRYGPVESIYMF-------KDR-NDKTKHSVLLSFLSRKICLDSYNSVLQRLAEF 299
           F+     Y  VES+Y+F       KD+ +DK    + LSFLSR+  LD YN+ LQRL +F
Sbjct: 204 FMRLIINYSQVESVYVFQQTDTPSKDKESDKDTCCLQLSFLSRQAALDFYNNFLQRLPDF 263

Query: 300 KTGLKSKSLTVSFVSLKYRKHVDENEVDQNDNSSSTPMNETDDTDASKTPVATSNVQDDA 359
           K  L S  L+VSFVS  Y            D       ++  D +  K  +  S      
Sbjct: 264 KKKLSSPKLSVSFVSFSY----------VTDEDKDKDKDKDKDINTEKRNIKRSQ----- 308

Query: 360 YNVTVVASLQYDIVNRGATRSVALELDGEYDKTKLLDQELDFLSPANNQRYVLESIYLIN 419
             +    +L  +I +  ATRS+A+E   + ++  L ++ L FL   +N+RY+LE++ +I+
Sbjct: 309 -ELLKEPALGEEIFSHDATRSIAIEFYSQVEQDALFEK-LPFLDDKDNKRYILEAVDIIS 366

Query: 420 AKEPFKHFPKNYAILTFLNISMAVEVLDYVRNNETARSKFQKCFFVSVSSCPQTSSDGGI 479
           A++    FP NY ILTF+NI MA+EVLDY++ N    S   +CFFVS+  C         
Sbjct: 367 AEDAADDFPANYVILTFINIKMAIEVLDYLKANLMTYS-VNECFFVSLPGCKSQR----- 420

Query: 480 VTTSNSITPVASGGSAGIATNGDLGGYTSKNASLSSLNSVGSYISLDQEIDFLSSSLKG- 538
               +S TPV       I+T G      SK+ S  +L + G+ + +D+E++ LS  L   
Sbjct: 421 ---ESSTTPVL----GHISTEG------SKSVSEVNLANGGNTVMIDRELESLSDELASL 467

Query: 539 ---SHTITVAVDEYPKPFFAEFSDHLSNASVLEASALDTQISSPHPQEVIVPSQ--DSPL 593
                 + +   +YPKP      DH+  ++       D  ++      + +     D   
Sbjct: 468 KLEEKCLKIIRSDYPKPEIRSHDDHIPGSTNFSMYIFDDGMNPEGNSGMYLHDNLTDHSS 527

Query: 594 VGGAPPLDAVHPAATPA-LSSQVLPL----QPHMAMNSGIYMEPFGRRNKTMIKPITQSL 648
           + G+P  + + P+ +   L +  LP+     P       I   PF   NK     ITQS+
Sbjct: 528 IIGSPFSNYIDPSISHVMLPNNGLPVGGFDAPGKFPIEPISGPPFNHTNKV----ITQSI 583

Query: 649 QKQFATSAEVANSMGGGIGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFV 708
           + +  TSA +A +MGG   NRTVYIGNI+PRSK EDICNVVRGGILQ+++F++DK ICFV
Sbjct: 584 EDRLNTSARIAAAMGGDADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFV 643

Query: 709 TFIEASTAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPD 768
           TFIEAS A QF  N+FIDPIVLHGN L+VGWG+ SGPLPKS++LAVTVGA+RNVYVSLP+
Sbjct: 644 TFIEASAAAQFCANSFIDPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPE 703

Query: 769 FAFKDKYINDPQYQRYSDEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSA 828
           +AFKDK+INDP+Y+ Y + YKLP++EQLR DF  +G+IEQIN+L D HCCWVNF+NI+SA
Sbjct: 704 YAFKDKFINDPKYKEYHERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASA 763

Query: 829 IKLVEEIKYNDGEAFHKSFDNRYRGLIIGYGKDRCGNVNKNLISGKNSRFYKKVKKPSYN 888
           I+LVE+I +N+GE FHK F+NRY GLII YGKDRCGN+NKNLI+GK S+FYKKVKKPSY+
Sbjct: 764 IRLVEDINHNNGEEFHKKFNNRYEGLIINYGKDRCGNINKNLIAGKGSKFYKKVKKPSYD 823

Query: 889 IRLSRMEEERKKHEETLRSQNQNNDEKMLQFGSLGIHLEGNDNNKT 934
           IR+ +MEE+RK  E+ L SQ +N+    +Q  SLGI ++   +N++
Sbjct: 824 IRIKKMEEKRKMQEDNLLSQKKNS----IQLDSLGISVDRTFSNES 865

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/38 (78%), Positives = 33/38 (86%)

Query: 1214 AKAIPGSDVMAQYLAQLQHSTFMYAANILGATAEGDVD 1251
             + IPGSDVMAQYLAQLQHSTFMYAANILGA+ E + D
Sbjct: 1009 TRPIPGSDVMAQYLAQLQHSTFMYAANILGASVETEED 1046

>KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {ON}
           Anc_8.844 YML117W
          Length = 1042

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/770 (45%), Positives = 495/770 (64%), Gaps = 99/770 (12%)

Query: 205 EQADKMFKEPFVVTYRMLPKGDDEYRTRSLLFENVNGSVDLYSFVSKYSRYGPVESIYMF 264
           E  +K+F EP  ++Y +LPKGDD YRTRSLLFENV+ +++L+SF++ + +   +ESIY+ 
Sbjct: 171 EILEKLFTEPINISYVILPKGDDAYRTRSLLFENVDNAINLHSFITNFVKNNSIESIYLV 230

Query: 265 KDRNDKTKHSVLLSFLSRKICLDSYNSVLQRLAEFKTGLKSKSLTVSFVSLKYRKHVDEN 324
            ++ND     ++LSFLSR ICLD YN+VLQRL EFK  L S+SL ++FVSLKY K   +N
Sbjct: 231 PNKNDSNTCDIILSFLSRHICLDFYNNVLQRLKEFKKHLNSESLNLNFVSLKYNKTTRDN 290

Query: 325 EVDQNDNSSSTPMNETDDTDASKTPVATSNVQDDAYNVTVVASLQYDIVNRGATRSVALE 384
           +                                         SL+++IV R ATRS+A+E
Sbjct: 291 QG---------------------------------------PSLEFNIVTRDATRSLAIE 311

Query: 385 LDGEYDKTKLLDQELDF-------LSPANNQRYVLESIYLINAKEPFKHFPKNYAILTFL 437
           L    + + +L++E  F       L    N+RYVLESI L++  +  K F KNYAIL+FL
Sbjct: 312 LCSNENDSLILEKEQLFEKILNEILRTDENKRYVLESIDLVSTDKSNKEFGKNYAILSFL 371

Query: 438 NISMAVEVLDYVRNNETARSKFQKCFFVSVSSCPQ---TSSDGGIVTTSNSITPVASGGS 494
           NI+MA+E++DY++   +++    KC FV++    +    ++   + + +N  + V+S G+
Sbjct: 372 NITMAIEIMDYIQV-ISSKLNIGKCSFVTIQPLIENNVMNNSSALSSATNIQSSVSSEGN 430

Query: 495 AGIATNGDLGGYTSKNASLSSLNSVGSYISLDQEIDFLSSSLKGSHTITVAVD----EYP 550
                NG    +  KN+  S L+S  S +S+D+E+  ++  LKG     +++D    +YP
Sbjct: 431 NNQNNNG--STFFHKNSINSLLSSESS-VSIDEEVISIADKLKGIKLKDISLDILPRDYP 487

Query: 551 KPFFAEFSDHLSNASVLEASALDTQISSPHPQEVIVPSQDSPLVGGAPPLDAVHPAATP- 609
           +P F   +DHL N ++   + LD    +P  QE+ +    SP   G   +D ++ ++T  
Sbjct: 488 EPEFNFSTDHLPNVTISVPTQLDQIPGTPRTQEIYINDM-SPSFEG---IDMMNSSSTML 543

Query: 610 -------ALSSQVLPLQP-HMAMNSGIYMEPFGRRNKTMIKPITQSLQKQFATSAEVANS 661
                  + +  ++P Q  +M  N+ I   PF  R+ + I PIT SL+ Q +TSA+VA++
Sbjct: 544 SGNGTFISNTPMLIPSQSFYMDQNTQIQEAPF--RSNSFIHPITDSLENQLSTSAKVASA 601

Query: 662 MGGGIGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYT 721
           MG   GNRT+YIGNI+PRSK EDICNVVRGGILQSI+F++ KHICFVTFIEA+ AVQFY 
Sbjct: 602 MGSDAGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEAAAAVQFYA 661

Query: 722 NAFIDPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQY 781
           NAFIDPIVLHGN LK+GWG++SGPLPKS++LAVT+GASRNVYVSLP+FAFKDKYINDP++
Sbjct: 662 NAFIDPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEF 721

Query: 782 QRYSDEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGE 841
           + Y +++KLP  EQLR DF+ +G  EQIN+LSD HCCWVNFMNISSAIKLVEE   ND +
Sbjct: 722 KEYHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEAT-NDFD 780

Query: 842 AFHKSFDNRYRGLIIGYGKDRCGNVNKNLISGKNSRFYKKVKKPSYNIRLSRMEEERKKH 901
            F++ FD RY GL+I YGKDRCGN+NKNLI+GKNSRFYK   + ++N +LS++EE+R+ H
Sbjct: 781 RFNEKFDERYNGLVINYGKDRCGNINKNLIAGKNSRFYK--IRQNHNFKLSKLEEKRRDH 838

Query: 902 E------------------ETLRSQNQNNDE------KMLQFGSLGIHLE 927
           +                  E++ + NQ+N+E      K LQ  SLGI LE
Sbjct: 839 DRRENGFKHVYNDEETIYNESMETDNQHNEESKENDGKFLQLDSLGISLE 888

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/40 (77%), Positives = 36/40 (90%), Gaps = 2/40 (5%)

Query: 1216 AIPGSDVMAQYLAQLQHSTFMYAANILGATAEGDVDYYED 1255
             IPGSDVMAQYLAQLQHSTFMYAANILGA+  G+ +YY++
Sbjct: 996  TIPGSDVMAQYLAQLQHSTFMYAANILGAS--GEEEYYDE 1033

>Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W
           (REAL)
          Length = 1131

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/770 (44%), Positives = 477/770 (61%), Gaps = 89/770 (11%)

Query: 207 ADKMFKEPFVVTYRMLPKGDDEYRTRSLLFENVNGSVDLYSFVSKYSRYGPVESIYMF-K 265
           ++ + + PF + Y++LP GDD YRTRSLL ENV+ S DL+S V  + +   +ES Y+   
Sbjct: 188 SELLLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSIVKNFVKSNTLESTYIIGN 247

Query: 266 DRNDKTKH------SVLLSFLSRKICLDSYNSVLQRLAEFKTGLKSKSLTVSFVSLKYRK 319
           +++D  K       S+L+SFL+R  CL+ YN++LQRL+EFKT LKS+SL + FV L Y  
Sbjct: 248 EKSDDLKDEQTSNLSILISFLTRSDCLNFYNNILQRLSEFKTFLKSESLNLKFVCLNYDF 307

Query: 320 HVDENEVDQNDNSSSTPMNETDDTDASKTPVATSNVQDDAYNVTVVASLQYDIVNRGATR 379
                 ++  D++ +  + + D T+ S                 + ASL +D+ N+ ATR
Sbjct: 308 KCLSTFIE--DDALTENVEQIDITNDSSM---------------ISASLHHDLENKDATR 350

Query: 380 SVALELDGEYDKTKLLDQELDFLSPANNQRYVLESIYLINAKEPFKHFPKNYAILTFLNI 439
           S+ +E       T+L +++L FL  +NN+RY+LESI ++N   P   FP+NYA+LTFLNI
Sbjct: 351 SIIVEFKSPLKSTELFNKKLQFLDRSNNKRYILESIDIVNTDVPSNQFPENYAVLTFLNI 410

Query: 440 SMAVEVLDYVRNNETARSKFQKCFFVSVSSCPQTSSDGGI-----VTTSNSITPVAS--- 491
            MA+EVLDY++   + +    KCF+VS++    +S+   +     + TS     V S   
Sbjct: 411 FMAIEVLDYLKK-YSKKLGISKCFYVSLAPLVISSTRSSVANIYEIKTSTHRLSVPSVPV 469

Query: 492 -------GGSAGIATNGDLGGYTSKNASLSSL--------NSVGSYISLDQEIDFLSSSL 536
                    +   +   D   + S N++ +SL         S+ S +SL++EID L++ L
Sbjct: 470 ENNNDNNNSNNHKSNISDANTHNSNNSTRASLYGNSNVSLASLPSSVSLNEEIDILTTKL 529

Query: 537 KGSHT----ITVAVDEYPKPFFAEFSDHLSNASVLEASALDTQ----ISSPHPQEVIVPS 588
           +G       + +   +Y  P   E S HLSN  + +      Q    I SP P    +  
Sbjct: 530 QGIQLDGTDLEINYHDYQTPTVHEHSTHLSNVKISKTVENSRQFPHDIPSPLPLNERMFM 589

Query: 589 QDSPLVGGAPPLDAVHPAATPALSSQVLPLQPHMAMNSGIYMEPFGRRNKTMIKPITQSL 648
            DS    G+  +      ATP+      P+   + MN            + +  PITQSL
Sbjct: 590 NDSNHSNGS--IVPQQLMATPS------PVSSTIQMNQ-----------RVLPNPITQSL 630

Query: 649 QKQFATSAEVANSMGGGIGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFV 708
           ++ F  SA+VA+SMG  +GNRT+YIGNI+PRS+ EDICNVVRGGILQSI+++ +K ICFV
Sbjct: 631 EQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFV 690

Query: 709 TFIEASTAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPD 768
           TFIEA +AVQFY N+FIDPIVLHGNML+VGWGH+SGPLPKS+SLAVT+GASRNVYVSLP+
Sbjct: 691 TFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPE 750

Query: 769 FAFKDKYINDPQYQRYSDEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSA 828
           FAFK+K+I+DPQY++  +   LP  EQLR DF+ +GDIEQIN+LSD HCCW+NFMNISSA
Sbjct: 751 FAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSA 810

Query: 829 IKLVEEIKY------NDGEAFHKS-----FDNRYRGLIIGYGKDRCGNVNKNLISGKNSR 877
           I LVEE+         DGE  HK+     F  RY GL+I YGKDRCGN+NKNL++GKNSR
Sbjct: 811 ISLVEEMNKESTAHNEDGEMTHKTATEKKFGGRYEGLLINYGKDRCGNINKNLVAGKNSR 870

Query: 878 FYKKVKKPSYNIRLSRMEEERKKHEETLRSQNQNNDEKMLQFGSLGIHLE 927
           FYKKVK+PSYNIRLS++EE R+++E     + +   +K L   SLGI L+
Sbjct: 871 FYKKVKRPSYNIRLSKLEERRRQNEN---DKKERAFDKALNLESLGISLD 917

 Score = 67.0 bits (162), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 29/33 (87%), Positives = 32/33 (96%)

Query: 1215 KAIPGSDVMAQYLAQLQHSTFMYAANILGATAE 1247
            + IPGSDVMAQYLAQ+QHSTFMYAANILGA+AE
Sbjct: 1092 RTIPGSDVMAQYLAQVQHSTFMYAANILGASAE 1124

>NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844
          Length = 1198

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/952 (38%), Positives = 528/952 (55%), Gaps = 143/952 (15%)

Query: 78  PLMNPPPTPFDTAYGITLLPSHLLIGSPFVSSPDLFXXXXXXXXXXXXXXXXXXIGMVNS 137
           PL N PPTPFDTAYG TLLPSHLL+GSP+VS+P+                     G+V S
Sbjct: 78  PLPNAPPTPFDTAYGATLLPSHLLMGSPYVSTPN---------------------GIVPS 116

Query: 138 NASHQSLNQRHRRSANQRNKGSYNNNSDTNISTNGHSRLSEASYXXXXXXXXXXXXARNR 197
           +     +    +  A   N+ S+         +  +S L++ S              +N 
Sbjct: 117 SQQQSQMFLYSQSPAGTPNRKSF---------SQLNSMLNQPSSRSNFFTDSYNNRYQNN 167

Query: 198 HRRRAQNEQADKMFKEPFVVTYRMLPKGDDEYRTRSLLFENVNGSVDLYSFVSKYSRYGP 257
            + R      +++F++PFV++Y++LP GDD YRTRSLLF NV  S+DL+SF+  + +Y  
Sbjct: 168 PQTRIPEVDPNELFQKPFVISYKLLPTGDDAYRTRSLLFSNVASSIDLHSFIYDFVQYSS 227

Query: 258 VESIYMF------KDR---NDKTKHSVLLSFLSRKICLDSYNSVLQRLAEFKTGLKSKSL 308
           +ESIY+       KD+   NDK K S+LLSFLSR+ICL  YN+VLQRL EFKT L+SKSL
Sbjct: 228 IESIYLISNTDDEKDQDNENDKNKRSILLSFLSREICLSFYNNVLQRLNEFKTNLQSKSL 287

Query: 309 TVSFVSLKYRKHVDENEVDQNDNSSSTPMNETDDTDASKTPVATSNVQDDAYNVTVVASL 368
           T++FV L Y +  D+       N S+  +N+  + +        +N  D   ++  V +L
Sbjct: 288 TLNFVILNYLEKTDDGSTA---NISNNQLNQIQENEND----VNTNEFDYRNSMNTVNAL 340

Query: 369 QYDIVNRGATRSVALELDGEYDKTKLLDQELDFL-SPANNQRYVLESIYLINAKE----- 422
           ++D++N  ATR + +EL  + DK  LL++ L FL     N RY+LESI L N  E     
Sbjct: 341 KFDLINPDATRFIMIELKTKCDKETLLNKHLSFLIDNKKNIRYILESIDLFNIIENENSS 400

Query: 423 --------------------------------PFKHFPKNYAILTFLNISMAVEVLDYVR 450
                                             + FP +YA+L+F+NI MA+E+ DY++
Sbjct: 401 ENKSIIEAKNENENSPQGKEKDTMVQKRKRNRSKRTFPNHYAVLSFINIYMAMELRDYLK 460

Query: 451 NNETARSKFQKCFFVSVSSCPQTSSDGGIVTTSNSITPVASGGSAGIATNGDLGGYTSKN 510
            N   +       +V +    ++ +     ++  S T   +   + + TN  + G   K+
Sbjct: 461 LN-GLKHGITNASYVQIKHVKKSLNSSSKRSSVTSTT--DNKDKSEVDTNESVEGKDKKS 517

Query: 511 ASLSSLNSVGSYISLDQEIDFLS--------------SSLKGSHTITVA-VDEYPKPFFA 555
               S N+  S I++                        LK   TI V  +  Y  P F 
Sbjct: 518 EEAKSFNNKLSSITMSSPDTTYEGEDDIDIDIIISKLQKLKLKETIQVLDIATYNTPLFQ 577

Query: 556 EFSDHLSNASVLEASALDTQISSPHPQEVIVPSQDS-----PLVGGAPPLDAVHPAATPA 610
               H++N ++   +  + Q+  P P  ++ P Q+      P++    P     P     
Sbjct: 578 SHDSHMANITLSIVNPFEAQLMRPPPSNIVSPDQNHENLSYPILPPTLPSIEKFPTRDQT 637

Query: 611 LSSQV-------------------------------LPLQPHMAMNSGIYM--EPFGRRN 637
           L+ +                                +  Q     N GI+   +P    +
Sbjct: 638 LNQETSGRRSLSSSSTSLSNYQGRSNSNNYNTEAKEVKEQNKGERNEGIFFVEQPTFNTD 697

Query: 638 KTMIKPITQSLQKQFATSAEVANSMGGGIGNRTVYIGNIHPRSKPEDICNVVRGGILQSI 697
            TM  PI ++L+ +F TSA+VA+SMG  +GNRT+YIGN++PRSK ED+CNVVRGGILQSI
Sbjct: 698 PTMY-PIVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVVRGGILQSI 756

Query: 698 RFLQDKHICFVTFIEASTAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVG 757
           + +  K ICFVTFIEAS AVQFY N+FIDP++LHGN LK+GWG++  PL KS++LAVT+G
Sbjct: 757 KLIASKRICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVTIG 816

Query: 758 ASRNVYVSLPDFAFKDKYINDPQYQRYSDEYKLPAEEQLRNDFNQFGDIEQINFLSDGHC 817
           ASRNVYVSLP+FAFKDK++NDP+Y+ + ++YKLP+E+QLR DFN++G IEQIN+LSD HC
Sbjct: 817 ASRNVYVSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHC 876

