Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0G14234g8.842ON50950924810.0
TDEL0B005608.842ON50949618000.0
NCAS0B003008.842ON52340717980.0
Suva_13.288.842ON53048017970.0
YML115C (VAN1)8.842ON53549017910.0
KNAG0G034208.842ON51148517720.0
KAFR0A028308.842ON50747917590.0
Smik_13.198.842ON53639817610.0
Skud_13.268.842ON53939917350.0
NDAI0E002908.842ON52240617090.0
SAKL0D01430g8.842ON44740616900.0
Kpol_541.158.842ON49848916870.0
KLTH0C03828g8.842ON40440516650.0
TBLA0B032708.842ON52049916230.0
KLLA0D01529g8.842ON50140516030.0
Ecym_46138.842ON52449415680.0
CAGL0B02321g8.842ON51240115530.0
ABL124W8.842ON48540515010.0
TPHA0C047808.842ON52549014970.0
Kwal_27.102468.842ON33934014340.0
Ecym_35731.479ON4473659881e-129
AFR357W1.479ON4343669861e-129
KLTH0C03432g1.479ON4893669831e-128
SAKL0D11792g1.479ON4833659731e-126
Kwal_27.101571.479ON4763659691e-126
KNAG0I003001.479ON4573679671e-126
TBLA0B021701.479ON5723659691e-125
YEL036C (ANP1)1.479ON5003599631e-125
Smik_5.571.479ON4913569571e-124
NCAS0G041101.479ON4943659571e-124
Skud_5.541.479ON4913569551e-123
KAFR0I027701.479ON4553649511e-123
Suva_5.331.479ON4953569541e-123
KLLA0E22155g1.479ON4503939491e-123
NDAI0G003401.479ON5043569541e-123
CAGL0L01331g1.479ON4473659481e-123
Kpol_370.51.479ON6453569561e-122
NDAI0B012501.479ON4463669351e-121
TPHA0O004301.479ON5483589401e-120
TDEL0C026001.479ON4623659301e-120
ZYRO0F05170g1.479ON6083589171e-116
NCAS0C023308.500ON3933524951e-56
KLLA0E12849g8.500ON3923524899e-56
TBLA0H033408.500ON3933554837e-55
KNAG0A021508.500ON3963524838e-55
NDAI0E030208.500ON3963524811e-54
TPHA0L013708.500ON3923524767e-54
Smik_16.1868.500ON3953524751e-53
ZYRO0F08492g8.500ON3963634751e-53
Suva_16.2658.500ON3953524741e-53
KAFR0H013908.500ON3983524699e-53
SAKL0H11110g8.500ON3933524681e-52
KLTH0E11616g8.500ON3943734662e-52
Skud_16.2328.500ON3953524654e-52
Kwal_27.118648.500ON4533494684e-52
Kpol_1031.788.500ON3923634644e-52
CAGL0L12804g8.500ON3933554636e-52
YPL050C (MNN9)8.500ON3953524628e-52
AGL259C8.500ON3893484601e-51
TDEL0B013708.500ON3963664498e-50
Ecym_25508.500ON3903514382e-48
NCAS0B024408.500ON4003574225e-46
NDAI0C052508.500ON4023513822e-40
KNAG0A039908.500ON3571752323e-20
SAKL0H20438gsingletonON5652101697e-12
YCR019W (MAK32)1.440ON363135770.64
ZYRO0G12540g3.295ON95063714.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0G14234g
         (509 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} simi...   960   0.0  
TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {O...   697   0.0  
NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,...   697   0.0  
Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}...   696   0.0  
YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}  V...   694   0.0  
KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.8...   687   0.0  
KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.8...   682   0.0  
Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}...   682   0.0  
Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}...   672   0.0  
NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,...   662   0.0  
SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {...   655   0.0  
Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON} (41403..4...   654   0.0  
KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {...   645   0.0  
TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.8...   629   0.0  
KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {...   622   0.0  
Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar...   608   0.0  
CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} simila...   602   0.0  
ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic ho...   582   0.0  
TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON} Anc_1...   581   0.0  
Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {...   556   0.0  
Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {O...   385   e-129
AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic ...   384   e-129
KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {...   383   e-128
SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} simila...   379   e-126
Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {...   377   e-126
KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}...   377   e-126
TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {O...   377   e-125
YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}  AN...   375   e-125
Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON} Y...   373   e-124
NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479    373   e-124
Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON} Y...   372   e-123
KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.4...   370   e-123
Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON} Y...   372   e-123
KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]...   370   e-123
NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}...   372   e-123
CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa] ...   369   e-123
Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)...   372   e-122
NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {O...   364   e-121
TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.47...   366   e-120
TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {O...   362   e-120
ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} simila...   357   e-116
NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {O...   195   1e-56
KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]...   192   9e-56
TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.5...   190   7e-55
KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {O...   190   8e-55
NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {O...   189   1e-54
TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8....   187   7e-54
Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {...   187   1e-53
ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly...   187   1e-53
Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {...   187   1e-53
KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {O...   185   9e-53
SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {...   184   1e-52
KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} high...   184   2e-52
Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {...   183   4e-52
Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050...   184   4e-52
Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON} (1970...   183   4e-52
CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} hig...   182   6e-52
YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON} ...   182   8e-52
AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON} S...   181   1e-51
TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {O...   177   8e-50
Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar...   173   2e-48
NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {O...   167   5e-46
NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON} Anc_8...   151   2e-40
KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {O...    94   3e-20
SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, ...    70   7e-12
YCR019W Chr3 (152837..153928) [1092 bp, 363 aa] {ON}  MAK32Prote...    34   0.64 
ZYRO0G12540g Chr7 (989838..992690) [2853 bp, 950 aa] {ON} simila...    32   4.4  

>ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115C VAN1
           Mannosyltransferase with a role in protein N-
           glycosylation
          Length = 509

 Score =  960 bits (2481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/509 (92%), Positives = 469/509 (92%)

Query: 1   MAAFWSXXXXXXXXXXXXXGYKLPTSHSKLSPKGKRSSWQNRKIVSWVIITVMVLILYKA 60
           MAAFWS             GYKLPTSHSKLSPKGKRSSWQNRKIVSWVIITVMVLILYKA
Sbjct: 1   MAAFWSLKKKLKKADDDDDGYKLPTSHSKLSPKGKRSSWQNRKIVSWVIITVMVLILYKA 60

Query: 61  FSGVVRGGREVMKTVGSNTSSNDGQVLXXXXXXXXXXXXXXPKVIEKFDGGVQHYLITQF 120
           FSGVVRGGREVMKTVGSNTSSNDGQVL              PKVIEKFDGGVQHYLITQF
Sbjct: 61  FSGVVRGGREVMKTVGSNTSSNDGQVLEEDAYYDYDFEDIDPKVIEKFDGGVQHYLITQF 120

Query: 121 GNDVLTPQDGEVFEREQKMLLSSTVESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLP 180
           GNDVLTPQDGEVFEREQKMLLSSTVESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLP
Sbjct: 121 GNDVLTPQDGEVFEREQKMLLSSTVESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLP 180

Query: 181 LMFKHLMNLTYPHELIDLAFLVSDCTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXX 240
           LMFKHLMNLTYPHELIDLAFLVSDCTEDDKTLDALIAYSRQLQSGTLSQVF         
Sbjct: 181 LMFKHLMNLTYPHELIDLAFLVSDCTEDDKTLDALIAYSRQLQSGTLSQVFADMDQAAAE 240

Query: 241 XXXXSKGTEKLYLKYMNPDYLETVKESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSD 300
               SKGTEKLYLKYMNPDYLETVKESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSD
Sbjct: 241 AEQASKGTEKLYLKYMNPDYLETVKESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSD 300

Query: 301 RHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAV 360
           RHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAV
Sbjct: 301 RHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAV 360

Query: 361 PNVWRPLPQFLDGEQPYDLNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRD 420
           PNVWRPLPQFLDGEQPYDLNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRD
Sbjct: 361 PNVWRPLPQFLDGEQPYDLNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRD 420

Query: 421 PTQDPNEILDLDGVGGVSILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGL 480
           PTQDPNEILDLDGVGGVSILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGL
Sbjct: 421 PTQDPNEILDLDGVGGVSILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGL 480

Query: 481 PHYTLWHIYEPSDDDLREIANKERESRRE 509
           PHYTLWHIYEPSDDDLREIANKERESRRE
Sbjct: 481 PHYTLWHIYEPSDDDLREIANKERESRRE 509

>TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {ON}
           Anc_8.842 YML115C
          Length = 509

 Score =  697 bits (1800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/496 (69%), Positives = 390/496 (78%), Gaps = 9/496 (1%)

Query: 20  GYKLPTSHSKLSPKGKRSS--WQN---RKIVSWVIITVMVLILYKAFSGVVRGGREVMKT 74
            Y+LP S SKL+PK K +S  W     ++I +W +I+V+  +++K  S V+ G  E    
Sbjct: 17  NYRLPVSRSKLNPKTKSASFTWNGSRVKRIANWALISVICFLMFKFLSTVILGSSESSSP 76

Query: 75  VGSN-TSSNDGQVLXXXXXXXXXXXXXXPKVIEKFDGGVQHYLITQFGNDVLTPQDGEVF 133
           + S  T S D   L              P VI+KFD GV +Y ITQFG + +T ++   F
Sbjct: 77  LPSIWTKSYDTITLSDEAYYDYDFENIDPDVIKKFDNGVTYYKITQFGEETMTSEETTKF 136

Query: 134 EREQKMLLSSTVESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPH 193
           E+E  MLL STVE YD+  FRG+ N A N EHVLLCVPLRDAE VLPLMFKHLMN+TYPH
Sbjct: 137 EQEVSMLLDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPH 196

Query: 194 ELIDLAFLVSDCTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYL 253
           ELIDLAFLVSDC+E D TLDALIAYSRQLQ+GTLSQVF              KG E LYL
Sbjct: 197 ELIDLAFLVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKER---KKGGENLYL 253

Query: 254 KYMNPDYLETVKESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKL 313
           +YM+ DYL+ VK+SFSPPFHENYDK FRSVQ+FQKDFGQ IGQGFSDRHAVKVQG+RRKL
Sbjct: 254 QYMDQDYLQRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKL 313

Query: 314 MGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDG 373
           M RARNWLTANALKPYHSWVYWRDADVELCPGSVI+DLM+KDYDV VPNVWRPLP FLDG
Sbjct: 314 MARARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDG 373

Query: 374 EQPYDLNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDG 433
           +QPYDLNSW+ES EAL+LAKTLDEDDVIVEGYAEYPT+R HLAY RD   DPNE+++LDG
Sbjct: 374 QQPYDLNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDG 433

Query: 434 VGGVSILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSD 493
           VGGVSILA+A LFR GI FPAFTFENHAETE FGKMAKKMG+RVGGLPHYTLWHIYEPSD
Sbjct: 434 VGGVSILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSD 493

Query: 494 DDLREIANKERESRRE 509
           DDL+EI NKERE RRE
Sbjct: 494 DDLKEIGNKEREKRRE 509

>NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,
           523 aa] {ON} Anc_8.842
          Length = 523

 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/407 (78%), Positives = 359/407 (88%)

Query: 102 PKVIEKFDGGVQHYLITQFGNDVLTPQDGEVFEREQKMLLSSTVESYDLSMFRGSANGAA 161
           P V++KFD GVQHYLI+Q+G DVLTP D EV+ +E +M+L ++VE YDLS F GS+NGA 
Sbjct: 116 PAVVKKFDNGVQHYLISQYGTDVLTPSDNEVYAKELQMVLDASVEKYDLSTFTGSSNGAT 175