Query: 818 CWVNFMNISSAIKLVEEIKYNDGE-AFHKSFDNRYRGLIIGYGKDRCGNVNKNLISGKNS 876
           CWVNFMNI+SAIKLVE++  N  +  F K F++RY GLII YGKDRCGNVN+NLIS KNS
Sbjct: 877 CWVNFMNITSAIKLVEDVNNNPKDNTFSKKFNHRYDGLIINYGKDRCGNVNRNLISNKNS 936

Query: 877 RFYKKVKKPSYNIRLSRMEEERKKHEETLRSQNQN-NDEKMLQFGSLGIHLE 927
           R Y+KVKK S N +L +++E+R+  +E  +  N   ND K+    +LGI L+
Sbjct: 937 RHYRKVKKFSDNYKLRQLQEKRRVEQEKGKELNGGVNDNKLPSLDALGIGLQ 988

 Score = 68.6 bits (166), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/43 (69%), Positives = 36/43 (83%)

Query: 1215 KAIPGSDVMAQYLAQLQHSTFMYAANILGATAEGDVDYYEDNT 1257
            + IPG+DVMAQYL QLQHSTFMYAANILG +AE +  Y E++T
Sbjct: 1155 RVIPGADVMAQYLTQLQHSTFMYAANILGVSAEDNTYYDEEDT 1197

>Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W
           (REAL)
          Length = 1122

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/759 (44%), Positives = 476/759 (62%), Gaps = 80/759 (10%)

Query: 208 DKMFKEPFVVTYRMLPKGDDEYRTRSLLFENVNGSVDLYSFVSKYSRYGPVESIYMFKDR 267
           + + ++PF + Y++LP GDD YRTRSLL ENV+ S DL+S V  + +   +ES Y+   +
Sbjct: 192 ETLLQKPFRINYKILPAGDDAYRTRSLLIENVDDSADLHSLVKNFVKSNALESAYIVGSK 251

Query: 268 ------NDKTKH-SVLLSFLSRKICLDSYNSVLQRLAEFKTGLKSKSLTVSFVSLKYRKH 320
                  ++TK+ S+L+SFL+R  CL+ YN++LQRL+EFKT LKSKSL + FV L Y   
Sbjct: 252 ETDNLEKEETKNLSILISFLTRGDCLNFYNNILQRLSEFKTFLKSKSLNLKFVCLNY--- 308

Query: 321 VDENEVDQNDNSSSTPMNETDDTDASKTPVATSNVQDDAYNVTVVASLQYDIVNRGATRS 380
                   +  S  TP+ E ++   S+   AT    DDA +  + ASL +D+ N+ ATRS
Sbjct: 309 --------DSKSLPTPV-EDEELSRSEEQAAT----DDA-STMISASLHHDVENKDATRS 354

Query: 381 VALELDGEYDKTKLLDQELDFLSPANNQRYVLESIYLINAKEPFKHFPKNYAILTFLNIS 440
           + +E     +K +L  ++L FL  + N+RY+LESI +++   P   FP+NY +LTFLNI 
Sbjct: 355 IIIEFKSPLEKAELFKEKLQFLDRSKNKRYILESIDIVDTDVPSNQFPENYVVLTFLNIF 414

Query: 441 MAVEVLDYVRNNETARSKFQKCFFVSVSSCPQTSSDGGIVTTSNSITPVASGGSAGIATN 500
           MA+EVLDY++   + +    KCF+VS++    +S+   + +   S +      +  +   
Sbjct: 415 MAIEVLDYLKK-YSKKLGISKCFYVSLTPLMVSSARSSVASIYESKSSSHRLSTPSVPAG 473

Query: 501 GDLGGYTSKNASLSSLNSVGSY-------------ISLDQEIDFLSSSLKG----SHTIT 543
            +       N + +       Y             +SL++EI+ L++ L+G       + 
Sbjct: 474 NNNDINNINNNNNNGSIGSSIYGNSNISLTSLSSSVSLNEEIEVLTTKLQGIDLDGTILE 533

Query: 544 VAVDEYPKPFFAEFSDHLSNASV---LEASALDTQ-ISSPHPQEVIVPSQDSPLVGGAPP 599
           V   +YP P   E S HLSN  +   ++ S   TQ I SP P    +   DS    G   
Sbjct: 534 VTCHDYPTPVINEHSAHLSNIKISKTVDNSRQFTQDIPSPLPLNEHMFMTDSNQSNGT-- 591

Query: 600 LDAVHPAATPALSSQVLPLQPHMAMNSGIYMEPFGRRNKTMIKPITQSLQKQFATSAEVA 659
                   +  L +   P  P+  MN            + +  PITQSL++ F  SA+VA
Sbjct: 592 ------IVSQQLITAPSPQSPNPQMNQ-----------RVLPNPITQSLEQNFNVSAKVA 634

Query: 660 NSMGGGIGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQF 719
           +SMG  IGNRT+YIGNI+PRS+ EDICNVVRGGILQ+I+++ +K ICFVTFIEA++AVQF
Sbjct: 635 SSMGSDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQF 694

Query: 720 YTNAFIDPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDP 779
           Y N+FIDPIVLHGNML+VGWGH+SGPLPKS+SLAVT+GASRNVYVSLP+FAFK+K+I+DP
Sbjct: 695 YANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDP 754

Query: 780 QYQRYSDEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKY-- 837
           QY++  +   LP  EQLR DF+ +GDIEQIN+LSD HCCW+NFMNISSAI LVEE+    
Sbjct: 755 QYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEP 814

Query: 838 ----NDGEAFHKS-----FDNRYRGLIIGYGKDRCGNVNKNLISGKNSRFYKKVKKPSYN 888
               + GE   K+     FD RY+GL+I YGKDRCGN+NKNL++GKNSRFYKKVK+PSYN
Sbjct: 815 TGHDDSGELIPKTATEEKFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYN 874

Query: 889 IRLSRMEEERKKHEETLRSQNQNNDEKMLQFGSLGIHLE 927
           IRLS++EE R+++E    +  + + +K+L   SLGI L+
Sbjct: 875 IRLSKLEERRRQNE----NDKKESFDKVLNLESLGISLD 909

 Score = 66.2 bits (160), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 29/33 (87%), Positives = 32/33 (96%)

Query: 1215 KAIPGSDVMAQYLAQLQHSTFMYAANILGATAE 1247
            + IPGSDVMAQYLAQ+QHSTFMYAANILGA+AE
Sbjct: 1083 RTIPGSDVMAQYLAQVQHSTFMYAANILGASAE 1115

>TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON}
           Anc_8.844 YML117W
          Length = 1039

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/725 (44%), Positives = 451/725 (62%), Gaps = 65/725 (8%)

Query: 215 FVVTYRMLPKGDDEYRTRSLLFENVNGSVDLYSFVSKYSRYGPVESIYMFK--DRNDKTK 272
           + ++Y++LPKGDD Y TRSLLFEN+N S+DL++F+ K+  YG +ES+Y+    + +  + 
Sbjct: 210 YKISYQILPKGDDTYHTRSLLFENINESIDLHTFIEKFVNYGLIESVYVVPSYETHQNSV 269

Query: 273 HSVLLSFLSRKICLDSYNSVLQRLAEFKTGLKSKSLTVSFVSLKYRKHVDENEVDQNDN- 331
            S+LLSF SR ICLD YNSVLQ+L+E+KT L S++L +SFVSL Y     +N +++ +  
Sbjct: 270 KSILLSFTSRSICLDFYNSVLQKLSEYKTQLNSENLKLSFVSLCYL----QNNINKGNGK 325

Query: 332 -SSSTPMNETDDTDASKTPVATSNVQDDAYNVTVVASLQYDIVNRGATRSVALELDGEYD 390
            S  +  NETD                      + + +QY + N GATRS+ +E D   D
Sbjct: 326 ISVESQKNETD--------------------FELTSLIQYQVANFGATRSLCIEFDKRVD 365

Query: 391 KTK-LLDQELDFLSPANNQRYVLESIYLINAKEPFKHFPKNYAILTFLNISMAVEVLDYV 449
           K    ++  L FLS   N+RY++ES+Y++N       FP +Y IL+FLNISM +EVL Y+
Sbjct: 366 KIDDFIETYLPFLSSNANKRYIIESLYIVNNNGKDNEFPAHYVILSFLNISMVIEVLHYI 425

Query: 450 RNNETARSKFQKCFFVSVSSCPQTSSDGGIVTTSNSITPVASGGSAGIATNGDLGGYTSK 509
           R+   +++  + C +VS             V+ SN  + ++  G++       L    + 
Sbjct: 426 RSKNLSKT-IKNCLYVSFDRTKHA------VSNSNRQS-LSKKGTSDTLNTYTLESPINH 477

Query: 510 NASLSSLNSVGSYISLDQEIDF---LSSSLKGSHTITVAVDEYPKPFFAEFSDHLSNASV 566
           N  +  +N + S I  + EI+    LS     +HT  + +  Y  P     ++HL N S+
Sbjct: 478 NTEVD-MNDIPS-IYDENEIEIANKLSELEIQTHTFNLDISNYSNPHIEIRAEHLPNVSI 535

Query: 567 LEASALDTQISSPHPQEVIVPSQDSPLVGGAPPLDAVHPAATPALSSQVLPLQPHMAMNS 626
                      S  P     P   SP  G    +       TP LSS ++  +     N 
Sbjct: 536 -----------SRDPMIYANPIYQSPPSGYMENM----WTTTPFLSSHIVHEE---YAND 577

Query: 627 GIYMEPFGRRNKTMIKPITQSLQKQFATSAEVANSMGGGIGNRTVYIGNIHPRSKPEDIC 686
            +        N+    P+ Q+LQ QFATSAE+A+ MGGG+GNRT++IGNI+PRSK EDIC
Sbjct: 578 RVDYNMKHYNNQLYNVPLPQTLQSQFATSAEMASKMGGGVGNRTIFIGNINPRSKTEDIC 637

Query: 687 NVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPL 746
           NV RGGI+Q ++++++K+ICFV FI+   A QFY N+FIDPI+LH N LK+GWG H GPL
Sbjct: 638 NVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPL 697

Query: 747 PKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYSDEYKLPAEEQLRNDFNQFGDI 806
           PK++ LAVT GASRNVYVSLP+FAFKDKYINDP Y+ Y ++Y LP+E+QLR DF++FG++
Sbjct: 698 PKAIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEM 757

Query: 807 EQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKSFDNRYRGLIIGYGKDRCGNV 866
           EQINFL D HCCW+NF NI SAIKLVE +K  D   FH+ + NRY+GLIIGYGKDRCGNV
Sbjct: 758 EQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHERYKNRYKGLIIGYGKDRCGNV 817

Query: 867 NKNLISGKNSRFYKKVKKPSYNIRLSRMEEERKKHEETLRSQNQNNDEKMLQFGSLGIHL 926
           NK+L+S KNSR+++KVKKPSYNIRL ++EEERK+++E      +  D K +   SLGI  
Sbjct: 818 NKSLVSNKNSRYFRKVKKPSYNIRLQQLEEERKRNDEI-----KQIDNKRINLDSLGITT 872

Query: 927 EGNDN 931
             N N
Sbjct: 873 SPNQN 877

 Score = 62.8 bits (151), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 28/42 (66%), Positives = 37/42 (88%), Gaps = 1/42 (2%)

Query: 1215 KAIPGSDVMAQYLAQLQHSTFMYAANILGATAEGDVDYYEDN 1256
            K IPGSDVM+QYLAQ+QHSTFMYAAN+L A+ E + ++Y++N
Sbjct: 992  KIIPGSDVMSQYLAQVQHSTFMYAANVLNASIE-EPEFYDEN 1032

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%)

Query: 84  PTPFDTAYGITLLPSHLLIGSPFVSSPD 111
           PTPFD AYG TLLPSH+L+ SPFVS+P+
Sbjct: 109 PTPFDYAYGTTLLPSHILMNSPFVSTPN 136

>SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1082

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/845 (41%), Positives = 494/845 (58%), Gaps = 135/845 (15%)

Query: 76  GPPLMNPPPTPFDTAYGITLLPSHLLIGSPFVSSPDLFXXXXXXXXXXXXXXXXXXIGMV 135
           G P+ + P TPFDT+YG TLLPSHLL+GSPF+S+P                      G  
Sbjct: 60  GSPMPSAPQTPFDTSYGATLLPSHLLMGSPFISTPQ--------------NAAMMHAGSR 105

Query: 136 NSNASHQSLNQRHRRSANQRNKGS-YNNNSDTNISTNGHSRLSEASYXXXXXXXXXXXX- 193
             N+S Q     +  S N +NKGS   NN D     NGH  ++  SY             
Sbjct: 106 GLNSSQQQF-YHYTYSNNGKNKGSSKKNNRDKKKVENGHVMMTRYSYPPPPQLNAPPMTH 164

Query: 194 ARNRHRRRAQNEQADKMFKEPFVVTYRMLPKGDDEYRTRSLLFENVNGSVDLYSFVSKYS 253
            R  H R   N Q      EP+V+ +++LPKGDDEY TRSLL  NVN S+ L+ F++K+ 
Sbjct: 165 KRKTHLRHETNSQPSS---EPYVINFKILPKGDDEYMTRSLLLSNVNASIKLHDFITKFV 221

Query: 254 RYGPVESIYMF---------------------KDRNDKTKHSVLLSFLSRKICLDSYNSV 292
           ++GP+ES+Y+                      +++ ++ K S+LLSFL++  CLD YN+V
Sbjct: 222 KFGPIESVYVVPEEEEEEEEEEEEEEEEEEEEEEKGEEKKQSILLSFLTKNTCLDFYNNV 281

Query: 293 LQRLAEFKTGLKSKSLTVSFVSLKYRKHVDENEVDQNDNSSSTPMNETDDTDASKTPVAT 352
           LQ+L++FK  L SKSLT++FVSL                                    +
Sbjct: 282 LQKLSDFKIDLNSKSLTLNFVSL-----------------------------------TS 306

Query: 353 SNVQDDAYNVTVVASLQYDIVNRGATRSVALELDGEYDKTKLLDQELDFLSPANNQRYVL 412
            +++DD             ++ +GATRS+ALE    +   +L  + ++ LS A+N R+V+
Sbjct: 307 EDIRDD-------------VLRKGATRSIALEFKNSFTTKQL--ESIEILSNASNSRFVV 351

Query: 413 ESIYLINAKEPFKHFPKNYAILTFLNISMAVEVLDYVRNNETARSKFQKCFFVSVSSCPQ 472
           E I ++N + P K+F  +YAI+ F++ISMAVE   Y+ N +  +    + FFV+ S    
Sbjct: 352 EKIDIVNTESPNKNFNTHYAIIHFISISMAVEASSYLLNWD-EKLGISRLFFVTDS---- 406

Query: 473 TSSDGGIVTTSNSITPVASGGSAGIATNGDLGGYTSKNASLSSLNSVGSYISLDQEIDFL 532
                 I+  S+      +                S++AS SS       +S+DQ ++F 
Sbjct: 407 ------IINKSDYFRSAPA----------------SQDASRSS-------VSIDQTLEFA 437

Query: 533 SSSLKG----SHTITVAVDEYPKPFFAEFSDHLSNASVLEASALDTQISSPHPQEVIVPS 588
           +  L+G      T+++    YP+    E   HL++ S+ +        SS       V  
Sbjct: 438 TKKLQGLVLKERTLSIKPKTYPQAEIEEHQHHLTSISISKPLLSSNNNSS------SVSL 491

Query: 589 QDSPLVGGAPPLDAVHPAATPALSSQVLPLQPHMAMNSGIYMEPFGRRNKTMIKPITQSL 648
           Q +  +  +P    ++   T   + + + +Q  MA  +  ++ P       + KPI Q+L
Sbjct: 492 QGNQNLTSSPVTQEMYLHDTSNSTREDVMIQSSMASGTSNFVPPPPHYYMDVTKPIRQTL 551

Query: 649 QKQFATSAEVANSMGGGIGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFV 708
           Q+Q  T+A+VA++MGGG+GNRTVY+GNI+PRSKPEDICNVVRGGILQ I+F + KH+CFV
Sbjct: 552 QQQLTTTAQVASNMGGGLGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFV 611

Query: 709 TFIEASTAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPD 768
           TFIEA+ AVQF+ NA I+PIVLHGN+LKVGWGHH G L +S++LAVT+GASRNVYVSLP+
Sbjct: 612 TFIEAAAAVQFFANASIEPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPE 671

Query: 769 FAFKDKYINDPQYQRYSDEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSA 828
           +AFKDK+I DP++Q + ++Y+LP++EQLR DF+ FG+IEQIN+L DGHCCWVNFMNI+SA
Sbjct: 672 YAFKDKFIKDPEFQEFREKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSA 731

Query: 829 IKLVEEIKYNDGEAFHKSFDNRYRGLIIGYGKDRCGNVNKNLISGKNSRFYKKVKKPSYN 888
           IKLVE+    D + FH S+ +RY+GLIIGYGKDRCGNVNKNL++ K SRF+KKVKK SY 
Sbjct: 732 IKLVEDANGADNKKFHGSYQDRYKGLIIGYGKDRCGNVNKNLVANKKSRFFKKVKKASYK 791

Query: 889 IRLSR 893
           IR+ +
Sbjct: 792 IRMHK 796

 Score = 72.0 bits (175), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 62/183 (33%), Positives = 81/183 (44%), Gaps = 58/183 (31%)

Query: 1065 GDSNNQKKHEKNNKPFKSKKLENVSATGTGDVSNYNSSLGEGASAVSNPSISMNPPIAPS 1124
            G   N+ K EK+       KL+    +G  D+     SL    S VS+ S+   PP+APS
Sbjct: 936  GHPTNKFKKEKSRT-----KLKRRPTSGLTDLY----SLNGFPSMVSSTSLDAVPPLAPS 986

Query: 1125 TISRNYSLMMKTQNG--HPHPRRDSSDRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPN 1182
            T+SR+YS+     N   H + R D+S +                                
Sbjct: 987  TVSRHYSVASSHSNNSYHNNGRHDASKK-------------------------------- 1014

Query: 1183 PSSSHNSGDRMSSHVGNSXXXXXXXXXXXXXAKAIPGSDVMAQYLAQLQHSTFMYAANIL 1242
                 + G + ++H G               +KAIPGS VMAQYLAQLQHSTFMYAANIL
Sbjct: 1015 ----RHGGGKGNTHHGR-----------HRKSKAIPGSQVMAQYLAQLQHSTFMYAANIL 1059

Query: 1243 GAT 1245
            G T
Sbjct: 1060 GVT 1062

>TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {ON}
            Anc_8.844 YML117W
          Length = 1362

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/844 (42%), Positives = 483/844 (57%), Gaps = 125/844 (14%)

Query: 208  DKMFKEPFVVTYRMLPKGDDEYRTRSLLFENVNGSVDLYSFVSKYSRYGPVESIYMFKDR 267
            +K+ + P VV+Y++LPKG DE+RTRSLL EN+N S+D  + V  +  +GP+ES+Y+ K  
Sbjct: 254  NKLLEIPLVVSYKILPKGTDEFRTRSLLLENINQSIDTRTLVKNFINFGPIESVYLIKLN 313

Query: 268  NDKTKHSVLLSFLSRKICLDSYNSVLQRLAEFKTGLKSKSLTVSFVSLKYR-----KHVD 322
                 +S+LLSF+SR+ICLD YN+VLQRL EFKT L SKSLT+SFV LKY        ++
Sbjct: 314  PGSKYNSILLSFVSREICLDFYNNVLQRLMEFKTELSSKSLTLSFVILKYEFTDYNHPIN 373

Query: 323  ENEVDQNDNSSSTPMNETDDT---------DASKTPVATSNVQDDA----YNVTVVASLQ 369
            E+  D  D SSS+  N   DT         +     +   ++++D     + +T  ++LQ
Sbjct: 374  EHASDNGDESSSSNKNLKIDTIKEEEEDEEETDGEEIVIEDIRNDLNKENFPLTFASALQ 433

Query: 370  YDIVNRGATRSVALELDGEYDKTKLLDQELDFLSPANNQ-RYVLESIYLINAKE------ 422
             D+V RGATRS+ L+ +G   K +L++++L+     N   RY+LESI L+N +       
Sbjct: 434  SDLVKRGATRSLLLKFNGVVSKDQLINEKLNLFINNNLNNRYILESISLVNIENNTKNNK 493