Query: 162 NGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSDCTEDDKTLDALIAYSRQ 221
           N +H+LLCVPLRDAE VLPLMFKHLMNLTYPHELIDLAFLVSDC+E D+TLDAL+AYS+ 
Sbjct: 176 NRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDRTLDALLAYSKH 235

Query: 222 LQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETVKESFSPPFHENYDKPFR 281
           LQ+GTLSQVF             SKGT+ L+LKYMNPDYL+ V  SF    H NYDKPFR
Sbjct: 236 LQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKLVDTSFKKRKHSNYDKPFR 295

Query: 282 SVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVE 341
           S+QVFQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWL ANALKPYH+WVYWRDAD+E
Sbjct: 296 SIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHAWVYWRDADIE 355

Query: 342 LCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWMESGEALNLAKTLDEDDVI 401
           LCPGSVIEDLMSKDYDV VPNVWRPLP+FLDGEQPYDLNSW+ES EAL LAKTLDEDDVI
Sbjct: 356 LCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWIESDEALKLAKTLDEDDVI 415

Query: 402 VEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAELFRRGIQFPAFTFENHA 461
           VEGYAEYPT+RVHLAYIRD   DPNE++DLDGVGGVSILAKA++FR G+QFPAFTFENHA
Sbjct: 416 VEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKAKIFRSGVQFPAFTFENHA 475

Query: 462 ETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIANKERESRR 508
           ETE FGKMA+KMG+RVGGLPHYT+WHIYEPSDDDL EIANKER+++R
Sbjct: 476 ETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANKERQNKR 522

>Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}
           YML115C (REAL)
          Length = 530

 Score =  696 bits (1797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/480 (70%), Positives = 384/480 (80%), Gaps = 5/480 (1%)

Query: 32  PKGKRSSWQ-NRKIVSWVIITVMVLILYKAFSGVVRGGREVMKTVGSNTSSNDGQV-LXX 89
           P+   S +Q    ++S VII V+ L L   F   ++ G  +        S N   + L  
Sbjct: 53  PRSSSSKFQLAVNVISLVIIIVLSLYLMILFLSEMKLGISIQNGNPLLGSENYKTIDLED 112

Query: 90  XXXXXXXXXXXXPKVIEKFDGGVQHYLITQFGNDVLTPQDGEVFEREQKMLLSSTVESYD 149
                       P+V+ KFD GVQHYLITQFG++VLTP D E ++ E  MLL STVE YD
Sbjct: 113 EEYYNYDFEDIDPEVVSKFDDGVQHYLITQFGSEVLTPGDNEKYQEEMSMLLDSTVEKYD 172

Query: 150 LSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSDCTEDD 209
           L+ F G+ NG    +H+LLC+PLR+A  VLPLMFKHLMNLTYPHELIDLAFLVSDC+E D
Sbjct: 173 LTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGD 232

Query: 210 KTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETVKESFS 269
            TLDALIAYSRQLQ+GTLS++F             +KGT+KLYLKYM+ DY+  V ++FS
Sbjct: 233 TTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQ---TKGTDKLYLKYMDEDYINRVHQAFS 289

Query: 270 PPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPY 329
           PPFH+NYDKPFRSVQVFQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPY
Sbjct: 290 PPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPY 349

Query: 330 HSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWMESGEAL 389
           HSWVYWRDADVELCPGSVI+DLMSK+YDV VPNVWRPLP FL+ EQPYDLNSWMESGEAL
Sbjct: 350 HSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGEAL 409

Query: 390 NLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAELFRRG 449
           +LAKTLDEDDVIVEGYAEYPT+RVHLAYIRD   DPNE++DLDGVGGVSILAKA++FR G
Sbjct: 410 DLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFRNG 469

Query: 450 IQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIANKERESRRE 509
           +QFPAFTFENHAETE FGKMAKKMGYRVGGLPHYT+WHIYEPSDDDL+EIA +ERE RR+
Sbjct: 470 VQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRRQ 529

>YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}
           VAN1Component of the mannan polymerase I, which contains
           Van1p and Mnn9p and is involved in the first steps of
           mannan synthesis; mutants are vanadate-resistant
          Length = 535

 Score =  694 bits (1791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/490 (69%), Positives = 390/490 (79%), Gaps = 15/490 (3%)

Query: 29  KLSPKGKRSSWQ-NRKIVSWVIITVMVLILYKAF-SGV-----VRGGREVMKTVGSNTSS 81
           +  P+   S +Q    I S +II V+ L L+ +F SG+      + GR ++   GS+ SS
Sbjct: 50  RYQPRSTPSKFQLTVSITSLIIIAVLSLYLFISFLSGMGIGVSTQNGRSLL---GSSKSS 106

Query: 82  NDGQV--LXXXXXXXXXXXXXXPKVIEKFDGGVQHYLITQFGNDVLTPQDGEVFEREQKM 139
            + +   L              P+VI KFD GVQHYLI+QFG++VLTP+D E ++RE  M
Sbjct: 107 ENYKTIDLEDEEYYDYDFEDIDPEVISKFDDGVQHYLISQFGSEVLTPKDDEKYQRELNM 166

Query: 140 LLSSTVESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLA 199
           L  STVE YDLS F G+ NG    +H+LLC+PLR+A  VLPLMFKHLMNLTYPHELIDLA
Sbjct: 167 LFDSTVEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLA 226

Query: 200 FLVSDCTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPD 259
           FLVSDC+E D TLDALIAYSR LQ+GTLSQ+F             +KGT+KLYLKYM+  
Sbjct: 227 FLVSDCSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQ---TKGTDKLYLKYMDEG 283

Query: 260 YLETVKESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARN 319
           Y+  V ++FSPPFHENYDKPFRSVQ+FQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARN
Sbjct: 284 YINRVHQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARN 343

Query: 320 WLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDL 379
           WLTANALKPYHSWVYWRDADVELCPGSVI+DLMSK+YDV VPNVWRPLP FL  EQPYDL
Sbjct: 344 WLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDL 403

Query: 380 NSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSI 439
           NSWMES EAL LAKTLDEDDVIVEGYAEYPT+RVHLAYIRD   DPNE +DLDGVGGVSI
Sbjct: 404 NSWMESQEALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSI 463

Query: 440 LAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREI 499
           LAKA++FR G+QFPAFTFENHAETE FGKMAKKMGYRVGGLPHYT+WHIYEPSDDDL+EI
Sbjct: 464 LAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEI 523

Query: 500 ANKERESRRE 509
           A++ERE RR+
Sbjct: 524 ASREREKRRQ 533

>KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.842
           YML115C
          Length = 511

 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/485 (67%), Positives = 385/485 (79%), Gaps = 5/485 (1%)

Query: 28  SKLSPKGKRSSWQNRKIVSWVIITVMVLILYKAFSGVVRGGREVMKTVGSNTSSNDGQV- 86
           +K  PK KR +      +  +++ V V  +  + S  +RG   + K +    S N     
Sbjct: 29  AKFVPKRKRQTLLRLISLLGLVVFVAVSTV--SLSRYLRGPASINKILKKLESGNHNYKT 86

Query: 87  --LXXXXXXXXXXXXXXPKVIEKFDGGVQHYLITQFGNDVLTPQDGEVFEREQKMLLSST 144
             L              P VI KFD GVQHYLI++FGNDVLTP+D E +E E K L  ST
Sbjct: 87  VNLQENEYYNYDFETLDPHVIGKFDQGVQHYLISEFGNDVLTPKDQERYEAEVKQLFDST 146

Query: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204
           V+ YDL+ F GS +G  N +HVL+CVPLRDAE+VLPLMFKHLMNLTYPHELID+AFLVSD
Sbjct: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206