Query: 423  --------------PFKHFPKNYAILTFLNISMAVEVLDYVRNNETARSKFQKCFFVS-- 466
                          P   F  NY +LTF NI MA+E  DY +      + F  CFFVS  
Sbjct: 494  NTIGDDNEDQIEDTPISKFGNNYCLLTFSNILMAIEAFDYFKAKLNELNIFD-CFFVSKT 552

Query: 467  ------------VSSCPQTSSDGGIVTTSNSI-------TPVASGGSAGIATNGDLGG-- 505
                        +S    +S    IV   N I        P+ S  S    +N  +    
Sbjct: 553  NYHKNSENSKSTISHSTPSSKISSIVNLPNEINNNNKSNVPITSLNSDNDKSNVSISNDN 612

Query: 506  ----------------------YTSKNASLSSLNSVGSYISLDQEIDFLSSSLKG----S 539
                                   T +N S  + N     +S+DQEI+ L+  LK      
Sbjct: 613  ISNDNTSNDNNNSNDNPINNNDITIRNKSRKNSNVTVHELSMDQEIEILNEKLKNIDLKD 672

Query: 540  HTITVAVDEYPKPFFAEFSDHLSNASVLEASALDTQISSPHPQEVI-------------- 585
            + + ++   Y +P   EF   L N S+   S  +  + +  P E                
Sbjct: 673  NELIISAKIYNQPIVEEFDQDLENISITNLSNSNYLLLNQQPFEFNMNMNMTMNMNMNMN 732

Query: 586  -------------VPSQDSPLVGGAPPLDAVHPAATPALSSQVLPLQPHMAMNSGIYMEP 632
                         +P Q  P+   A   D + P   P  S Q  P     A       + 
Sbjct: 733  MNVNMNMNMNMNMLPPQSMPMPMFAGNFDMIDPM-DPQRSRQ--PSVLFTATQQPQQPQQ 789

Query: 633  FGRRNKTMIKPITQSLQKQFATSAEVANSMGGGIGNRTVYIGNIHPRSKPEDICNVVRGG 692
               + +     +TQ+L+  F TS E++  +GGG GNRTVYIGNI+PRSKPED+CNVVRGG
Sbjct: 790  QQPQQQGTHNNLTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGG 849

Query: 693  ILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSVSL 752
            ILQ I FL+DKHICFVTFIEA+ A QF+ NA+IDPIVLHGN+LKVGWG+HSGPLPKS+SL
Sbjct: 850  ILQKIVFLRDKHICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISL 909

Query: 753  AVTVGASRNVYVSLPDFAFKDKYINDPQYQRYSDEYKLPAEEQLRNDFNQFGDIEQINFL 812
            AVT+GA+RNVYVSLP+FAFKDK+IN+P Y++Y + YKLP E QLR DF+Q+G+IEQIN+L
Sbjct: 910  AVTIGANRNVYVSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYL 969

Query: 813  SDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKSFDNRYRGLIIGYGKDRCGNVNKNLIS 872
            +DGHCCW+NFMNI+SAI LVEE+  +DG  FH  FD RY GLIIGYGKDRCGNVNKNL++
Sbjct: 970  NDGHCCWINFMNINSAITLVEEVNEDDGIRFHNKFDGRYNGLIIGYGKDRCGNVNKNLVA 1029

Query: 873  GKNSRFYKKVKKPSYNIRLSRMEEERKKHEE-TLRSQNQ--NNDE---KMLQFGSLGIHL 926
             KNS+F+KKVKKP+Y I+L ++EEER+  EE  LR+ N+  NN +     +   SLGI  
Sbjct: 1030 TKNSKFFKKVKKPAYQIKLKKIEEERRLQEENNLRNNNKLSNNSQIRKPAVNLESLGITF 1089

Query: 927  EGND 930
            E ++
Sbjct: 1090 ESSE 1093

 Score = 66.6 bits (161), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 35/44 (79%)

Query: 1215 KAIPGSDVMAQYLAQLQHSTFMYAANILGATAEGDVDYYEDNTE 1258
            K IPGSDVM+QYL QLQHSTFMYAANILG +AE +   Y D+ E
Sbjct: 1316 KTIPGSDVMSQYLTQLQHSTFMYAANILGVSAEDNNITYGDDGE 1359

 Score = 59.3 bits (142), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 24/35 (68%), Positives = 31/35 (88%)

Query: 78  PLMNPPPTPFDTAYGITLLPSHLLIGSPFVSSPDL 112
           P+ + PPTPFD +YG TLLPSHLL+GSPFVS+P++
Sbjct: 100 PIPSAPPTPFDPSYGATLLPSHLLMGSPFVSTPNI 134

>NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844
          Length = 1081

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/781 (41%), Positives = 479/781 (61%), Gaps = 92/781 (11%)

Query: 195 RNRHRRRAQNEQADKMFKEPFVVTYRMLPKGDDEYRTRSLLFENVNGSVDLYSFVSKYSR 254
           R+ +R +        +F +PF ++Y++LP GDD YRTRSLLFENV  S++L++F++++ R
Sbjct: 157 RSSYRSKVPETDPKTLFLQPFRMSYKILPSGDDAYRTRSLLFENVVNSIELHTFMTEFVR 216

Query: 255 YGPVESIYMF------KDRNDKTKHSVLLSFLSRKICLDSYNSVLQRLAEFKTGLKSKSL 308
           + P+ES+Y+       K  +D    S+LLSFL+R++CL  YN+VLQRL EFK  LKS++L
Sbjct: 217 FSPIESVYLINHHDSDKPDDDTECRSILLSFLTREVCLTFYNNVLQRLKEFKAKLKSENL 276

Query: 309 TVSFVSLKYRKHVDENEVDQNDNSSSTPMNETDDTDASKTPVATSNVQDDAYNVTVVASL 368
            +SFVS+KY+   DENE ++                        +N+ D+    T   S+
Sbjct: 277 RLSFVSIKYQ---DENEEEE------------------------TNIVDEPSFYTK-ESV 308

Query: 369 QYDIVNRGATRSVALELDGEYDKTKLLDQELDFLSPANNQRYVLESIYLINAKEPFKHFP 428
            +++ N  ATRS+ ++      + +L D++L FL+  NN RY+LESI L+N  +    FP
Sbjct: 309 YFELSNPQATRSILIQFKNPCSEQELFDKKLKFLNQENNSRYILESIDLVNVTQTENEFP 368

Query: 429 KNYAILTFLNISMAVEVLDYVRNNETARSKFQKCFFVSVSSCPQTSSDGGIVTTSNSITP 488
           K+YAILTF+NI MA+E+ DY++ +   R   Q C FV V                 +++ 
Sbjct: 369 KHYAILTFINILMAMEICDYLKIH-GPRYGIQDCMFVQV--------------IPKAVSC 413

Query: 489 VASGGSAGIATNGDLGGYTS----------KNASLSSLNSV-GSYISLDQEIDFLSSSLK 537
           V+S  ++ I+ + D    T           KN+S+ SL S     +S ++++D LS  LK
Sbjct: 414 VSSKRASIISKDNDNNDETLSSQQKKNDILKNSSIISLPSAENDQVSDEEKLDKLSEKLK 473

Query: 538 GSHT----ITVAVDEYPKPFFAEFSDHLSNASVLEASALDTQISSPHPQEVIVP-----S 588
            ++     + V    YP+P F    +HL NA++  +S+     S+P  Q++         
Sbjct: 474 STNIEELILIVDTATYPRPSFLSHDEHLPNATLSLSSS-----SNPFEQQLPYSYEEDDD 528

Query: 589 QDSPLVGGAPPLDAVHPAATPALSSQVLPLQPHMAMNSGIYMEPFG-------------- 634
           Q + +  G+ P +   P   P L    +   P+M  N+ + M P G              
Sbjct: 529 QRTNVRSGSLPANPQFPNM-PNLPKGYISPNPNMNYNTPL-MYPNGYFVNDPAFSMNNNY 586

Query: 635 RRNKTMIKPITQSLQKQFATSAEVANSMGGGIGNRTVYIGNIHPRSKPEDICNVVRGGIL 694
             N     PI+++L++   T+++V NS+G   GNRT+YIGNI+ RSK EDICNVVRGGIL
Sbjct: 587 NNNTNYRNPISKTLEQHATTTSQVVNSLGADAGNRTIYIGNINSRSKVEDICNVVRGGIL 646

Query: 695 QSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSVSLAV 754
           Q++++++ KHICF+TFIEAS A+ FY N+FIDPIVLH + LK+GWG++  PLPK+V+LAV
Sbjct: 647 QNVKYIEHKHICFITFIEASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLPKAVALAV 706

Query: 755 TVGASRNVYVSLPDFAFKDKYINDPQYQRYSDEYKLPAEEQLRNDFNQFGDIEQINFLSD 814
           TVGASRNVYVSLP+FAFKDK+INDP+YQ Y  +YKLP  +QLR DF+++G IEQIN+L D
Sbjct: 707 TVGASRNVYVSLPEFAFKDKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQINYLKD 766

Query: 815 GHCCWVNFMNISSAIKLVEEIKYNDGEAFHKSFDNRYRGLIIGYGKDRCGNVNKNLISGK 874
            HCCWVNF+NIS+AI+LVE+        F + F+NRY GLII YGKDRCGNVNK+L+S K
Sbjct: 767 SHCCWVNFLNISAAIRLVEDAHNPVESKFSEKFNNRYDGLIINYGKDRCGNVNKSLMSNK 826

Query: 875 NSRFYKKVKKPSYNIRLSRMEEERKKHEETLRS--QNQNNDEKMLQFGSLGIHLEGNDNN 932
           NSRFYKKVK  S N++L  +EE+RK   E L S  +  ++D ++ +  + GI ++   NN
Sbjct: 827 NSRFYKKVKSISNNVKLKELEEKRKADTERLNSLRKTSSSDGQLSKLDAFGIGIDTVSNN 886

Query: 933 K 933
           +
Sbjct: 887 E 887

 Score = 72.0 bits (175), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 34/42 (80%), Positives = 38/42 (90%), Gaps = 1/42 (2%)

Query: 1214 AKAIPGSDVMAQYLAQLQHSTFMYAANILGATAEGDVDYYED 1255
            A+ IPGSDVMAQYLAQLQHSTFMYAANILGA+AE D  YY++
Sbjct: 1038 ARVIPGSDVMAQYLAQLQHSTFMYAANILGASAE-DGSYYDE 1078

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/33 (81%), Positives = 30/33 (90%)

Query: 78  PLMNPPPTPFDTAYGITLLPSHLLIGSPFVSSP 110
           PL N PPTPFDTAYG TLLPSHLL+GSPFV++P
Sbjct: 74  PLPNVPPTPFDTAYGATLLPSHLLMGSPFVATP 106

>KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {ON}
           Anc_8.844 YML117W
          Length = 1053

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/725 (44%), Positives = 446/725 (61%), Gaps = 68/725 (9%)

Query: 210 MFKEPFVVTYRMLPKGDDEYRTRSLLFENVNGSVDLYSFVSKYSRYGPVESIYMFKDRND 269
           +F+ PF ++Y++LPKGDD YRTRSLL  N++  VDL++FVSK+ +   VES+Y+ K+   
Sbjct: 155 LFQIPFEISYKILPKGDDLYRTRSLLLGNIDDMVDLHTFVSKFVQNNSVESVYITKEGQQ 214

Query: 270 KTKHSVLLSFLSRKICLDSYNSVLQRLAEFKTGLKSKSLTVSFVSLKYRKHVDENEVDQN 329
             K+  LLSFLS +ICL+ YN+VLQRL EFK  LK+ SL +SFVS++ R    E ++ + 
Sbjct: 215 PEKYGFLLSFLSVQICLNFYNNVLQRLKEFKEQLKASSLELSFVSMRQRPTKVEGKIYRR 274

Query: 330 DNSSSTPMNETDDTDASKTPVATSNVQDDAYNVTVVASLQYDIVNR-GATRSVALEL--- 385
                      DD D                    +A+L +D+  + GATRS+A+E    
Sbjct: 275 --------FAADDGDG-------------------MANLHFDMAAQTGATRSIAIEFVDK 307

Query: 386 DGEYDKTKLLDQELDFLSPANNQRYVLESIYLINAKEPFKHFPKNYAILTFLNISMAVEV 445
           D    + +LL+++L FLS  NN RY+LE I +   +   K F KNYAI+TFL+I MA+E+
Sbjct: 308 DVILTRDELLNKKLKFLSEGNN-RYILEHIAVFKTQHGTKVFGKNYAIITFLSIPMAMEI 366

Query: 446 LDYVRNNETARSKFQKCFFVSVSSCPQTSSDGGIV------TTSNSIT-PVASGGSAGIA 498
           +DY++ N   +    K F+V V+  PQ S            T SN  T P  S       
Sbjct: 367 MDYLKLN-IKQLHLTKFFYVQVTHPPQQSPAASQKKPHANDTESNRDTSPPNSKKDQEFF 425

Query: 499 TNGDLGGYTSKNASLSSLNSVGSYISLDQEIDFLSSSLKGSHTITVAVDEYPKPFFAEFS 558
            N  +    S  +S S  + V   ++  + I+   S+LK      + V++YP+P F +FS
Sbjct: 426 PNNSMLSLVSSESSTSLADDVDGLVNKLKSIELQESTLK------LRVEDYPEPLFEQFS 479

Query: 559 DHLSNASVLEASALDTQ-ISSPHPQEVIVPSQDSPL---VGGAP----PLDAVHPAATPA 610
           +H SN  V       T+ I  P    +  P         +G  P    PLD  H  + P 
Sbjct: 480 EH-SNGIVQSLPVPQTRPIGGPQ-SSISTPRAFGAFPNDIGSPPASFLPLDLNHSNSVPN 537

Query: 611 LSSQVLPLQPHMAMN---SGIYMEPFGRRNK------TMIKPITQSLQKQFATSAEVANS 661
           L    +P  P   M+     +++    +R +          PIT SL+ Q  TS +VA +
Sbjct: 538 LPPGFIPATPSGPMSPQQQQLFLN--SQRQQRDHAGGKFAHPITDSLESQMKTSTQVATA 595

Query: 662 MGGGIGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYT 721
           MG    NRT+YIGNI+PRS+ EDICNVVRGGILQ+I+F++ KHICF+TFIEAS AVQFY 
Sbjct: 596 MGSDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYA 655

Query: 722 NAFIDPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQY 781
           NAFIDPIVLHGN LK+GWG ++GPLPK ++LAVT+GASRNVY+SLP+ AFKDKYI DP++
Sbjct: 656 NAFIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKF 715

Query: 782 QRYSDEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGE 841
           + Y + +KLPA+E LR DF  +G IEQIN L+D HCCWVNFMNISSAI+LVE+      +
Sbjct: 716 KIYHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQ-D 774

Query: 842 AFHKSFDNRYRGLIIGYGKDRCGNVNKNLISGKNSRFYKKVKKPSYNIRLSRMEEERKKH 901
            F++ FD+RY GL+I YGKDRCGN+N+NL++GK S+++KKVKK + ++RLS++EE+R+  
Sbjct: 775 HFNQLFDHRYEGLVINYGKDRCGNINRNLVAGKTSKYHKKVKKHTRDVRLSQLEEKRRNQ 834

Query: 902 EETLR 906
           +   R
Sbjct: 835 DAERR 839

 Score = 68.9 bits (167), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 34/39 (87%)

Query: 1214 AKAIPGSDVMAQYLAQLQHSTFMYAANILGATAEGDVDY 1252
            A+ IPGSDVMAQYLAQLQHSTFMYAAN+LGA+ EG   Y
Sbjct: 1012 ARTIPGSDVMAQYLAQLQHSTFMYAANVLGASNEGTEQY 1050

 Score = 61.6 bits (148), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 31/35 (88%)

Query: 78  PLMNPPPTPFDTAYGITLLPSHLLIGSPFVSSPDL 112
           P+ N  PTPFDTAYG TLLPSHLL+GSPFVS+P+L
Sbjct: 85  PMTNGMPTPFDTAYGATLLPSHLLMGSPFVSTPNL 119

>Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117W -
           Hypothetical ORF [contig 38] PARTIAL
          Length = 914

 Score =  555 bits (1429), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 309/729 (42%), Positives = 440/729 (60%), Gaps = 112/729 (15%)

Query: 214 PFVVTYRMLPK---GD-DEYRTRSLLFENVNGSVDLYSFVSKYSRYGPVESIYMFKDRND 269
           P+ +T+ +LP+   GD D++RTRSL F N+N  V L+ F++ + ++  +ES+Y+     D
Sbjct: 62  PYKLTFNILPRNGNGDGDKFRTRSLYFSNLNPDVRLHEFLATFHKFDRIESVYVV----D 117

Query: 270 KTKHSVLLSFLSRKICLDSYNSVLQRLAEFKTGLKSKSLTVSFVSLKYRKHVDENEVDQN 329
           + + SVL+SFL+++ CLD YN +LQ+L+EFK  L+SK L++SF S             Q 
Sbjct: 118 REQQSVLVSFLTKETCLDFYNGILQKLSEFKKELRSKELSLSFAS------------PQK 165

Query: 330 DNSSSTPMNETDDTDASKTPVATSNVQDDAYNVTVVASLQYDIVNRGATRSVALELDGEY 389
             S  T                             +  ++++++  GATRS+ LE   E 
Sbjct: 166 VESGPT-----------------------------LQEIKFEVLRAGATRSLGLEFKDEI 196

Query: 390 DKTKLLDQELDFLSPANNQRYVLESIYLINAKEPFKHFPKNYAILTFLNISMAVEVLDYV 449
           D   LL ++ DF   +   RYV+ESI  +N  +P K+F  NYAI+ F++I+MAVE ++Y+
Sbjct: 197 DFASLL-KKFDFFDNSG-PRYVIESIETVNTDKPSKYFGSNYAIVHFISIAMAVETMEYL 254

Query: 450 RNNETARSKFQKCFFVSVSSCPQTSSDGGIVTTSNSITPVASGGSAGIATNGDLGGYTSK 509
           +                     QT    G+   S   +   SG S            T  
Sbjct: 255 K--------------------VQTPESFGLTKVSYVNSTFTSGKSEF---------QTFS 285

Query: 510 NASLSSLNSVGSYISLDQEIDFL----SSSLKGSHTITVAVDEYPKPFFAEFSDHLSNAS 565
           N+ LS  N V    S+    D      S S++     TV   +Y  P   E + H S+ +
Sbjct: 286 NSELSDQNDVEVQDSISSFEDITLSEGSMSVENEKAFTVLPSQYGPPVVEEHNQHCSHIT 345

Query: 566 VLEA-------SALDTQISSPHPQEVIVPSQDSPLVGGAPPLDAVHPAATPALSSQVL-P 617
           + +A       +   + I+SP PQEV+V + ++P         +   +    LS++   P
Sbjct: 346 ISKALSSKVSRNGSSSSIASPQPQEVLVSNSEAP---------SSRNSIVSLLSARSQGP 396

Query: 618 LQPHMAMNSGIYMEPFGRRNKTMIKPITQSLQKQFATSAEVANSMGGGIGNRTVYIGNIH 677
             P    +   YM+        M KP+ Q+LQ+Q+  +A+VA +MGGG GNRTVYIGNI 
Sbjct: 397 TYPVPGYH--YYMD--------MSKPLGQTLQQQYTATAQVATAMGGGAGNRTVYIGNIS 446

Query: 678 PRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPIVLHGNMLKV 737
           PRSK EDICNVVRGGILQS+++++ KHICFVTFIEA++AVQF+ N+ I+PIVLHG++LKV
Sbjct: 447 PRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIEPIVLHGSLLKV 506

Query: 738 GWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYSDEYKLPAEEQLR 797
           GWGHHSG LP+S+SLAVT+GASRNVYVSLP++AFKDK+I DP+YQ + +++KLP+++QL 
Sbjct: 507 GWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFREKFKLPSKQQLY 566

Query: 798 NDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKSFDNRYRGLIIG 857
           +DF+ FGDIE INFL DGHCCW+NFMNIS+AIKLVE+   ++ E+FH+ F+NRYRGL IG
Sbjct: 567 DDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHEKFENRYRGLFIG 626

Query: 858 YGKDRCGNVNKNLISGKNSRFYKKVKKPSYNIRLSRMEEERKKHEETLRSQNQNNDEKML 917
           YGKDRCGNVNKNL+S KNS+++KKVKK SYNIRL R +++     +    +   N EK L
Sbjct: 627 YGKDRCGNVNKNLVSNKNSKYFKKVKKASYNIRL-RRQQKSDIEAQAKSGKGDENSEKKL 685

Query: 918 QFGSLGIHL 926
           Q  + GI +
Sbjct: 686 QVDAFGISV 694

 Score = 61.6 bits (148), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 34/50 (68%)

Query: 1195 SHVGNSXXXXXXXXXXXXXAKAIPGSDVMAQYLAQLQHSTFMYAANILGA 1244
            S +G+              A+AIPGS+VMAQYLAQLQHSTFMYAA+ILG 
Sbjct: 856  SDIGSKSTQGKSSKSRQRNAQAIPGSNVMAQYLAQLQHSTFMYAADILGV 905

>KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 997

 Score =  531 bits (1368), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 303/698 (43%), Positives = 427/698 (61%), Gaps = 107/698 (15%)

Query: 215 FVVTYRMLPK----GDDEYRTRSLLFENVNGSVDLYSFVSKYSRYGPVESIYMFKDRNDK 270
           + V + +LP+    G DEY TRSLLF N+N    L+ F++K+ ++  VES+Y+     D 
Sbjct: 136 YEVVFHILPRSADGGGDEYMTRSLLFSNLNPDTHLHDFLTKFEKFDRVESVYLV----DS 191

Query: 271 TKHSVLLSFLSRKICLDSYNSVLQRLAEFKTGLKSKSLTVSFVSLKYRKHVDENEVDQND 330
            + SVL+SFL+++ CLD YN VLQ+L+EFK  LKSK LT++F SL+              
Sbjct: 192 QQQSVLVSFLTKETCLDFYNGVLQKLSEFKKELKSKELTLNFASLR-------------- 237

Query: 331 NSSSTPMNETDDTDASKTPVATSNVQDDAYNVTVVASLQYDIVNRGATRSVALELDGEYD 390
                                      D      +  ++ +++  GATRS+ LE   + D
Sbjct: 238 ---------------------------DVKTGPTLQEIKIEVLRAGATRSLILEFQDKVD 270

Query: 391 KTKLLDQELDFLSPANNQRYVLESIYLINAKEPFKHFPKNYAILTFLNISMAVEVLDYVR 450
              LL + L F+      RYV+E+I ++NA    KHF  +YAI+ F++I+MA+E ++Y++
Sbjct: 271 -LALLSKSLGFIV-NEGPRYVVEAIEIVNAGRSSKHFGPHYAIIHFISIAMALETVEYLK 328

Query: 451 NNETARSKFQKCFFVSVSSCPQTSSDGGIVTTSNSITPVASGGSA-GIATNGDLGGYTSK 509
           +     +   K  +V+ +S                    ASG S     ++  L      
Sbjct: 329 SQSNKLAGLIKFRYVNTTS--------------------ASGKSEFQTLSSSQLNERALS 368

Query: 510 NASLSSLNSVGSYISLDQEIDFLSSSLKGSHTITVAVDEYPKPFFAEFSDHLSNASVLEA 569
           N S S ++   S  SL  ++    +SL G  T+ V   +Y +P   E S+HL + ++ +A
Sbjct: 369 NTSDSDISGGESVASLGSKLQ--QTSL-GEQTLVVDPTQYGRPLVEERSEHLPHVTISKA 425

Query: 570 -------SALDTQISSPHPQEVIV-PSQDSPLVGGAPPLDAVH---PAATPALSSQVLPL 618
                  + L +  +SP PQEV+V   +DS   G    L   +   PA  P      +P 
Sbjct: 426 LNSKSSLNDLTSNTTSPQPQEVLVNDHEDSSSRGSMVSLKQANSHGPAYPP------IPG 479

Query: 619 QPHMAMNSGIYMEPFGRRNKTMIKPITQSLQKQFATSAEVANSMGGGIGNRTVYIGNIHP 678
            P        YM         M KP+ Q+LQ+Q+ T+A+VA +MGGG+GNRTVYIGNI P
Sbjct: 480 YP-------FYM--------NMSKPLGQTLQQQYTTTAQVATAMGGGLGNRTVYIGNISP 524

Query: 679 RSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPIVLHGNMLKVG 738
           RSK EDICNVVRGGILQS+++++ KHICFVTFIEA++AVQF+ N+ I+PIVLHGN+LKVG
Sbjct: 525 RSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEPIVLHGNVLKVG 584

Query: 739 WGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYSDEYKLPAEEQLRN 798
           WGHHSG LP+S+SLAVT+GASRNVYVSLP+ AFKDK+I DP+YQ + ++++LP++EQL  
Sbjct: 585 WGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFKEKFQLPSKEQLYE 644

Query: 799 DFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKSFDNRYRGLIIGY 858
           DF+ FGDIE +NFL DGHCCW+NFMNIS+AIKLVE+    + ++FH+ F NRY+GL IGY
Sbjct: 645 DFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANNPNNDSFHEKFGNRYKGLFIGY 704

Query: 859 GKDRCGNVNKNLISGKNSRFYKKVKKPSYNIRLSRMEE 896
           GKDRCGNVNKNL++ KNS+++KKVKK SYNIRL + ++
Sbjct: 705 GKDRCGNVNKNLVANKNSKYFKKVKKASYNIRLRKQQK 742

 Score = 69.3 bits (168), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 1/43 (2%)

Query: 1214 AKAIPGSDVMAQYLAQLQHSTFMYAANILGATAEGDVDYYEDN 1256
            +KAIPGSDVMAQYLAQLQHSTFMYAANILG   +G+  +Y++N
Sbjct: 948  SKAIPGSDVMAQYLAQLQHSTFMYAANILGVD-DGETVFYDEN 989

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 27/30 (90%)

Query: 83  PPTPFDTAYGITLLPSHLLIGSPFVSSPDL 112
           P TPFDT+YG++LLPSHLL+ SPF+++P +
Sbjct: 49  PQTPFDTSYGVSLLPSHLLMSSPFLATPGM 78

>ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML117W
          Length = 1043

 Score =  498 bits (1283), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 306/785 (38%), Positives = 436/785 (55%), Gaps = 156/785 (19%)

Query: 213 EPFVVTYRMLPKGDDEYRTRSLLFENVN--GSVDLYSFVSKYSRYGPVESIYMFKDRNDK 270
           EP+ + +++LPKG DEY TRSLL  N+     +D+++F++ + ++GPVESIY+  D    
Sbjct: 142 EPYHINFKILPKGKDEYMTRSLLLTNLEMLRDLDIHNFLNSFVKFGPVESIYLMDD---- 197

Query: 271 TKHSVLLSFLSRKICLDSYNSVLQRLAEFKTGLKSKSLTVSFVSLKYRKHVDENEVDQND 330
             HS+LLSFL++  CLD YN++LQR +EFKT L S  L+VSFV                 
Sbjct: 198 -NHSILLSFLTKATCLDFYNNLLQRFSEFKTKLHSPKLSVSFV----------------- 239

Query: 331 NSSSTPMNETDDTDASKTPVATSNVQDDAYNVTVVASLQYDIVNRGATRSVALELDGEYD 390
                                    QD++   +    LQ ++V RGATRS+ +E +   D
Sbjct: 240 ------------------------CQDES---SWFKYLQMNVVTRGATRSLTVEFE---D 269

Query: 391 KTKLLDQE---LDFLSPANNQRYVLESIYLINAKEPFKHFPKNYAILTFLNISMAVEVLD 447
             K L+++   L F     +QR+VLE I LINA    +HF   Y IL F++ISMA+EV D
Sbjct: 270 SVKELNEDFVRLKFPWLFCSQRFVLERIDLINATTVNQHFGTRYMILHFISISMALEVDD 329

Query: 448 YVRNNETARS-KFQKCFFVSVSSCPQTSSDGGIVTTSNSITPVASGGSAGIATNGDLGGY 506
           +++     R     +  FV+V+      SD      +N +        +  ++   +   
Sbjct: 330 FLQQPSQKRQLNISRIQFVNVNGHHSKLSDEEAAAAANGLQ-----QDSRTSSVSSISLS 384

Query: 507 TSKNASLSSLNSVGSYISLDQEIDFLSSSLKGSHTITVAVDEYPKPFFAEFSDHLSN--- 563
            S  A L++L            +  + S             EYP P   + S+HL++   
Sbjct: 385 ISNTADLAALFHSLDLSLDTLSLQVVPS-------------EYPTPLIEQHSEHLTSITI 431

Query: 564 ----------ASVLEASALDTQISSPH-------------------PQEVIVPSQ---DS 591
                     AS++E  +  T   + H                      +IVPS+   ++
Sbjct: 432 SRPSKTLGPSASLIEMDSNATNAGNHHGVSSSLSGVLFMNDPSSSGSTPMIVPSELNLNT 491

Query: 592 PLVGGAPPLDAVHPAATPALSSQVLPLQPH-MAM------NSG---IYMEPFGRRNKTMI 641
           P++GG              +  Q++P  P  M++      N G    +M+P       + 
Sbjct: 492 PVMGGP-------------MQGQLMPGPPQPMSLHNPSDGNGGSPSYFMDPM------VG 532

Query: 642 KPITQSLQKQFATSAEVANSMGGGIGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQ 701
            PI Q+LQ+Q+   A  AN    GI NRTVYIGNIHPRSKPEDICNVVRGGILQ+I+++ 
Sbjct: 533 APIGQTLQRQYLAGASQAN----GINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWIS 588

Query: 702 DKHICFVTFIEASTAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRN 761
            K ICFVTFIE + AVQFY NA ++PIVLHGN+L+VGWG  SG LPK+++LAVT+GASRN
Sbjct: 589 SKRICFVTFIETAAAVQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRN 648

Query: 762 VYVSLPDFAFKDKYINDPQYQRYSDEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVN 821
           VYVSLP+++FK+KYIN+P+++ Y  +YKLP EEQLR DF ++G +EQIN+L DGHCCWVN
Sbjct: 649 VYVSLPEYSFKEKYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVN 708

Query: 822 FMNISSAIKLVEE----IKYNDGEAFHKSFDNRYRGLIIGYGKDRCGNVNKNLISGKNSR 877
           FMNI+ AI+LVE+    I+ N  E FH  FD RY+ LIIGYGKDRCGNVNKNL + KNSR
Sbjct: 709 FMNIAHAIRLVEDSNSPIEKNL-EKFHAQFDGRYKNLIIGYGKDRCGNVNKNLAANKNSR 767

Query: 878 FYKKVKKPSYNIRLSRMEEERKKHEETLRSQNQNNDEKMLQFGSLGIHLEGNDNNKTSYE 937
           FYKK+KK SY+++  +   + +K +  + S +   + ++L     G+ +  + N      
Sbjct: 768 FYKKIKKQSYSMKQGK---QPRKEDGIVNSDDLTKNNEVLP----GVQMNSSKNGGVGES 820

Query: 938 RSLNG 942
           +SL G
Sbjct: 821 QSLVG 825

 Score = 53.5 bits (127), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 31/45 (68%), Gaps = 2/45 (4%)

Query: 1214 AKAIPGSDVMAQYLAQLQHSTFMYAANILGATA--EGDVDYYEDN 1256
            +K I G DVM+QYL QL HSTF+YA NILGAT   E    YY+ N
Sbjct: 994  SKPIAGQDVMSQYLEQLHHSTFLYATNILGATTVQEPLGGYYDSN 1038

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/34 (61%), Positives = 27/34 (79%), Gaps = 3/34 (8%)

Query: 77  PPLMNPPPTPFDTAYGITLLPSHLLIGSPFVSSP 110
           PP+   P TPFD  YG +LLPSH+L+GSPF+S+P
Sbjct: 57  PPV---PQTPFDPTYGASLLPSHMLMGSPFLSTP 87

>Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {ON}
           similar to Ashbya gossypii ABL122C
          Length = 1067

 Score =  482 bits (1241), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 285/730 (39%), Positives = 413/730 (56%), Gaps = 127/730 (17%)

Query: 213 EPFVVTYRMLPKGDDEYRTRSLLFENV--NGSVDLYSFVSKYSRYGPVESIYMFKDRNDK 270
           EP+ V +++LPKG DEY TRSLLF N+    + D+++F++ + ++GP+ESIY+  D    
Sbjct: 157 EPYQVNFKILPKGKDEYMTRSLLFSNLERQENFDIHNFLTNFIKFGPIESIYLLDD---- 212

Query: 271 TKHSVLLSFLSRKICLDSYNSVLQRLAEFKTGLKSKSLTVSFVSLKYRKHVDENEVDQND 330
             HS+LLSFL++  CLD YN++LQR +EFK+ L S  L+VSFV                 
Sbjct: 213 -SHSILLSFLTKATCLDFYNNLLQRFSEFKSKLHSTKLSVSFVC---------------- 255

Query: 331 NSSSTPMNETDDTDASKTPVATSNVQDDAYNVTVVASLQYDIVNRGATRSVALELDGEYD 390
                     D+T+  +                    LQ ++V RG TRS+ +E + +  
Sbjct: 256 ---------QDETNWFRL-------------------LQMNVVTRGVTRSLCIEFEDQSM 287

Query: 391 K--TKLLDQELDFLSPANNQRYVLESIYLINAKEPF-KHFPKNYAILTFLNISMAVEVLD 447
           +  + L+ +++ +L    + R+V+E I L+NA  P  ++F   Y ++ F+ ISMA+EV +
Sbjct: 288 ELTSDLIHEKIPWL--FFSHRFVIERIDLVNAAAPKNQNFNNRYLLIHFICISMALEVEE 345

Query: 448 YVRN-NETARSKFQKCFFVSVSSCPQTSSDGGIVTTSNSI-----TPVASGGSAGIATNG 501
           Y++  ++  +    K  FV+V+      SD   V  +N +     T   S  S  I+ + 
Sbjct: 346 YLQQASQKKQLGISKIQFVNVNGHSSDLSDEDAVAAANGLQRESRTSSVSSISLPISNSS 405

Query: 502 DLGGYTSKNASLSSLNSVGSYISLDQEIDFLSSSLKGSHTITVAVDEYPKPFFAEFSDHL 561
           DL               V  + SLD  +  +S        + V   EYP P      DHL
Sbjct: 406 DL---------------VELFHSLDLALGIIS--------LQVIPSEYPVPLIESHDDHL 442

Query: 562 SNASVLEASALDTQISSPHPQEVIVP--------SQDSPLVGGAPPLDAVHPAATP---- 609
            + ++   S   T  +S    +            +    L+   P  D   P+  P    
Sbjct: 443 HSVTISRPSKTLTSSTSLVEMDGGPNGGTPNGSNAMQGVLLLSDPSSDGNTPSMLPNELN 502

Query: 610 --------ALSSQVLPLQPHMAM-----NSG----IYMEPFGRRNKTMIKPITQSLQKQF 652
                    +  QVL     +++     N G     +M+P          PI Q+LQ+Q+
Sbjct: 503 INTSLMPGPMGGQVLGTSQSLSLHNPNDNGGAGPSYFMDPMSG------APINQALQRQY 556

Query: 653 ATSAEVANSMGGGIGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIE 712
            T         GG  NRTVYIGNIHPRSKPEDICNVVRGGILQ+I+++  K ICFVTFIE
Sbjct: 557 LT----GTGQVGGSNNRTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIE 612

Query: 713 ASTAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFK 772
           A+ A+QFY NA ++PIVLHGN+L+VGWG  SG LPK+++LAVT+GASRNVYVSLP+++FK
Sbjct: 613 AAAAIQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFK 672

Query: 773 DKYINDPQYQRYSDEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLV 832
           +KYIN+P+++ Y  +YKLP+EEQLR DF ++G +EQIN+L DGHCCWVNFMNI+ AI+LV
Sbjct: 673 EKYINNPEFKEYHGKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLV 732

Query: 833 EE---IKYNDGEAFHKSFDNRYRGLIIGYGKDRCGNVNKNLISGKNSRFYKKVKKPSYNI 889
           E+   +   + E FH  FD RY+ LIIGYGKDRCGNVNKNL + KNSRF+KK+KK +   
Sbjct: 733 EDCNSLSQRNLEKFHAQFDGRYKNLIIGYGKDRCGNVNKNLTANKNSRFFKKIKKLNCTT 792

Query: 890 RLSRMEEERK 899
           + ++ ++ ++
Sbjct: 793 KPNKRQQSKR 802

 Score = 53.1 bits (126), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/45 (55%), Positives = 32/45 (71%), Gaps = 1/45 (2%)

Query: 1214 AKAIPGSDVMAQYLAQLQHSTFMYAANILGATAEGD-VDYYEDNT 1257
            +K I G DVM+QYL QL HSTF+Y+ NILGAT   D + +Y+ N 
Sbjct: 1020 SKPIAGQDVMSQYLEQLHHSTFLYSTNILGATTVHDPLGFYDVNA 1064

 Score = 50.8 bits (120), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/34 (64%), Positives = 27/34 (79%), Gaps = 3/34 (8%)

Query: 77  PPLMNPPPTPFDTAYGITLLPSHLLIGSPFVSSP 110
           PP+   P TPFD  YG +LLPSH+L+GSPFVS+P
Sbjct: 80  PPV---PQTPFDPTYGASLLPSHMLMGSPFVSTP 110

>Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,
           1032 aa] {ON} (7832..9475,9855..9863,10320..11765) [3099
           nt, 1033 aa]
          Length = 1032

 Score =  437 bits (1125), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 204/321 (63%), Positives = 253/321 (78%), Gaps = 12/321 (3%)

Query: 628 IYMEPFG--RRNKTMIKPITQSLQKQFATSAEVANSMGGGIGNRTVYIGNIHPRSKPEDI 685
           I+ME      R   M+  + ++ + QFATSAE+AN+MGGG GNRTVYIGNI+PRSK EDI
Sbjct: 538 IWMETINCNLRXXXMLHQLLRASKHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDI 597

Query: 686 CNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPIVLHGNMLKVGWGHHSGP 745
           CNVVRGG LQ I+F ++K ICFVTFIEA++A QFY N+FIDPI+LH N L+VGWG HSGP
Sbjct: 598 CNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGP 657

Query: 746 LPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYSDEYKLPAEEQLRNDFNQFGD 805
           LPKS+SLAVTVGASRNVYVSLP++AFKDK+INDP+Y+ Y ++Y LP EE+LR DF+ FG+
Sbjct: 658 LPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGE 717

Query: 806 IEQINFLSDGHCCWVNFMNISSAIKLVEEI-KYNDGEAFHKSFDNRYRGLIIGYGKDRCG 864
           +EQ+NFL+DGHCCW+NFMNI SAIKLVE +   N G+ FH+ + NRY+GLIIGYGKDRCG
Sbjct: 718 MEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCG 777

Query: 865 NVNKNLISGKNSRFYKKVKKPSYNIRLSRMEEERKKHEETLRSQNQNNDEKMLQFGSLGI 924
           NVNK+LISGKNS+FY+KVKKPSYNIRL ++EEERK+ E+   S       K +   S GI
Sbjct: 778 NVNKSLISGKNSKFYRKVKKPSYNIRLQQLEEERKQEEKNKISN------KSINLNSFGI 831

Query: 925 HLEGNDNNKTSYER---SLNG 942
            +E    N++  E    SL+G
Sbjct: 832 QVETPSQNESEQEEPKISLDG 852

 Score =  200 bits (508), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 117/279 (41%), Positives = 160/279 (57%), Gaps = 58/279 (20%)

Query: 215 FVVTYRMLPKGDDEYRTRSLLFENVNGSVDLYSFVSKYSRYGPVESIYMFKD-------- 266
           F ++Y++LPKG+DEY+TRSLLFENV+ SVDL+ F+ K+  +GP+ES+Y+           
Sbjct: 251 FTISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLINSNGIYDNNK 310

Query: 267 ------------------RNDKTKHSVLLSFLSRKICLDSYNSVLQRLAEFKTGLKSKSL 308
                              N+    S+LLSFLSR ICLD YNSVLQRL+EFKT L S  L
Sbjct: 311 NNDDYDDDNDNNNDNDDNANNHDTQSILLSFLSRPICLDFYNSVLQRLSEFKTQLNSNDL 370

Query: 309 TVSFVSLKYRKHVDENEVDQNDNSSSTPMNETDDTDASKTPVATSNVQDDAYNVTVVASL 368
           T+SFV LKY K+ D  + +++D S + P+                             SL
Sbjct: 371 TLSFVLLKY-KNQDRPDDEESDFSPALPL-----------------------------SL 400

Query: 369 QYDIVNRGATRSVALELDGEY-DKTKLLDQELDFLSPANNQRYVLESIYLINAKEPFKHF 427
           +YDI+ RGATRS+A+E +     K   ++ +L FL    N+RY++ES+ +INA E   + 
Sbjct: 401 EYDIIKRGATRSIAVEFNQPITSKEGFMNSKLSFLLSPENKRYIIESVDIINAAERDANL 460

Query: 428 PKNYAILTFLNISMAVEVLDYVRNNETARSKFQKCFFVS 466
           PKN  ILTFLNISM V+V+D +R  E   S   KC FV+
Sbjct: 461 PKNTVILTFLNISMTVDVMDRIR-LERKDSGISKCVFVT 498

 Score = 66.6 bits (161), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/45 (66%), Positives = 40/45 (88%), Gaps = 1/45 (2%)

Query: 1215 KAIPGSDVMAQYLAQLQHSTFMYAANILGATAEGDVDYYEDNTEN 1259
            K +PGSDVM+QYLAQLQHSTFMYAANILGA+++ + ++Y++N  N
Sbjct: 985  KLLPGSDVMSQYLAQLQHSTFMYAANILGASSD-EPEFYDENVIN 1028

>KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1151

 Score =  431 bits (1109), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 274/717 (38%), Positives = 384/717 (53%), Gaps = 139/717 (19%)

Query: 219 YRMLPKGDDEYRTRSLLFENVNGSVDLYSFVSKYSRYGPVESIYMFKDRN---------- 268
           Y +LPKG+D YR+RSLLF NVN  +D+  F+ K ++  P+ESIY+ KD +          
Sbjct: 219 YSILPKGNDTYRSRSLLFTNVNSELDIVEFLQKVAKNYPIESIYLIKDEDTGDDIENLNT 278

Query: 269 -----------------------DKTKHSV-------------------LLSFLSRKICL 286
                                  DK K S                    LLSF +++ CL
Sbjct: 279 SNNDDDPNQNYNADNNNNSKREDDKDKESAPALTKQIAISPSSCSQQSYLLSFFTKESCL 338

Query: 287 DSYNSVLQRLAEFKTGLKSKSLTVSFVSLKYRKHVDENEVDQNDNSSSTPMNETDDTDAS 346
           D YN++LQR AE K  +KS  L ++FV                                 
Sbjct: 339 DFYNNLLQRYAEIKNAVKSDQLAMNFVK-------------------------------- 366

Query: 347 KTPVATSNVQDDAYNVTVVASLQYDIVNRGATRSVALELDGEYDKTKLLDQELDFLSPAN 406
                   +QDD      +A+L+ ++++ GATRS+ +E   +   +  +   L FL   N
Sbjct: 367 --------IQDDE---EWMANLKMNVISLGATRSLYVEFADDSVTSDTIWDTLPFLK--N 413

Query: 407 NQRYVLESIYLINAKEPFKHFPKNYAILTFLNISMAVEVLDYVRNNETARSKFQKCFFVS 466
           + +YV+  + ++   E  K+F  +Y +L FL+++MA+EV + +   ET      +  FV+
Sbjct: 414 SGKYVVIDVDVVTTDERRKNFGLHYCLLHFLSVTMALEVKELL---ETGDEAVSRVSFVT 470

Query: 467 VSSCPQTSSDGGIVTTSNSITPVASGGSAGIATNGDLGGYTSKNASL---SSLNSVGSYI 523
               P  S+D  +    +S   +    S  + +        S N SL     +++  + I
Sbjct: 471 ----PANSADKEMRRRRSSAISLKQEASPQMFSTDSRSRSRSSNVSLPLSEQVSTASTDI 526

Query: 524 S--LDQEIDFLSSSLKGSHTITVAVDEYPKPFFAEFSDHLSNASVLEASALDTQISSPHP 581
           S  + +E D    +L  S T+ V V EY +P   EF  HL++ S+ + + L    S    
Sbjct: 527 STPIYEEFD---GNLTWS-TLIVDVSEYKEPIVNEFDHHLNSWSISKPTTLYMHESG--- 579

Query: 582 QEVIVPSQDSPLVGGAPPLDAVHPAATPALSSQVLPLQPHMAMNSGIY-MEPFGRRNKTM 640
                    S L     PL         ++SS   P+   M +N   Y MEP       M
Sbjct: 580 ---TTNFSSSNLSDDIDPL---------SISSHD-PVPQQMLLNEYPYIMEPL------M 620

Query: 641 IKPITQSLQKQFATSAEVANSMGGGIGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFL 700
              ITQ++Q Q++ S +  N+   G+ +RTVYIGNI+PRSK EDICNVVRGGILQ I+++
Sbjct: 621 PPQITQTIQNQYSKSIQAVNA---GMEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWV 677

Query: 701 QDKHICFVTFIEASTAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASR 760
             K ICFVTFIE + AVQFY N  ++PI+LHGN+LKVGWG + GPLPK+++LAVTVGASR
Sbjct: 678 SHKRICFVTFIETAAAVQFYANTTLEPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASR 737

Query: 761 NVYVSLPDFAFKDKYINDPQYQRYSDEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWV 820
           NVYVSLPD AFKDK+INDPQ++ Y + YK+P   QL++DF  +G +EQ+NF SDGHCCW+
Sbjct: 738 NVYVSLPDKAFKDKFINDPQFKEYQNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWI 797

Query: 821 NFMNISSAIKLVEEIKYNDGEAFHKSFDNRYRGLIIGYGKDRCGNVNKNLISGKNSR 877
           NFMNISSAIKLVEE        FHK  + RY GLIIGYGKDRCGN+N+NL+  KN +
Sbjct: 798 NFMNISSAIKLVEEYSDTKDNLFHKKTEGRYVGLIIGYGKDRCGNINRNLVFNKNGK 854

 Score = 54.7 bits (130), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/34 (67%), Positives = 28/34 (82%)

Query: 77  PPLMNPPPTPFDTAYGITLLPSHLLIGSPFVSSP 110
           P  ++ P TPFD  YGITLLPSHLL+GSPFV++P
Sbjct: 63  PGTVSIPQTPFDPVYGITLLPSHLLVGSPFVNTP 96

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/42 (66%), Positives = 32/42 (76%), Gaps = 1/42 (2%)

Query: 1215 KAIPGSDVMAQYLAQLQHSTFMYAANILGATAEGDVDYYEDN 1256
            K I GSDVM +YL QL H+TF+YAANILGAT +  V Y EDN
Sbjct: 1110 KPIAGSDVMTRYLEQLHHNTFVYAANILGATQD-PVFYDEDN 1150

>TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa]
           {ON} Anc_6.183 YPL184C
          Length = 710

 Score =  194 bits (494), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 103/225 (45%), Positives = 141/225 (62%), Gaps = 22/225 (9%)

Query: 644 ITQSLQKQFATSAEVANSMGG--GIGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQ 701
           I+ +L +Q A +A +A S GG   +GNRTVY+GN+    K ++ICN VRGG+LQ I+ L 
Sbjct: 501 ISNTLLQQSAAAAAIATSAGGPNNLGNRTVYLGNLPVDVKIDEICNAVRGGLLQHIKLLT 560

Query: 702 DKHICFVTFIEASTAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRN 761
           D+H+CFVTFI+ + A QFY  + +  + +     KVGWG HSGPLP  ++LAV+ GASRN
Sbjct: 561 DRHVCFVTFIDPTAAAQFYAMSSLHGLSIQKKRCKVGWGKHSGPLPNLIALAVSNGASRN 620

Query: 762 VYVSLPDFAFKDKYINDPQYQRYSDEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVN 821
           VY+   DF    K  N P +           E  LRN F Q+GD+EQINFL + +CC++N
Sbjct: 621 VYLGNIDFENDIKLHNPPIF----------TELSLRNIFQQYGDVEQINFLPEKNCCFIN 670

Query: 822 FMNISSAIKLVEEIKYNDGEAFHKSFDNRYRGLIIGYGKDRCGNV 866
           F NIS+AI  +E+IK N            ++ L I +GKDRCGN+
Sbjct: 671 FTNISNAILAIEKIKNNPD----------FKDLKINFGKDRCGNI 705

 Score =  100 bits (249), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 67/231 (29%), Positives = 117/231 (50%), Gaps = 26/231 (11%)

Query: 654 TSAEVANSMGGGIGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEA 713
           TS    N+  G   +RTVY+GNI      +D+ + VR G++++I+ L DK   F++F++ 
Sbjct: 253 TSTLPNNNTFGNTPSRTVYLGNIPSDLSVKDLLDHVRSGVVENIKILPDKMCAFISFVDE 312

Query: 714 STAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYV--------- 764
           S+A+ F+++A +  + + G  +K+GWG  +   P   +  VT GA+RNVY+         
Sbjct: 313 SSALLFHSDAILKRLNIGGRDIKIGWGKPTPIDPIVATSIVTDGATRNVYIGQLSNSSNN 372

Query: 765 -------SLPDFAFKDKYINDPQYQRYSDEYKLPAEEQLRNDFNQFGDIEQINFLSDGHC 817
                  S    +  +   +D + ++  D+  L  EE+LR D   +G+I+ +  + D   
Sbjct: 373 NTSSSSSSTSPSSPSNNTSDDLEKKKNIDDSPL-TEEKLREDLKDYGEIDCVKIVQDKGF 431

Query: 818 CWVNFMNISSAIKLVEEIKYNDGEAFHKSFDNRYRGLIIGYGKDRCGNVNK 868
            +V+  +I SAIK+V  +   +           Y+   I YGKDRC  + K
Sbjct: 432 AFVHMSSILSAIKVVNNLAQTNP---------YYQNKRIFYGKDRCAFITK 473

>NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {ON}
           Anc_6.183
          Length = 629

 Score =  191 bits (485), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 100/227 (44%), Positives = 146/227 (64%), Gaps = 23/227 (10%)

Query: 642 KPITQSLQKQFATSAEVANSMGG--GIGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRF 699
           K I+ +L +Q A +A +A + GG   +GNRTVY+GN+    K E+ICNVVRGG+LQS++ 
Sbjct: 419 KFISNALLQQSAAAAAIATAAGGPNNLGNRTVYLGNLPKDIKIEEICNVVRGGLLQSVKL 478

Query: 700 LQDKHICFVTFIEASTAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGAS 759
           L D+++CFVTFI+ + A QFY  + +  + +     KVGWG HSGPLP +++LAV+ GAS
Sbjct: 479 LSDRYVCFVTFIDPTAAAQFYAMSSLHGLTIQKKRCKVGWGKHSGPLPNALALAVSNGAS 538

Query: 760 RNVYVSLPDFAFKDKYINDPQYQRYSDEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCW 819
           RNVY+   +  F+   + DP         ++  E+ LR  F Q+G++EQINFL + +CC+
Sbjct: 539 RNVYIG--NINFEKDAMRDP---------RIFTEDSLRKLFRQYGEVEQINFLPEKNCCF 587

Query: 820 VNFMNISSAIKLVEEIKYNDGEAFHKSFDNRYRGLIIGYGKDRCGNV 866
           +NF NIS+AI  +++IK N            +  L I +GKDRCGNV
Sbjct: 588 INFTNISNAILALDKIKSNP----------HFEDLKINFGKDRCGNV 624

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 102/200 (51%), Gaps = 20/200 (10%)

Query: 669 RTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPI 728
           RTVY+GNI      +++ + VR G+++ ++ + +K   F++F++ S+A+ F+++A +  +
Sbjct: 214 RTVYLGNIPSNLTVKELLDHVRSGVVEDVKIIPEKLCAFISFVDESSALLFHSDAILKRL 273

Query: 729 VLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYSDEY 788
            + G  +K+GWG  +   P   +  +   A+RNV++   +    D    +P         
Sbjct: 274 NIGGKDIKIGWGKPTTVDPMISARIINDDATRNVFIGHLNKTDNDSCTKEPI-------- 325

Query: 789 KLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKSFD 848
               E +LR D   FG+IE +  + +    +V+F +I+SAIK V  +         +S +
Sbjct: 326 ---TEAKLREDLEDFGEIETVKIIPEKGIAFVHFSSITSAIKCVHNL---------RSMN 373

Query: 849 NRYRGLIIGYGKDRCGNVNK 868
             Y    I YGKDRC  + K
Sbjct: 374 PYYENKKIAYGKDRCAFITK 393

>Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii AFL061C
          Length = 576

 Score =  189 bits (480), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 106/261 (40%), Positives = 156/261 (59%), Gaps = 34/261 (13%)

Query: 612 SSQVLPLQPHMAMNSGIYMEPFGRRNKTMIKPITQSLQKQFATSAEVANSMG--GGIGNR 669
           ++Q L +QP M        EP    ++ +I   +Q+L +Q A +A +A S G    +GNR
Sbjct: 347 AAQFLGIQPGM--------EPLFSNDRELI---SQTLLQQSAAAAAIATSAGGANNLGNR 395

Query: 670 TVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPIV 729
           T+Y+GN+    K E+ICN VRGG+LQ I+ L D+H+CFVTFI+ + A QFY  + +  + 
Sbjct: 396 TIYLGNLPKDVKLEEICNSVRGGLLQHIKLLNDRHVCFVTFIDPTAAAQFYAMSSLHGLT 455

Query: 730 LHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYSDEYK 789
           +H    K+GWG HSGPLP  ++LAV+ GASRN+Y+   DF   D+ +  P +        
Sbjct: 456 IHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFE-DDRKLEQPIF-------- 506

Query: 790 LPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKSFDN 849
              E  LR+ F +FG++EQINFL + +CC++NF NISSAI  +++IK             
Sbjct: 507 --TETSLRSVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKIKSIP---------- 554

Query: 850 RYRGLIIGYGKDRCGNVNKNL 870
            ++ L I +GKDRCGNV +  
Sbjct: 555 TFKDLKINFGKDRCGNVPRQF 575

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 107/202 (52%), Gaps = 18/202 (8%)

Query: 669 RTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPI 728
           RTVY+GN+ P     ++ + VR G+++ ++ L +K   F++F++ ++A+ F+++A +  +
Sbjct: 156 RTVYLGNVPPYITTRELLDHVRSGVVEDVKILPEKMCAFISFVDENSALLFHSDAILKRL 215

Query: 729 VLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFK--DKYINDPQYQRYSD 786
            +    +K+GWG  +   P   +     GA+RNVY+   +   K   ++  DP  +  + 
Sbjct: 216 NIDDRDIKIGWGKPTQIDPIVAAGINNDGATRNVYLGKLNTNPKMCAQWGADPNEETIT- 274

Query: 787 EYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKS 846
                 EE+LRND   FG++E +  +++    +V+F +I SAIK+V  +          +
Sbjct: 275 ------EEKLRNDLADFGEVESVKIVTEKGIAFVHFSSIFSAIKVVANL---------AN 319

Query: 847 FDNRYRGLIIGYGKDRCGNVNK 868
            +  Y    I YGKDRC  + K
Sbjct: 320 VNPYYAQKKIFYGKDRCAFITK 341

>AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL184C
          Length = 523

 Score =  187 bits (474), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 108/261 (41%), Positives = 155/261 (59%), Gaps = 34/261 (13%)

Query: 612 SSQVLPLQPHMAMNSGIYMEPFGRRNKTMIKPITQSLQKQFATSAEVANSMG--GGIGNR 669
           ++Q L +QP M        E F   ++ +I   +Q+L +Q A +A +A S G    +GNR
Sbjct: 294 AAQFLGIQPGM--------ESFFSNDRELI---SQTLLQQSAAAAAIATSAGGANNLGNR 342

Query: 670 TVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPIV 729
           T+Y+GN+    K E+ICN VRGG+LQ I+ L D+H+CFVTFI+ + A QFY  + +  + 
Sbjct: 343 TIYLGNLPKDVKLEEICNSVRGGLLQHIKLLSDRHVCFVTFIDPTAAAQFYAMSSLHGLT 402

Query: 730 LHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYSDEYK 789
           +H    K+GWG HSGPLP  ++LAV+ GASRN+Y+   DFA  DK    P +        
Sbjct: 403 IHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFA-ADKKSQHPIF-------- 453

Query: 790 LPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKSFDN 849
              E  LR  F +FG++EQINFL + +CC++NF NISSAI  +++IK             
Sbjct: 454 --TEAALRAVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKIKSIP---------- 501

Query: 850 RYRGLIIGYGKDRCGNVNKNL 870
            ++ L I +GKDRCGNV +  
Sbjct: 502 TFKDLKINFGKDRCGNVPRQF 522

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 106/201 (52%), Gaps = 16/201 (7%)

Query: 669 RTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPI 728
           RTVY+GN+ P    +++ + VR G+++ ++ L +K   F++F+E ++A+ F+++A +  +
Sbjct: 103 RTVYLGNVPPYITTKELLDHVRSGVVEEVKILPEKMCAFISFVEENSALLFHSDAILKRL 162

Query: 729 VLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYSD-E 787
            +    +K+GWG  +   P   +     GA+RNVY+       K     D   Q   D  
Sbjct: 163 NIDDRDIKIGWGKPTQIDPIVAAGITNDGATRNVYIG------KLNTNKDICAQWGVDPN 216

Query: 788 YKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKSF 847
            ++  EE+LRND + FG++E +  + +    +V+F +I +AIK+V  +          + 
Sbjct: 217 EEVITEEKLRNDLSDFGEVENVKIVPEKGIAFVHFSSIFAAIKVVANL---------ANI 267

Query: 848 DNRYRGLIIGYGKDRCGNVNK 868
           +  Y    I YGKDRC  + K
Sbjct: 268 NPYYAQKKIFYGKDRCAFITK 288

>SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 582

 Score =  187 bits (475), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 90/201 (44%), Positives = 130/201 (64%), Gaps = 21/201 (10%)

Query: 666 IGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFI 725
           +GNRTVY+GN+    K E+ICN VRGG+LQS++ L D+H+CFVTFI+ + A QFY  + +
Sbjct: 398 LGNRTVYLGNLPKDVKIEEICNAVRGGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMSSL 457

Query: 726 DPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYS 785
             + +H    K+GWG HSG LP +++LAV+ GASRN+YV   DF   D+          +
Sbjct: 458 HGLTIHNKRCKIGWGKHSGSLPNALALAVSHGASRNIYVGNIDFNAIDE----------T 507

Query: 786 DEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHK 845
            E  +  E+ LR  F +FG++EQINFL + +CC++NF NIS+AI  +++IK N       
Sbjct: 508 GE-TIFTEQNLRETFQEFGEVEQINFLHEKNCCFINFTNISNAILAIDKIKCNP------ 560

Query: 846 SFDNRYRGLIIGYGKDRCGNV 866
                ++ L + +GKDRCGNV
Sbjct: 561 ----YFKNLKVNFGKDRCGNV 577

 Score =  111 bits (277), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 111/204 (54%), Gaps = 22/204 (10%)

Query: 669 RTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPI 728
           RTVY+GNI P    + + + VR G+++ ++ L D+   F++F++ S+A+ F+++A +  +
Sbjct: 161 RTVYLGNIPPFLPAKQLLDHVRSGVIEELKILPDRMCAFISFVDESSALLFHSDAILKRL 220

Query: 729 VLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYV----SLPDFAFKDKYINDPQYQRY 784
            + G  +KVGWG  +   P   +   + GA+RNVY+    + P  A        PQ+   
Sbjct: 221 NIEGRDIKVGWGKPTPIDPIVAAGIASDGATRNVYIGRLNTDPQLA--------PQFGTD 272

Query: 785 SDEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFH 844
            +E ++ +EE+LR D N FG+IE I  + D    +V+F +I SAIK+V  +         
Sbjct: 273 PNE-EIVSEEKLRKDLNDFGEIESIKIVRDKGIAFVHFSSIFSAIKVVSNL--------- 322

Query: 845 KSFDNRYRGLIIGYGKDRCGNVNK 868
            S +  Y    I YGKDRC  + K
Sbjct: 323 ASVNPYYTNKKIFYGKDRCAFITK 346

>KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 652

 Score =  187 bits (476), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 106/256 (41%), Positives = 152/256 (59%), Gaps = 34/256 (13%)