Query: 205 CTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETV 264
           C++DD TL+ALIAYSRQLQ+GTLSQ+F              +   KLYLKYM  +YL  V
Sbjct: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266

Query: 265 KESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 324
           +++F+PP+HENYDKPFRSVQ+F+K+FGQ+IGQGFSDRHAVKVQGIRRKLMGR+RNWLTAN
Sbjct: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326

Query: 325 ALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWME 384
           ALKPYHSWVYWRDAD+ELCPGSVI+D+M+KDYDV VPNVWRPLP+FL+GEQPYDLNSWME
Sbjct: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNSWME 386

Query: 385 SGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAE 444
           S EAL LA+TLDEDDVIVEGYAEYPT+RVHLAYIRD   DP+E++DLDGVGGVSILA+A+
Sbjct: 387 SPEALELAETLDEDDVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILARAK 446

Query: 445 LFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIANKER 504
           LFR G+QFPAFTFENHAETE FGKMA+K+G+RVGGLPHYTLWHIYEPSDDDLREIANKER
Sbjct: 447 LFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIANKER 506

Query: 505 ESRRE 509
           E RRE
Sbjct: 507 EKRRE 511

>KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.842
           YML115C
          Length = 507

 Score =  682 bits (1759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/479 (67%), Positives = 377/479 (78%), Gaps = 8/479 (1%)

Query: 30  LSPKGKRSSWQNRKIVSWVIITVMVLILYKAFSGVVRGGREVMKTVGSNTSSNDGQVLXX 89
            +PK ++      KI+    ++ ++L L   F        + +  +   T +     L  
Sbjct: 37  FTPKNRKRRLNYAKIIFGFFVSFLILFLMLNFEFNASKLNKTIIDIAQKTIN-----LSD 91

Query: 90  XXXXXXXXXXXXPKVIEKFDGGVQHYLITQFGNDVLTPQDGEVFEREQKMLLSSTVESYD 149
                       P VI+KFD G QHYLI+QFG DVLTP+D E++ERE  ML  ST+E+YD
Sbjct: 92  QEYYNFDFEDIDPTVIQKFDQGAQHYLISQFGTDVLTPEDQEIYEREMNMLYDSTIETYD 151

Query: 150 LSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSDCTEDD 209
           L  F G+ NGA N +HVLLC+PLRDA  VLPLMF+HLMNLTYPHELIDLAFLVSDC+E+D
Sbjct: 152 LQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSDCSEND 211

Query: 210 KTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETVKESFS 269
            TLDALI +S+ LQ+GTLSQV              +     L+LKYM+P+YL+ V+++FS
Sbjct: 212 NTLDALIEFSKNLQNGTLSQVLNEIDAFTKEE---TSTKSNLHLKYMDPEYLKRVQKAFS 268

Query: 270 PPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPY 329
           PPFHE+YDKPFRSVQ+F+K+FGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPY
Sbjct: 269 PPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPY 328

Query: 330 HSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWMESGEAL 389
           HSWVYWRDAD+ELCPGSVIEDLM+KDYDV VPNVWRPLP FL GEQPYDLNSW ES EAL
Sbjct: 329 HSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESAEAL 388

Query: 390 NLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAELFRRG 449
            LA+TLDEDDVIVEGYAEYPT+RVHLAYIRDP  +P+E++D+DGVGGVSILAKA+LFR G
Sbjct: 389 KLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPDEVVDIDGVGGVSILAKAKLFRSG 448

Query: 450 IQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIANKERESRR 508
           +QFPAFTFENHAETE FGKMAKKMGY+VGGLPHYTLWHIYEPSDDDL+E+ANKERE RR
Sbjct: 449 VQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMANKEREERR 507

>Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}
           YML115C (REAL)
          Length = 536

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/398 (79%), Positives = 353/398 (88%), Gaps = 3/398 (0%)