Query: 613 SQVLPLQPHMAMNSGIYMEPFGRRNKTMIKPITQSLQKQFATSAEVANSMG--GGIGNRT 670
           +Q L +QP M        E     N+ +I   +Q+L +Q A +A +A S G    +GNRT
Sbjct: 425 AQFLGIQPGM--------EALMENNRELI---SQTLLQQSAAAAAIATSAGGANNLGNRT 473

Query: 671 VYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPIVL 730
           VY+GN+    K E+ICN +RGG+LQ+I+ L D+H+CFVTFI+ + A QFY  + +  + +
Sbjct: 474 VYLGNLPKNVKLEEICNAIRGGLLQNIKLLNDRHVCFVTFIDPTAAAQFYAMSSLHGLTI 533

Query: 731 HGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYSDEYKL 790
           H    K+GWG HSGPLP  ++LAV+ GASRN+Y+   +F    K            E  +
Sbjct: 534 HNKRCKIGWGKHSGPLPNPIALAVSRGASRNIYLGNINFEEDAK-----------QEESV 582

Query: 791 PAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKSFDNR 850
            AE+ LR  F +FG +EQINFL + +CC++NF NIS+AI  +++IK N            
Sbjct: 583 FAEDTLRAIFEEFGTVEQINFLYEKNCCFINFANISNAILAIDKIKSNP----------H 632

Query: 851 YRGLIIGYGKDRCGNV 866
           +  L I +GKDRCGNV
Sbjct: 633 FNNLKINFGKDRCGNV 648

 Score = 98.6 bits (244), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 68/236 (28%), Positives = 115/236 (48%), Gaps = 28/236 (11%)

Query: 645 TQSLQKQFATSAEVANSMGGGIGN----------RTVYIGNIHPRSKPEDICNVVRGGIL 694
           T ++  QF   A +  S+  G  N          RTVY+GNI      + + + VR G++
Sbjct: 199 TVNMIAQFTAEANLPLSLQSGQLNNPRDFTTAPSRTVYLGNIPATITYKALLDYVRTGVV 258

Query: 695 QSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSVSLAV 754
           + ++ L +K   FV+F++ + A+ F+++A +  + + G  +K+GWG      P   +   
Sbjct: 259 EEVKILSEKMCAFVSFVDENDALLFHSDAILKRLNIDGRDIKIGWGKPQPIDPIVRAGIA 318

Query: 755 TVGASRNVYVSLPDFAFKDKYINDPQYQRYSDEYK--LPAEEQLRNDFNQFGDIEQINFL 812
             GA+RNVY+   +        N    +++  + K  L  +E+L +D +QFG+IE I  +
Sbjct: 319 NDGATRNVYIGKLN-------TNKDSCEKWGADPKEILVTKEKLYDDLSQFGEIESIKLV 371

Query: 813 SDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKSFDNRYRGLIIGYGKDRCGNVNK 868
            D    +V+F +I +AIK V  I          S D  Y    + YGKDRC  + K
Sbjct: 372 EDRGIAFVHFTSIFAAIKAVANI---------GSIDPYYSNKKVFYGKDRCAFITK 418

>Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184C -
           Hypothetical ORF [contig 30] FULL
          Length = 567

 Score =  186 bits (471), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 90/201 (44%), Positives = 129/201 (64%), Gaps = 21/201 (10%)

Query: 666 IGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFI 725
           +GNRT+Y+GN+    K E+ICNVVRGG+LQSI+ L D+H+CFVTFI+ + A Q Y  A +
Sbjct: 383 LGNRTIYLGNLPKDVKIEEICNVVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMASL 442

Query: 726 DPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYS 785
             + +H    K+GWG HSG L  +++LAV+ GASRN+Y+   DF    +           
Sbjct: 443 HGLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNIDFKADSE----------- 491

Query: 786 DEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHK 845
            E+ +  E+ LR+ F +FG++EQINFL + +CC+VNF NIS+AI  +++IK N       
Sbjct: 492 TEHPIFTEQNLRSIFEEFGEVEQINFLIERNCCFVNFTNISNAILAIDKIKNNP------ 545

Query: 846 SFDNRYRGLIIGYGKDRCGNV 866
               ++  L I +GKDRCGNV
Sbjct: 546 ----QFSDLKINFGKDRCGNV 562

 Score =  109 bits (273), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 65/202 (32%), Positives = 114/202 (56%), Gaps = 18/202 (8%)

Query: 669 RTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPI 728
           RTVY+GNI P  +   + + VR G+++ IR L++K   F++F++ S+A+ F+++A +  +
Sbjct: 146 RTVYLGNIPPNLEARQLLDHVRSGVVEDIRILREKMCAFISFLDESSALLFHSDAILKRL 205

Query: 729 VLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSL--PDFAFKDKYINDPQYQRYSD 786
            + G  +K+GWG  +   P   S     GA+RNVY+     D +F  +   DP+     D
Sbjct: 206 NIDGRDIKIGWGKPTPIDPVVTSAVANDGATRNVYIGRLNTDSSFAPQIGADPR-----D 260

Query: 787 EYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKS 846
           E  +  E++LR+D + +G+IE +  +++    +V+F +I SAIK+V  +      A +  
Sbjct: 261 E--VVTEQKLRDDLSFYGEIESVKIITEKGIAFVHFCSIFSAIKVVSSLA-----AVNPY 313

Query: 847 FDNRYRGLIIGYGKDRCGNVNK 868
           + N+     I YGKDRC  + K
Sbjct: 314 YANKK----IFYGKDRCAFITK 331

>Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa]
           {ON} complement(185133..186905) [1773 nt, 591 aa]
          Length = 590

 Score =  184 bits (468), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 129/201 (64%), Gaps = 21/201 (10%)

Query: 666 IGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFI 725
           +GNRTVY+GN+    K E+ICN VR G+LQS++ L D+H+CFVTFI+ + A QFY  + +
Sbjct: 406 LGNRTVYLGNLPKGIKIEEICNTVRSGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMSSL 465

Query: 726 DPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYS 785
             ++L     KVGWG HSGPLP  ++LAV+ GASRNVY+   DF  +D   N+       
Sbjct: 466 HGLILQRKRCKVGWGKHSGPLPNLIALAVSNGASRNVYIGNIDFE-EDSKRNE------- 517

Query: 786 DEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHK 845
              ++  E+ LR  F ++G++EQINFL   +CC++N+ NIS+AI  +++IK N       
Sbjct: 518 ---RVFTEDNLRKLFQEYGEVEQINFLPSKNCCFINYTNISNAISAIDKIKSNP------ 568

Query: 846 SFDNRYRGLIIGYGKDRCGNV 866
                ++ L I +GKDRCGN+
Sbjct: 569 ----YFKDLKINFGKDRCGNI 585

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 62/201 (30%), Positives = 112/201 (55%), Gaps = 16/201 (7%)

Query: 669 RTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPI 728
           RTVY+GNI      +++ + VR G+++ ++ L +K   F++F++ S+A+ F+++A +  +
Sbjct: 169 RTVYLGNIPTTLTVKELLDHVRSGVVEDVKILPEKMCAFISFVDDSSALLFHSDAILKRL 228

Query: 729 VLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYV-SLPDFAFKDKYINDPQYQRYSDE 787
            + G  +K+GWG  +   P   +   T GA+RNVY+  L   A   + +N P+      E
Sbjct: 229 NIEGRDIKIGWGKPTKIDPIVANGITTDGATRNVYIGQLYTDAEVAESLNIPK------E 282

Query: 788 YKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKSF 847
            ++  EE+L  D   +GDI+ +  + +    +++F +I SAIK+V     N+  A ++ +
Sbjct: 283 SEIVTEERLIADLEIYGDIDSVKIVKEKGIAFIHFASILSAIKVV-----NNLAASNRYY 337

Query: 848 DNRYRGLIIGYGKDRCGNVNK 868
            NR     I YGKDRC  + K
Sbjct: 338 QNRK----IFYGKDRCAFITK 354

>CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184c
          Length = 639

 Score =  185 bits (469), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 125/201 (62%), Gaps = 21/201 (10%)

Query: 666 IGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFI 725
           +GNRTVY+GN+    K E+ICN VRGG+LQSI+ L D+H+CFVTFI+ + A QFY  + +
Sbjct: 455 LGNRTVYLGNLPKGVKIEEICNAVRGGLLQSIKLLDDRHVCFVTFIDPTAAAQFYAMSSL 514

Query: 726 DPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYS 785
               +     KVGWG HSGPLP +++LAV+ GASRNVY+   DF    K           
Sbjct: 515 YGFTIQRQRCKVGWGKHSGPLPNALALAVSNGASRNVYLGNIDFEADSK----------- 563

Query: 786 DEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHK 845
            E  +  E  LR  F ++G++EQINFL +  CC++NF NI++AI  +++IK N       
Sbjct: 564 KEQPIFNETALRAIFQEYGEVEQINFLVEKKCCFINFTNINNAIFAMDKIKSNP------ 617

Query: 846 SFDNRYRGLIIGYGKDRCGNV 866
                ++ L I +GKDRCGNV
Sbjct: 618 ----HFKSLKINFGKDRCGNV 634

 Score =  105 bits (263), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 66/201 (32%), Positives = 109/201 (54%), Gaps = 22/201 (10%)

Query: 669 RTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPI 728
           RTVY+GNI P    +++ + VR G+++  + L +K   F++F+E S+A+ F+++A +  +
Sbjct: 224 RTVYLGNIPPSLTIKELLDHVRSGVVEEAKILPEKMCAFISFVEESSALLFHSDAILKRL 283

Query: 729 VLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYSDEY 788
            +    +KVGWG  +   P   S  +  GA+RNVY+   +        ND    R S E 
Sbjct: 284 NIDNRDIKVGWGKPTVLDPSIASRIINDGATRNVYIGQGN--------ND----RSSKEN 331

Query: 789 KLP-AEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKSF 847
           K P  EE+LR D  ++G+I+ I  + +    +V+F +I++AIK+V  +      A    F
Sbjct: 332 KEPLTEEKLREDLKEYGEIDSIKIIPEKDIAFVHFSSIATAIKVVSTL------AQKNPF 385

Query: 848 DNRYRGLIIGYGKDRCGNVNK 868
              Y+   I YGKDRC  + K
Sbjct: 386 ---YQEKKIFYGKDRCAFITK 403

>Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {ON}
           YPL184C (REAL)
          Length = 596

 Score =  183 bits (464), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 92/201 (45%), Positives = 130/201 (64%), Gaps = 21/201 (10%)

Query: 666 IGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFI 725
           +GNRTVY+G++    K E+ICN VRGG+LQSI+ L D+++CFVTFI+ + A QFY  + +
Sbjct: 412 LGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSL 471

Query: 726 DPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYS 785
               +     KVGWG HSGPLP +++LAV+ GASRNVYV   DFA     +ND       
Sbjct: 472 YGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDFA--SDSLNDE------ 523

Query: 786 DEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHK 845
              ++  E  LR+ F Q+G++EQINFL + +CC++N+ NIS+AI  +++IK N       
Sbjct: 524 ---RIFTENNLRSIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKIKSNP------ 574

Query: 846 SFDNRYRGLIIGYGKDRCGNV 866
                ++ L I +GKDRCGNV
Sbjct: 575 ----YFKDLKINFGKDRCGNV 591

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 104/200 (52%), Gaps = 24/200 (12%)

Query: 669 RTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPI 728
           RTVY+GN+ P    +++ + VR G+++ ++ + +K   F++F++ S A+ F+++A +  +
Sbjct: 185 RTVYLGNVPPHLTVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAILKRL 244

Query: 729 VLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYSDEY 788
            +    +K+GWG  +   P   +   T GA+RNVY+       ++ ++            
Sbjct: 245 NIGDRDIKIGWGKPTRIDPIVAARITTDGATRNVYIGRMTVEGEESHL------------ 292

Query: 789 KLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKSFD 848
              +EEQLR D  ++G+I+ I  + +    +++F +I +AIK+V  +   +         
Sbjct: 293 ---SEEQLRADLQEYGEIDCIKIIKEKGIAFIHFASILNAIKVVTNLPIRNP-------- 341

Query: 849 NRYRGLIIGYGKDRCGNVNK 868
             Y+   I YGKDRC  + K
Sbjct: 342 -YYQNKRIFYGKDRCAFITK 360

>KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON}
           Anc_6.183 YPL184C
          Length = 533

 Score =  181 bits (458), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 88/201 (43%), Positives = 125/201 (62%), Gaps = 25/201 (12%)

Query: 666 IGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFI 725
           +GNRT+Y+GN+    K E+ICNVVRGG+LQ+I+ L D+  CF+TFI+ + A QFY  + +
Sbjct: 353 LGNRTIYLGNLPKGVKIEEICNVVRGGLLQNIKLLSDRFACFITFIDPTAAAQFYAMSSL 412

Query: 726 DPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYS 785
             + +  N  KVGWG HSGPL  +++LA++ GASRN+Y+   DF  K++Y N        
Sbjct: 413 HGLTIQKNRCKVGWGKHSGPLSNALALAISNGASRNIYIGNVDFEKKNEYFN-------- 464

Query: 786 DEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHK 845
                  EE LR  F +FG++EQINFL +  CC+VNF NI+ AI  +++IK         
Sbjct: 465 -------EEHLREIFEEFGEVEQINFLREKGCCFVNFTNINHAILALDKIKSLP------ 511

Query: 846 SFDNRYRGLIIGYGKDRCGNV 866
                +  L I +GKDRCGN+
Sbjct: 512 ----EFEDLKINFGKDRCGNI 528

 Score = 99.0 bits (245), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 60/201 (29%), Positives = 107/201 (53%), Gaps = 28/201 (13%)

Query: 669 RTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPI 728
           RTVY+GNI      +++ + VR G+++S++ L  K   F++FI+   A+ F+++A +  +
Sbjct: 128 RTVYLGNIPQGLTIKELLDHVRSGVVESVKILPTKLCAFISFIDERGALLFHSDAILKRL 187

Query: 729 VLHGNMLKVGWGHHSGPLPKSVSLAVTV-GASRNVYVSLPDFAFKDKYINDPQYQRYSDE 787
            + G  +K+GWG  S  +   V+  +T  GA+RNVY+                  + +D+
Sbjct: 188 NIRGKDIKIGWG-KSNHIDSIVAARITNDGATRNVYIG-----------------QLNDD 229

Query: 788 YKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKSF 847
             +  E++L  D  +FG+I+ I FLS+    +V+F +IS AI +V+ +            
Sbjct: 230 PTITTEQELEKDMQKFGEIDCIKFLSNKGIAFVHFASISVAIYVVQNL---------SKL 280

Query: 848 DNRYRGLIIGYGKDRCGNVNK 868
           + +Y+   I YGKDRC  + K
Sbjct: 281 NEKYKNKRIFYGKDRCAFITK 301

>KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 569

 Score =  181 bits (459), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 127/203 (62%), Gaps = 25/203 (12%)

Query: 666 IGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFI 725
           +GNRT+Y+GN+    K E+ICN VRGG+LQSI+ L D+H+CFVTFI+ + A Q Y    +
Sbjct: 385 LGNRTIYLGNLPKDVKIEEICNAVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMTSL 444

Query: 726 DPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYS 785
             + +H    K+GWG HSG L  +++LAV+ GASRN+Y+   DF             +  
Sbjct: 445 HGLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNIDF-------------KAD 491

Query: 786 DEYKLPA--EEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAF 843
            E  +P   E+ LR  F ++G++EQINFL +  CC+VNF NIS+AI  +++IK N+    
Sbjct: 492 SERDVPVFTEQNLRKLFEEYGEVEQINFLPERSCCFVNFTNISNAILAIDKIKSNE---- 547

Query: 844 HKSFDNRYRGLIIGYGKDRCGNV 866
                 +++ L I +GKDRCGNV
Sbjct: 548 ------QFKDLKINFGKDRCGNV 564

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 113/203 (55%), Gaps = 20/203 (9%)

Query: 669 RTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPI 728
           RTVY+GNI P  +  ++ + VR G+++ +R L++K   F++F++ S+A+ F+++A +  +
Sbjct: 148 RTVYLGNIPPNLEVRELLDHVRSGVVEDVRILREKMCAFISFLDESSALLFHSDAILKRL 207

Query: 729 VLHGNMLKVGWGHHSGPLPKSVSLAVT-VGASRNVYVSL--PDFAFKDKYINDPQYQRYS 785
            + G  +KVGWG  + P+   V+ AV+  GA+RNVY+     D     ++  DP+     
Sbjct: 208 NIGGRDIKVGWGKPT-PIDPVVTAAVSNDGATRNVYIGRLNTDRDLAPQFGADPRDL--- 263

Query: 786 DEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHK 845
               +  EE+LR D + +G+IE +  + +    +V+F +I SAIK+V  +          
Sbjct: 264 ----IATEEKLRADLDFYGEIESVKIIVEKGIAFVHFSSIFSAIKVVSSL---------A 310

Query: 846 SFDNRYRGLIIGYGKDRCGNVNK 868
           + +  Y    I YGKDRC  V K
Sbjct: 311 TVNPYYSNKKIFYGKDRCAFVTK 333

>Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C
           (REAL)
          Length = 625

 Score =  181 bits (460), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 131/201 (65%), Gaps = 21/201 (10%)

Query: 666 IGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFI 725
           +GNRTVY+G++    K E+ICN VRGG+LQSI+ L D+++CFVTFI+ + A QFY  + +
Sbjct: 441 LGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSL 500

Query: 726 DPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYS 785
               +     KVGWG HSGPLP +++LAV+ GASRNVYV   DF      ++D       
Sbjct: 501 YGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDF------VSD----SLR 550

Query: 786 DEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHK 845
           DE ++  E  LR+ F Q+G++EQINFL + +CC+VN+ NIS+AI  +++IK N       
Sbjct: 551 DE-RIFTESNLRHVFQQYGEVEQINFLPEKNCCFVNYTNISNAILALDKIKSNP------ 603

Query: 846 SFDNRYRGLIIGYGKDRCGNV 866
                ++ L I +GKDRCGNV
Sbjct: 604 ----YFKDLKINFGKDRCGNV 620

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 104/200 (52%), Gaps = 24/200 (12%)

Query: 669 RTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPI 728
           RTVY+GN+ P    +++ + VR G+++ ++ + +K   F++F++ S A+ F+++A +  +
Sbjct: 214 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIISEKMCAFISFVDESAALLFHSDAILKRL 273

Query: 729 VLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYSDEY 788
            +    +K+GWG  +   P   +   T GA+RNVY+       ++ ++            
Sbjct: 274 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIDGEESHL------------ 321

Query: 789 KLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKSFD 848
              +EEQLR D  ++G+I+ I  + +    +++F +I +AIK+V  +   +         
Sbjct: 322 ---SEEQLRIDLKEYGEIDCIKVIKEKGIAFIHFASILNAIKVVTNLPIRNP-------- 370

Query: 849 NRYRGLIIGYGKDRCGNVNK 868
             Y+   I YGKDRC  + K
Sbjct: 371 -YYQNKRIFYGKDRCAFITK 389

>Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {ON}
           YPL184C (REAL)
          Length = 614

 Score =  181 bits (459), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 92/201 (45%), Positives = 131/201 (65%), Gaps = 21/201 (10%)

Query: 666 IGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFI 725
           +GNRTVY+G++    K E+ICN VRGG+LQSI+ L D+++CFVTFI+ + A QFY  + +
Sbjct: 430 LGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSL 489

Query: 726 DPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYS 785
               +     KVGWG HSGPLP +++LAV+ GASRNVYV   D      Y++D       
Sbjct: 490 YGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNID------YVSD----SVR 539

Query: 786 DEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHK 845
           DE ++  E +LR  F Q+G++EQINFL + +CC++N+ NIS+AI  +++IK N       
Sbjct: 540 DE-RIFTEGKLRGIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKIKSNP------ 592

Query: 846 SFDNRYRGLIIGYGKDRCGNV 866
                ++ L I +GKDRCGNV
Sbjct: 593 ----YFKDLKINFGKDRCGNV 609

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 103/200 (51%), Gaps = 24/200 (12%)

Query: 669 RTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPI 728
           RTVY+GN+ P    +++ + VR G+++ ++ + +K   F++F++ S A+ F+++A +  +
Sbjct: 203 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAILKRL 262

Query: 729 VLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYSDEY 788
            +    +K+GWG  +   P   +   T GA+RNVY+       ++ ++            
Sbjct: 263 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIEGEESHL------------ 310

Query: 789 KLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKSFD 848
              + EQLR D  ++G+I+ I  + +    +++F +I +AIK+V  +   +         
Sbjct: 311 ---SGEQLRADLEEYGEIDCIKIIKEKGVAFIHFASILNAIKVVTNLPIRNL-------- 359

Query: 849 NRYRGLIIGYGKDRCGNVNK 868
             Y+   I YGKDRC  + K
Sbjct: 360 -YYQNKRIFYGKDRCAFITK 378

>YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON}
           MRN1RNA-binding protein proposed to be involved in
           translational regulation; binds specific categories of
           mRNAs, including those that contain upstream open
           reading frames (uORFs) and internal ribosome entry sites
           (IRES)
          Length = 612

 Score =  181 bits (458), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 92/201 (45%), Positives = 130/201 (64%), Gaps = 21/201 (10%)

Query: 666 IGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFI 725
           +GNRTVY+G++    K E+ICN VRGG+LQSI+ L D+++CFVTFI+ + A QFY  + +
Sbjct: 428 LGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSL 487

Query: 726 DPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYS 785
               +     KVGWG HSGPLP +++LAV+ GASRNVYV   DF      + D       
Sbjct: 488 YGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDF------VGD----SLR 537

Query: 786 DEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHK 845
           DE ++  E  LR+ F Q+G++EQINFL + +CC++N+ NIS+AI  +++IK N       
Sbjct: 538 DE-RVFTESNLRHIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKIKSNP------ 590

Query: 846 SFDNRYRGLIIGYGKDRCGNV 866
                ++ L I +GKDRCGNV
Sbjct: 591 ----YFKDLKINFGKDRCGNV 607

 Score = 97.1 bits (240), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 104/200 (52%), Gaps = 24/200 (12%)

Query: 669 RTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPI 728
           RTVY+GN+ P    +++ + VR G+++ ++ + +K   FV+FI+ S A+ F+++A +  +
Sbjct: 201 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFVSFIDESAALLFHSDAILKRL 260

Query: 729 VLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYSDEY 788
            +    +K+GWG  +   P   +   T GA+RNVY+       ++ ++            
Sbjct: 261 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIEGEESHL------------ 308

Query: 789 KLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKSFD 848
              +EEQLR D  ++G+I+ I  + +    +++F +I +AIK+V  +   +         
Sbjct: 309 ---SEEQLRVDLEEYGEIDCIKIIKEKGIAFIHFASILNAIKVVTNLPIRNP-------- 357

Query: 849 NRYRGLIIGYGKDRCGNVNK 868
             Y+   I YGKDRC  + K
Sbjct: 358 -YYQNKRIFYGKDRCAFITK 376

>NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183
          Length = 680

 Score =  182 bits (461), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 132/201 (65%), Gaps = 21/201 (10%)

Query: 666 IGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFI 725
           +GNRT+Y+GN+    + E+ICNVVRGG+LQS++ L D+++CFVTFI+ + A QF+  + +
Sbjct: 496 LGNRTIYLGNLPKDIRVEEICNVVRGGLLQSVKLLGDRYVCFVTFIDPTAAAQFFAMSSL 555

Query: 726 DPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYS 785
             + +     KVGWG HSGPL  +++LAV+ GASRN+Y+   DFA  DK  ++P +    
Sbjct: 556 HGLTIQKKRCKVGWGKHSGPLSNALALAVSHGASRNIYIGNIDFA-TDKKRDNPIF---- 610

Query: 786 DEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHK 845
                  E+ LR  F+ +G++EQINFL + +CC++NF NIS+AI  +++IK N       
Sbjct: 611 ------TEDSLRKMFSMYGEMEQINFLPEKNCCFINFTNISNAILALDKIKSNP------ 658

Query: 846 SFDNRYRGLIIGYGKDRCGNV 866
                ++ L I +GKDRCGN+
Sbjct: 659 ----VFKDLKINFGKDRCGNI 675

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 109/232 (46%), Gaps = 41/232 (17%)

Query: 669 RTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPI 728
           RTVY+GNI      +++ + VR G+++ ++ + +K   F++F++ ++A+ F+++A +  +
Sbjct: 222 RTVYLGNIPSDLTVKELLDHVRSGVIEDVKIIPEKLCAFISFLDENSALLFHSDAILKRL 281

Query: 729 VLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYV-SLPDFAF---KDKYINDPQYQRY 784
            ++G  +K+GWG  +   P   +  +  GA+RNV++  L   +F   K K    P  + +
Sbjct: 282 NINGKDIKIGWGKSTAVDPMIATRIINDGATRNVFIGQLKTKSFDPNKAKVTKMPPSRNH 341

Query: 785 SDEYKLPAEE----------------------------QLRNDFNQFGDIEQINFLSDGH 816
                +  E                             +LR D   FGDI+ I  + D  
Sbjct: 342 DINATISNENDEKENGVDTAHVEGEVEVGEEEEPISDAKLRKDLADFGDIDCIKIVEDKG 401

Query: 817 CCWVNFMNISSAIKLVEEIKYNDGEAFHKSFDNRYRGLIIGYGKDRCGNVNK 868
             +++F +I+SAIK V  +          S ++ Y    I YGKDRC  + K
Sbjct: 402 IAFIHFASITSAIKCVHNL---------NSMNDYYSTKKIFYGKDRCAFITK 444

>TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {ON}
           Anc_6.183 YPL184C
          Length = 584

 Score =  178 bits (452), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 127/201 (63%), Gaps = 21/201 (10%)

Query: 666 IGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFI 725
           +GNRTVY+GN+    K E+ICNVVRGGILQ+I+ L D+H+CFVTFI+   A QFY  + +
Sbjct: 400 LGNRTVYLGNLPKDVKIEEICNVVRGGILQAIKVLSDRHVCFVTFIDPIAAAQFYAMSSL 459

Query: 726 DPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYS 785
             I +     +VGWG H GPLP +++LAV+ GASRNVY+   DF ++D    +P +    
Sbjct: 460 HGITIQKRRCRVGWGKHPGPLPNAIALAVSNGASRNVYIGNIDF-YEDSKRQEPIF---- 514

Query: 786 DEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHK 845
                   + LR  F ++G++EQ+NFL + +C +VN+ NIS+AI  +++IK N       
Sbjct: 515 ------TADYLRKIFQEYGEVEQLNFLPEKNCAFVNYTNISNAISAIDKIKSNP------ 562

Query: 846 SFDNRYRGLIIGYGKDRCGNV 866
                ++ L I +GKDRCG +
Sbjct: 563 ----LFKNLKINFGKDRCGTI 579

 Score =  103 bits (257), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 110/202 (54%), Gaps = 18/202 (8%)

Query: 669 RTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPI 728
           +TVY+GNI P     ++ + VR G+++ ++ L +K   F+TF++ S A+ F+++A +  +
Sbjct: 163 KTVYLGNIPPSLTVRELLDHVRSGVVEEVKILPEKTCAFLTFVDESAALLFHSDAILKRL 222

Query: 729 VLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSL--PDFAFKDKYINDPQYQRYSD 786
            + G  +K+GWG  +   P   +   + GA+RNVY+ L   D     +   DP  ++ + 
Sbjct: 223 HIDGRDIKIGWGKATPVDPLVTTAIASDGATRNVYIGLLNTDSDIALQVGADPNDEKIT- 281

Query: 787 EYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKS 846
                 EE+LR+D  +FG+I+ +  + +    +++F +I SA+K+V  +        +  
Sbjct: 282 ------EEKLRSDLGEFGEIDCVKIVEEKGIAFIHFASILSAVKVVANLA-----GINPY 330

Query: 847 FDNRYRGLIIGYGKDRCGNVNK 868
           ++N+     I YGKDRC  + K
Sbjct: 331 YENKK----IYYGKDRCAFITK 348

>KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON}
           Anc_6.183 YPL184C
          Length = 443

 Score =  174 bits (440), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 91/225 (40%), Positives = 135/225 (60%), Gaps = 25/225 (11%)

Query: 644 ITQSLQKQFATSAEVANSMGG--GIGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQ 701
           ++  L +Q A +A +A S GG   +GNRT+Y+GN+  R + E++CNVVRGG+LQS++FL 
Sbjct: 238 VSNVLLQQAAATAAIATSAGGPNNLGNRTIYVGNLSARCRIEEVCNVVRGGLLQSVKFLP 297

Query: 702 DKHICFVTFIEASTAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRN 761
           D+H+CFVTF + + A QFY  A +  + +     K+GWG HSGPLP  ++ A++ GASRN
Sbjct: 298 DRHVCFVTFADPTAAAQFYAMASLHGLTIQRRRCKIGWGKHSGPLPAHLADAISHGASRN 357

Query: 762 VYVSLPDFAFKDKYINDPQYQRYSDEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVN 821
           VY       F +    DP    + +      E  LR   + FG++EQ+N + +  C +VN
Sbjct: 358 VY-------FGNVNWQDPAVAEFFE------ERHLRQAMSHFGEMEQVNAVPERRCVFVN 404

Query: 822 FMNISSAIKLVEEIKYNDGEAFHKSFDNRYRGLIIGYGKDRCGNV 866
           F N+ SAI  VE++K             +++ L + YGKDRCGNV
Sbjct: 405 FTNLESAIAAVEQVKKWP----------QFQQLKVNYGKDRCGNV 439

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 100/202 (49%), Gaps = 31/202 (15%)

Query: 668 NRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDP 727
           +RTVY+GNI P     ++ + V+ G+++  R    K   FV+F++ ++A+ F+++A ++ 
Sbjct: 38  SRTVYLGNIAPEVTLRELLDHVQSGVVEDARLFPAKSCAFVSFVDENSALLFHSDAILNR 97

Query: 728 IVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYV-SLPDFAFKDKYINDPQYQRYSD 786
           + +    +K+GW   +   P   +   + GA+RNVY+ +LPD              RY  
Sbjct: 98  LRIGDRDVKIGWATATLMDPLVATRIQSEGATRNVYLGNLPD-----------GVSRY-- 144

Query: 787 EYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKS 846
                   +L  D + +G+I+ +  LS     +V+  +I  AI  V  ++ ++     K 
Sbjct: 145 --------ELTKDLSVYGEIDSVKLLSSKGVAFVHMASIGQAIHAVANLQRDN-----KI 191

Query: 847 FDNRYRGLIIGYGKDRCGNVNK 868
           + +R     + +GKDRC  V K
Sbjct: 192 YSDRR----VSFGKDRCAYVTK 209

>TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6.183
           YPL184C
          Length = 593

 Score =  176 bits (446), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 88/201 (43%), Positives = 126/201 (62%), Gaps = 21/201 (10%)

Query: 666 IGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFI 725
           +GNRTVY+GN+    + EDICN +R G+LQ+I+ L D+H+CFVTFI+  +A QFY  + I
Sbjct: 412 LGNRTVYLGNLPNDIRIEDICNTIRCGLLQNIKLLSDRHVCFVTFIDPVSAAQFYAMSSI 471

Query: 726 DPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYS 785
              VL     KVGWG HSGPL   ++LAV+ GASRNVY+   DF       +  + +RY 
Sbjct: 472 YGFVLQKKRCKVGWGKHSGPLSNPLTLAVSNGASRNVYIGNIDFT-----ADGTKRERYF 526

Query: 786 DEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHK 845
                  +  LR  F+++G++EQINFL   +CC+VN+ NI++AI  +++IK N       
Sbjct: 527 ------TDSNLRRIFSEYGEVEQINFLYSKNCCFVNYTNINNAISAIDKIKNNP------ 574

Query: 846 SFDNRYRGLIIGYGKDRCGNV 866
                ++ L I +GKDRCGN+
Sbjct: 575 ----TFKNLKINFGKDRCGNI 591

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 62/202 (30%), Positives = 110/202 (54%), Gaps = 11/202 (5%)

Query: 669 RTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPI 728
           RTVY+GNI P     D+ + VR G+++ ++ L +K   F++F++ ++++ F+++A +  +
Sbjct: 168 RTVYLGNIPPTLTASDLLDHVRSGVIEEVKILPEKMCAFISFLDENSSLLFHSDAILKRL 227

Query: 729 VLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYI-NDPQYQRYSDE 787
            + G  +K+GWG  S   P   +   T GA+RN+++   +    +K   ND      SD+
Sbjct: 228 NIDGKDIKIGWGKPSPLSPIIATSVATDGATRNIFIGQLNTTDHNKQKDNDATIYHGSDD 287

Query: 788 YK-LPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKS 846
           ++ +  EE+LR D  ++GDI+ I    +    +V+F +I SAIK+V  +  N    + K 
Sbjct: 288 FEDIMTEEKLRKDLEEYGDIDCIKIFKEKGFAFVHFTSILSAIKVVNNLS-NSNPYYSKK 346

Query: 847 FDNRYRGLIIGYGKDRCGNVNK 868
                    I YGKDRC  + K
Sbjct: 347 --------KIYYGKDRCAFITK 360

>ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 632

 Score =  175 bits (444), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 90/201 (44%), Positives = 128/201 (63%), Gaps = 21/201 (10%)

Query: 666 IGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFI 725
           +GNRTVY+GN+    K E+ICNVVRGG+LQ+++ L D+H+CFVTFI+ + A QFY  + +
Sbjct: 448 LGNRTVYLGNLPKDVKVEEICNVVRGGLLQNVKVLSDRHVCFVTFIDPTAAAQFYAMSSL 507

Query: 726 DPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYS 785
             I +     +VGWG H G L  +++LAV+ GASRNVYV   +F  +D    DP +    
Sbjct: 508 HGITIQKRRCRVGWGKHPGSLENALALAVSNGASRNVYVGNINFD-EDSKREDPIF---- 562

Query: 786 DEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHK 845
                  E  LR+ F Q+G++EQIN+L + +CC+VN+ NIS+AI  +++IK       H 
Sbjct: 563 ------TESSLRSIFQQWGEVEQINYLPERNCCFVNYTNISNAILAIDKIKG------HP 610

Query: 846 SFDNRYRGLIIGYGKDRCGNV 866
            F    + L I +GKDRCGNV
Sbjct: 611 VF----KDLKINFGKDRCGNV 627

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 60/203 (29%), Positives = 102/203 (50%), Gaps = 19/203 (9%)

Query: 669 RTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPI 728
           +TVY+GN       +++ + VR G+++ +R L DK   FV+F++ S A+ F+++A +  +
Sbjct: 210 KTVYLGNTPITLTVKELLDHVRSGVVEDVRILPDKMCAFVSFVDESAALLFHSDAILKRL 269

Query: 729 VLHGNMLKVGWGHHSGPLPKSVSLAVTVG---ASRNVYVSLPDFAFKDKYINDPQYQRYS 785
            + G  +K+GWG    P P    +A  V    A+RNVY+   +   K       Q     
Sbjct: 270 HIDGRDIKIGWGK---PTPIDPVVATAVANDNATRNVYIGQLNTGPKLS----SQVSPVD 322

Query: 786 DEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHK 845
               +  E++LR D  +FG+I+ I  + +    +V+F +I +AIK V  +          
Sbjct: 323 VTEPVITEDKLRLDLQEFGEIDCIKIVEEKGIAFVHFASILNAIKAVANL---------A 373

Query: 846 SFDNRYRGLIIGYGKDRCGNVNK 868
           + +  YR   I YGKDRC  + K
Sbjct: 374 NINPYYRNKKIFYGKDRCAFITK 396

>Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W
            (REAL)
          Length = 1128

 Score = 66.6 bits (161), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 29/33 (87%), Positives = 32/33 (96%)

Query: 1215 KAIPGSDVMAQYLAQLQHSTFMYAANILGATAE 1247
            + IPGSDVMAQYLAQ+QHSTFMYAANILGA+AE
Sbjct: 1089 RTIPGSDVMAQYLAQVQHSTFMYAANILGASAE 1121

 Score = 65.9 bits (159), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 32/35 (91%)

Query: 78  PLMNPPPTPFDTAYGITLLPSHLLIGSPFVSSPDL 112
           PL N PPTPFDTAYG +LLPSHLL+GSPFVSSP++
Sbjct: 59  PLPNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNM 93

>ZYRO0F07238g Chr6 complement(586327..587496) [1170 bp, 389 aa] {ON}
           similar to uniprot|Q96US5 Saccharomyces cerevisiae
           YOR242C SSP2 Sporulation SPecific involved in
           sporulation
          Length = 389

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/220 (25%), Positives = 93/220 (42%), Gaps = 15/220 (6%)

Query: 652 FATSAEVANSMGGGIGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICF---- 707
           + TS+     +   +  + + +GNI  R+    I   +  G L++I    D         
Sbjct: 166 YVTSSSEDELLENNVRPKAIVLGNIPKRTGIASILAQIHAGPLENIIVHTDDEQALKKIE 225

Query: 708 VTFIEASTAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLP 767
           + F+    A  F      +   ++G  L   WG  S    K  +      +S +      
Sbjct: 226 LDFLTHEAAYSFMKYGRTNMFKINGQHLTPEWGKSSEHKTKKGNEWDDQQSSSDDQDFCR 285

Query: 768 DFAFKDKYINDPQYQRYSDEYKL-PAE----EQLRNDFNQFGDIEQIN-FLSDGHCCWVN 821
               K KYIN  +  +YS+ YK  P E     +++ DF  FG+I +I   +S   C  +N
Sbjct: 286 SLIMK-KYINCTKRTKYSEAYKESPLEPLNLSEIKQDFGTFGEILEITPVVSRKLCISIN 344

Query: 822 FMNISSAIKLVEEIKYNDGEAFHKSFDNRYRGLIIGYGKD 861
           F N+ SA+K ++E + N     HK++ N +    I YGKD
Sbjct: 345 FFNMESAMKAMKEYE-NPNSDLHKAYFNNW---AIWYGKD 380

>Ecym_2403 Chr2 (785307..786434) [1128 bp, 375 aa] {ON} similar to
           Ashbya gossypii ACR135C
          Length = 375

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 39/69 (56%), Gaps = 5/69 (7%)

Query: 794 EQLRNDFNQFGDIEQIN-FLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKSFDNRYR 852
           + L+NDF QFGDI  I+  +S   C  +NF +I +A+  ++  K N     ++ + + + 
Sbjct: 302 QDLKNDFGQFGDILDISPMISRKLCVQINFFDIKTAVDALQAYK-NINSPLNRKYADTW- 359

Query: 853 GLIIGYGKD 861
              IGYGKD
Sbjct: 360 --TIGYGKD 366

>NDAI0E01190 Chr5 (237093..238169) [1077 bp, 358 aa] {ON} Anc_8.670
           YOR242C
          Length = 358

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 88/206 (42%), Gaps = 31/206 (15%)

Query: 669 RTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQD------KHICFVTFIEASTAVQFYTN 722
           R + I NI   +    I   + GG +++  F Q        ++  + FI +  A QF   
Sbjct: 162 RMIIIRNIPKETGIHSIVAQISGGPIENFNFYQQHKLSSPSNVLKIAFIASEGAQQFMKY 221

Query: 723 AFIDPIVLHGNMLKVGWGHHSG-PLPKSVSLAVTV----GASRNVYVSLPDFAFKDKYIN 777
              +   ++G  LK  W   S   +P     + T+    G  R ++  +     KD  + 
Sbjct: 222 GNTNLFKVNGIHLKPEWFVDSNLCIPSKTVPSKTLLNYNGKCRCLF--MKQLPLKDHLVL 279

Query: 778 DPQYQRYSDEYKLPAEEQLRNDFNQFGDIEQIN-FLSDGHCCWVNFMNISSAIKLVEEIK 836
           +  Y +           ++R+DF  FG+I  I+  +S   C ++ F +I SA++++E   
Sbjct: 280 NSLYLK-----------RIRSDFECFGEIVDISPLISRRPCLYIQFYDIYSAVRVLEA-- 326

Query: 837 YNDGEA-FHKSFDNRYRGLIIGYGKD 861
           Y D  +  H+ +  ++    I YGKD
Sbjct: 327 YEDRHSRIHQQYFEKWS---IYYGKD 349

>KLTH0D11088g Chr4 complement(906439..907707) [1269 bp, 422 aa] {ON}
           some similarities with uniprot|Q96US5 Saccharomyces
           cerevisiae YOR242C SSP2 Sporulation SPecific involved in
           sporulation
          Length = 422

 Score = 40.4 bits (93), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 40/68 (58%), Gaps = 7/68 (10%)

Query: 796 LRNDFNQFGDIEQIN-FLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAF-HKSFDNRYRG 853
           LR DF QFG+I +I+  +S   C  V+F ++ SAI  +E   + + ++F HK ++   R 
Sbjct: 350 LRKDFEQFGEISEISPMISRKLCVSVSFYDVRSAINALES--FGEPDSFMHKKYN---RD 404

Query: 854 LIIGYGKD 861
             + YG+D
Sbjct: 405 WTMAYGRD 412

>KAFR0A03830 Chr1 complement(779143..780267) [1125 bp, 374 aa] {ON}
           Anc_8.670 YOR242C
          Length = 374

 Score = 40.4 bits (93), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 35/65 (53%), Gaps = 7/65 (10%)

Query: 799 DFNQFGDIEQIN-FLSDGHCCWVNFMNISSAIKLVEEIKYND-GEAFHKSFDNRYRGLII 856
           DF QFG I+++   +S   C  VN+ NI SA+K +E   Y D     H+ +   Y+   I
Sbjct: 306 DFGQFGRIQEVTPIISRKLCVAVNYYNILSALKAIES--YEDPNSELHRKY---YKSWAI 360

Query: 857 GYGKD 861
            +GKD
Sbjct: 361 WFGKD 365

>ACR135C Chr3 complement(585997..587127) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR242C
           (SSP2)
          Length = 376

 Score = 40.0 bits (92), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 5/69 (7%)

Query: 794 EQLRNDFNQFGDIEQIN-FLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKSFDNRYR 852
           ++L+ DF+QFG+I  I+  +S   C  +NF +I SA+  ++  K N     ++ +   + 
Sbjct: 303 QELKKDFSQFGNILDISPMISRKLCVQINFYDIKSAMDALQSYK-NANSPLNRKYAESW- 360

Query: 853 GLIIGYGKD 861
              IGYGKD
Sbjct: 361 --TIGYGKD 367

>TDEL0A06160 Chr1 complement(1078577..1079713) [1137 bp, 378 aa]
           {ON} Anc_8.670 YOR242C
          Length = 378

 Score = 38.5 bits (88), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 95/214 (44%), Gaps = 38/214 (17%)

Query: 668 NRTVYIGNIHPRSKPEDICNVVRGGILQSI--------RFLQDKHICFVTFIEASTAVQF 719
           +R++ + NI   +    I + + GG L+ +          L+   + F+T  E + A   
Sbjct: 174 SRSIVLANIPNNTGLGSILSQICGGPLECVLPRRNEGDNLLRQVQLDFLT-TEGANAFMK 232

Query: 720 Y--TNAFIDPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFA---FKDK 774
           Y  TN F     ++G  L   W  H+  +  ++S          ++  +P+        K
Sbjct: 233 YGSTNLF----KINGVHLIPEWAKHTDTMFPALSA--------ELFEEIPEICRCLIMKK 280

Query: 775 YINDPQYQRYSDEYKLPAEE-----QLRNDFNQFGDIEQIN-FLSDGHCCWVNFMNISSA 828
           YI + +  ++ D  +  A +     ++R+DF  FG ++ I   +S   C  ++F ++ SA
Sbjct: 281 YITNTKRYKHGDSSRERAPDVLDVAEIRHDFGIFGKVQDIAPIVSRKLCISISFYSVHSA 340

Query: 829 IKLVEEIKYND-GEAFHKSFDNRYRGLIIGYGKD 861
           I+ +++  Y D   A +K +   ++   + YGKD
Sbjct: 341 IRAMDD--YEDPSSALYKKY---FKNWAVWYGKD 369

>Suva_8.292 Chr8 complement(527751..528863) [1113 bp, 370 aa] {ON}
           YOR242C (REAL)
          Length = 370

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 37/69 (53%), Gaps = 5/69 (7%)

Query: 794 EQLRNDFNQFGDIEQIN-FLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKSFDNRYR 852
           ++L  DF  FG++ +I   +S   C  + F +ISSA++ +EE +      ++K F    +
Sbjct: 297 QELEKDFQNFGEVLEITPIVSRKLCVSIFFYDISSAMRAMEEYEQKGSYLYNKYF----K 352

Query: 853 GLIIGYGKD 861
              I YGKD
Sbjct: 353 TWTIWYGKD 361

>YOR242C Chr15 complement(788742..789857) [1116 bp, 371 aa] {ON}
           SSP2Sporulation specific protein that localizes to the
           spore wall; required for sporulation at a point after
           meiosis II and during spore wall formation; SSP2
           expression is induced midway in meiosis
          Length = 371

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 37/69 (53%), Gaps = 5/69 (7%)

Query: 794 EQLRNDFNQFGDIEQIN-FLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKSFDNRYR 852
           ++L  DF  FG++ +I   +S   C  + F +ISSA++ +EE +      ++K F    +
Sbjct: 298 QELEKDFQNFGEVLEITPIVSRKLCVSIFFYDISSAMRAMEEYEQKGSYLYNKYF----K 353

Query: 853 GLIIGYGKD 861
              I YGKD
Sbjct: 354 TWTIWYGKD 362

>Smik_15.426 Chr15 complement(738453..739568) [1116 bp, 371 aa] {ON}
           YOR242C (REAL)
          Length = 371

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 94/231 (40%), Gaps = 26/231 (11%)

Query: 650 KQFATSAEVANSMGGGIGN------RTVYIGNIHPRSKPEDICNVVRGGILQSI------ 697
           K++A     AN    GI N      R+V I +I   +    + + VRGG L+ I      
Sbjct: 139 KRYAMETTFANEKIAGIQNPAFLKTRSVSISDIPRGTGIASVLSQVRGGSLERIIVYRYD 198

Query: 698 ---RFLQDKHICFVTFIEASTAVQFYTNAFIDPIVLHGNMLKVGWGHHSGP---LPKSVS 751
              R L    + F+ +  A + ++ Y N  +  +  +G  LK  W         + K  S
Sbjct: 199 TPERSLHKVDLFFLNYDGAQSFMR-YANTSVFKV--NGVRLKPEWIFLESTYENVIKEQS 255

Query: 752 LAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYSDEYKLPAEEQLRNDFNQFGDIEQIN- 810
           +   V   + +   L       K + +   Q  S   +     +L  DF  FG+I +I  
Sbjct: 256 VNRIVEEEKLISRCLIVKKSSTKTVFNKSNQDRSQNLETINVRELEKDFQNFGEILEITP 315

Query: 811 FLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKSFDNRYRGLIIGYGKD 861
            +S   C  + F +ISSA++ +EE +   G   +  +   ++   I YGKD
Sbjct: 316 IVSRKLCVSIFFYDISSAMRAMEEYE-QKGSGLNNKY---FKTWTIWYGKD 362

>TPHA0D01210 Chr4 complement(253331..254425) [1095 bp, 364 aa] {ON}
           Anc_8.670 YOR242C
          Length = 364

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 40/70 (57%), Gaps = 7/70 (10%)

Query: 794 EQLRNDFNQFGDIEQIN-FLSDGHCCWVNFMNISSAIKLVEEIKYNDGEA-FHKSFDNRY 851
           E++R DF QFG+I  I   +S   C  +++ NI +A+  ++   Y+D  + FHK +   +
Sbjct: 291 EEVRKDFFQFGNIVDITPIVSRKVCLSISYYNIKAAMDAMKA--YDDPYSEFHKKYSEEW 348

Query: 852 RGLIIGYGKD 861
              ++ YGKD
Sbjct: 349 ---VVWYGKD 355

>KAFR0D01660 Chr4 (330013..330651) [639 bp, 212 aa] {ON} Anc_8.797
           YOR319W
          Length = 212

 Score = 35.4 bits (80), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 7/55 (12%)

Query: 669 RTVYIGNIHPRSKPEDICNV-VRGGILQSIRFLQDKHI------CFVTFIEASTA 716
           RTVY+GNI PR   ED+  + V+ G ++ I + +DK +       F+ F+  ST 
Sbjct: 7   RTVYVGNIDPRVNKEDLYELFVQFGRIKKINYPRDKVLDTHQGYAFIEFLNDSTV 61

>TBLA0C01820 Chr3 complement(429227..430411) [1185 bp, 394 aa] {ON}
           Anc_8.670 YOR242C
          Length = 394

 Score = 35.8 bits (81), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 37/67 (55%), Gaps = 5/67 (7%)

Query: 796 LRNDFNQFGDIEQIN-FLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKSFDNRYRGL 854
           L+NDF ++G I  +   +S   C  V+F N++SAI+ ++  +   G   +K +   Y+  
Sbjct: 323 LKNDFKKYGTILDVTPIVSRKLCFAVHFANVASAIRAMQAFELK-GTELNKKY---YKRW 378

Query: 855 IIGYGKD 861
            + YGKD
Sbjct: 379 AMWYGKD 385

>TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7.387
           YBL063W
          Length = 1105

 Score = 36.2 bits (82), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 52/112 (46%), Gaps = 2/112 (1%)

Query: 534 SSLKGSHTITVAVDEYPKPFFAEFSDHLSNASVLEASALDTQISSPHPQEVIVPSQDSPL 593
           S L  +++IT  + ++ K    E SDH S + V +   L+T+ISS H + VI+ S D+ +
Sbjct: 850 SHLLATNSITKELHDFKKAIVIECSDHKSQSLVEKIDELNTRISS-HVEAVILESSDA-I 907

Query: 594 VGGAPPLDAVHPAATPALSSQVLPLQPHMAMNSGIYMEPFGRRNKTMIKPIT 645
              +  + A    A   L + V  L          Y E F +  KT  + I+
Sbjct: 908 SESSNKVSAASGQAKQRLENAVSELDALCEYLMANYKENFNQITKTQDRIIS 959

>Kwal_26.8763 s26 complement(934672..935952) [1281 bp, 426 aa] {ON}
           YOR242C (SSP2) - involved in sporulation [contig 67]
           FULL
          Length = 426

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 7/68 (10%)

Query: 796 LRNDFNQFGDIEQIN-FLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKSFDNRY-RG 853
           LR DF  FG+I +I+  +S   C  V F ++SS+I  +E       E  +   + +Y R 
Sbjct: 353 LRQDFENFGNIVEISPMISRKLCLCVTFYDVSSSIGALESF-----EKPNSYLNKKYGRD 407

Query: 854 LIIGYGKD 861
             I YG+D
Sbjct: 408 WSIAYGRD 415

>YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Component
           of the SPS plasma membrane amino acid sensor system
           (Ssy1p-Ptr3p-Ssy5p), which senses external amino acid
           concentration and transmits intracellular signals that
           result in regulation of expression of amino acid
           permease genes
          Length = 852

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 49/94 (52%), Gaps = 4/94 (4%)

Query: 831 LVEEIKYNDGEAFHKSFDNRYRGLIIGYGKDRCGNVNKNLISGKNSRFYKKVKK--PSYN 888
           ++EE  +ND E +  S  N+   L   Y K +   + ++++S +  + Y++  +   +YN
Sbjct: 56  IIEEQGWNDAELYRSSIQNQRFFLTDKYTKKKHLTM-EDMLSPEEEQIYQEPIQDFQTYN 114

Query: 889 IRLSRMEEERKKHEETLRSQNQNNDEKMLQFGSL 922
            R+ R  E R++ EE  R QN  ND  +L   SL
Sbjct: 115 KRVQREYELRERMEEFFR-QNTKNDLHILNEDSL 147

>Kpol_1013.1 s1013 complement(54..1238) [1185 bp, 394 aa] {ON}
           complement(54..1238) [1185 nt, 395 aa]
          Length = 394

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 39/70 (55%), Gaps = 7/70 (10%)

Query: 794 EQLRNDFNQFGDIEQIN-FLSDGHCCWVNFMNISSAIKLVEEIKYNDGEA-FHKSFDNRY 851
           E+L++DF +FGDI  I   +S   C  +++ +I  A+  +++  Y D  +  H+ +   +
Sbjct: 321 EELKSDFERFGDIFDITPIVSRKLCVSISYNHILGAMTAMDD--YEDSHSLLHQKY---F 375

Query: 852 RGLIIGYGKD 861
           R   I YGKD
Sbjct: 376 RTWAIWYGKD 385

>NCAS0B00950 Chr2 (150330..150989) [660 bp, 219 aa] {ON} Anc_8.797
          Length = 219

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 69/169 (40%), Gaps = 35/169 (20%)

Query: 670 TVYIGNIHPRSKPEDICNV-VRGGILQSIRFLQDKHICF---VTFIEASTA--VQFYTNA 723
           TVY+GNI P+   E +  + ++   +  +R+ +DK +       FIE  TA  VQ+    
Sbjct: 11  TVYVGNIDPKVTKEQLYELFIQVSPISKLRYPKDKILQMHQGYAFIEFYTAKDVQYVIQV 70

Query: 724 FIDPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAF----KDKYINDP 779
             + + L+   LKV     S   P S         + N  + LP         D+ I +P
Sbjct: 71  MNNTVALYDRFLKV---RQSVQNPTSSMGGANTSENSNQSIVLPIAKLFVKNLDESIENP 127

Query: 780 Q----YQRYSDEYKLPAEEQLRNDFNQFGDIEQINFLSDG--HCCWVNF 822
           Q    +Q++   +K P                +I FLS+G   C ++ F
Sbjct: 128 QLIKLFQKFGPLFKDP----------------EIFFLSNGKLRCAYIYF 160

>Kpol_543.17 s543 (37962..39248) [1287 bp, 428 aa] {ON}
           (37962..39248) [1287 nt, 429 aa]
          Length = 428

 Score = 33.9 bits (76), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 34/75 (45%), Gaps = 9/75 (12%)

Query: 842 AFHKSFDNRYRGLIIGYGKDRCGNVNKNLISGKNSRFYKKVKKPSYNIRLSRMEEERKKH 901
           A  K     Y  L+   G+ + GN    LISG NS  Y K+KK      L  ++EE  K 
Sbjct: 14  AEEKPLMKSYGSLLAQLGQQQSGN---GLISGNNSDVYLKLKKLEKEYELLTLQEEYIKD 70

Query: 902 E------ETLRSQNQ 910
           E      E LR+Q +
Sbjct: 71  EQRHLKRELLRAQEE 85

>KLLA0F11275g Chr6 (1038770..1039927) [1158 bp, 385 aa] {ON} weakly
           similar to uniprot|Q96US5 Saccharomyces cerevisiae
           YOR242C SSP2 Sporulation SPecific involved in
           sporulation
          Length = 385

 Score = 33.9 bits (76), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 39/73 (53%), Gaps = 13/73 (17%)

Query: 794 EQLRNDFNQFGDIEQIN-FLSDGHCCWVNFMNISSAIKLVEEIK----YNDGEAFHKSFD 848
           +Q+ +DFNQFG + +++  +S   C  ++F +I SAI+ +   +    Y +G+ F     
Sbjct: 312 QQIIDDFNQFGQVLEVSPLISRKICLQISFHDIRSAIEAMRSYETSNSYINGKYF----- 366

Query: 849 NRYRGLIIGYGKD 861
              +   I YGKD
Sbjct: 367 ---KDWSIWYGKD 376

>KAFR0D02600 Chr4 complement(514523..515369,515443..515462) [867 bp,
           288 aa] {ON} Anc_3.379 YBR119W
          Length = 288

 Score = 32.7 bits (73), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 668 NRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTF--IEASTAVQ 718
           N+ + + N+    K ED+ N+ +   L  +R +  +H+ FV +  +E S+A++
Sbjct: 216 NKVLLVQNLPANVKQEDVINLFQNAGLVEVRLVSPRHLAFVEYKTVEDSSAIK 268

>Kpol_1069.8 s1069 (14170..15519) [1350 bp, 449 aa] {ON}
           (14170..15519) [1350 nt, 450 aa]
          Length = 449

 Score = 33.1 bits (74), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 79/181 (43%), Gaps = 37/181 (20%)

Query: 666 IGNRTVYIGNIHPRSKPEDICNV-VRGGILQ------SIRFLQDKHICFVTFIEASTAVQ 718
           + N T+++ N  P  +  D+ N+ V+  +L       S+R+  ++   +V  I    A +
Sbjct: 106 LENCTIWLTNFPPNYRILDLRNIFVQNNVLPLSIRLPSLRYNSNRRFAYVDVISPDIANE 165

Query: 719 FYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYIND 778
                +++ +V+ G   KV     S PL KS      +   R +Y++  D          
Sbjct: 166 MVN--YLNEMVIDG--FKV-VAKLSNPLEKSDRSDAALLEHREIYITNLD---------- 210

Query: 779 PQYQRYSDEYKLPAEEQLRNDFNQFGDIEQINFLSDGH------CCWVNFMNISSAIKLV 832
                 SD+     E++L   F++FGDIE+I  + + +        +++F +  SA K +
Sbjct: 211 ------SDQI---TEQKLSEWFSKFGDIERIKLVKNENEPGNTSYAFISFTSSDSATKAL 261

Query: 833 E 833
           E
Sbjct: 262 E 262

>Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W
           (REAL)
          Length = 851

 Score = 33.1 bits (74), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 45/89 (50%), Gaps = 4/89 (4%)

Query: 831 LVEEIKYNDGEAFHKSFDNRYRGLIIGYGKDRCGNVNKNLISGKNSRFYKKVKK--PSYN 888
           ++EE  +ND   +  S  N+   L+  Y K +   + +++I  +  R Y++  +   +YN
Sbjct: 56  IIEEQGWNDAGLYRSSIQNQRFFLMDKYTKKKHITM-QDMICSEEERIYQEPIQDFETYN 114

Query: 889 IRLSRMEEERKKHEETLRSQNQNNDEKML 917
            R+ R  E R++ EE  R QN  N   +L
Sbjct: 115 RRVQREYELRERMEEFFR-QNTKNGLHIL 142

>TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa] {ON}
           Anc_7.157 YIR004W
          Length = 470

 Score = 32.7 bits (73), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 28/41 (68%), Gaps = 4/41 (9%)

Query: 773 DKYINDP----QYQRYSDEYKLPAEEQLRNDFNQFGDIEQI 809
           DK  NDP    ++Q+ S+ Y++ ++E LRN+++QFG  + I
Sbjct: 36  DKNPNDPTATERFQQISEAYQVLSDEHLRNNYDQFGKEQAI 76

>Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}
           (4910..5845,5849..7711) [2799 nt, 933 aa]
          Length = 932

 Score = 32.7 bits (73), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 3/69 (4%)

Query: 218 TYRMLPKGDDE--YRTRSLLFENVNGSVDLYSFVSKYSRYGPVESIYMFKDRNDKTKHSV 275
           T RML   +DE  Y   +L+  ++ GS+DL+ F+ K  +   VE   +FK      KH  
Sbjct: 738 TLRMLDFFEDENFYYIETLV-HSMKGSIDLFDFIEKKDKIDEVEQKLIFKQIVAGIKHIH 796

Query: 276 LLSFLSRKI 284
            L  + R I
Sbjct: 797 GLGIIHRDI 805

>Suva_14.340 Chr14 complement(596181..598220) [2040 bp, 679 aa] {ON}
           YNL008C (REAL)
          Length = 679

 Score = 32.3 bits (72), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 34/53 (64%), Gaps = 2/53 (3%)

Query: 321 VDENEVDQNDNSSSTPMNETDD-TDASKTPVATSNVQDDAYNVTVVASLQYDI 372
           V + E D ND+ S   M E ++ T  S +PV + N++D A+N+++ + L+Y++
Sbjct: 502 VSDEEFD-NDSESQLIMEEKEELTRLSTSPVDSDNIRDLAWNLSMWSILKYEM 553

>Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W
           (REAL)
          Length = 852

 Score = 32.3 bits (72), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 43/84 (51%), Gaps = 3/84 (3%)

Query: 831 LVEEIKYNDGEAFHKSFDNRYRGLIIGYGKDRCGNVNKNLISGKNSRFYKKVKK--PSYN 888
           ++EE  +ND E +  S  N+   L   Y K +   + +++I+ +  + Y++  +   +YN
Sbjct: 56  IIEEQGWNDAEFYRSSIQNQRFFLTDKYAKKKHLTI-EDMITSEEEQIYQEPIQDFQTYN 114

Query: 889 IRLSRMEEERKKHEETLRSQNQNN 912
            R+ R  E R++ E+      +NN
Sbjct: 115 KRVQREYELRERMEQFFLQNTKNN 138

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 128,213,535
Number of extensions: 5734247
Number of successful extensions: 28607
Number of sequences better than 10.0: 201
Number of HSP's gapped: 29282
Number of HSP's successfully gapped: 280
Length of query: 1259
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1138
Effective length of database: 39,606,813
Effective search space: 45072553194
Effective search space used: 45072553194
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 72 (32.3 bits)