Query: 102 PKVIEKFDGGVQHYLITQFGNDVLTPQDGEVFEREQKMLLSSTVESYDLSMFRGSANGAA 161
           P+V+ KFD GV+HYLI+QFG+DVLTP+D E ++ E  MLL STVE YDLS F G++NG  
Sbjct: 129 PEVVSKFDNGVEHYLISQFGSDVLTPKDDEKYQSELSMLLDSTVEKYDLSRFEGASNGVE 188

Query: 162 NGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSDCTEDDKTLDALIAYSRQ 221
             +H+LLCVPLR+A  VLPLMFKHLMNLTYPHELIDLAFLVSDC+EDD TLDALIAYSRQ
Sbjct: 189 TRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDTTLDALIAYSRQ 248

Query: 222 LQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETVKESFSPPFHENYDKPFR 281
           LQ+GTLSQ+F             +KGT+KLYL+YM+ +Y+  V+++FSPPFHENYDKPFR
Sbjct: 249 LQNGTLSQIFQEIDAVIDSQ---TKGTDKLYLQYMDQNYINRVRQAFSPPFHENYDKPFR 305

Query: 282 SVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVE 341
           SVQ+FQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVE
Sbjct: 306 SVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVE 365

Query: 342 LCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWMESGEALNLAKTLDEDDVI 401
           LCPGS+I+DLMSK+YDV VPNVWRPLP FL+ EQPYDLNSWMES E L LAKTLDEDDVI
Sbjct: 366 LCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKEGLELAKTLDEDDVI 425

Query: 402 VEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAELFRRGIQFPAFTFENHA 461
           VEGYAEYPT+RVHLAYIRD   DPNE++DLDGVGGVSILAKA+LFR G+QFPAFTFENHA
Sbjct: 426 VEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFRNGVQFPAFTFENHA 485

Query: 462 ETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREI 499
           ETE FGKMAKKMGYRVGGLPHYT+WHIYEPSDDDL+EI
Sbjct: 486 ETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEI 523

>Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}
           YML115C (REAL)
          Length = 539

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/399 (78%), Positives = 351/399 (87%), Gaps = 3/399 (0%)

Query: 102 PKVIEKFDGGVQHYLITQFGNDVLTPQDGEVFEREQKMLLSSTVESYDLSMFRGSANGAA 161
           P+VI KFDGG QHYLI+QFG++VL P++ E +++E  MLL STVE YDLS F G+ NG  
Sbjct: 129 PEVISKFDGGEQHYLISQFGSEVLPPENEEEYQKELNMLLDSTVEKYDLSDFEGAPNGLE 188

Query: 162 NGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSDCTEDDKTLDALIAYSRQ 221
             +H+LLC+PLR+A  VLPLMFKHLMNLTYPHELIDLAFLVSDC+E D TLDALIAYSRQ
Sbjct: 189 TRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQ 248

Query: 222 LQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETVKESFSPPFHENYDKPFR 281
           LQ+GTLSQ+F             +KGT+KLYLKYM+ DY+  V ++FSPPFH+NYDKPFR
Sbjct: 249 LQNGTLSQIFQDIDAIIDSQ---TKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFR 305

Query: 282 SVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVE 341
           SVQ+FQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVE
Sbjct: 306 SVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVE 365

Query: 342 LCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWMESGEALNLAKTLDEDDVI 401
           LCPGSVIEDLMSK+YDV VPNVWRPLP FL+ EQ YDLNSWMES EAL LAKTLDEDDVI
Sbjct: 366 LCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESREALELAKTLDEDDVI 425

Query: 402 VEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAELFRRGIQFPAFTFENHA 461
           VEGYAEYPT+RVHLAYIRD   +PNE++DLDGVGGVSILAKA++FR G+QFPAFTFENHA
Sbjct: 426 VEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHA 485

Query: 462 ETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIA 500
           ETE FGKMAKKMGYRVGGLPHYT+WHIYEPSDDDL+EIA
Sbjct: 486 ETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA 524

>NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,
           522 aa] {ON} Anc_8.842
          Length = 522

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/406 (74%), Positives = 352/406 (86%)

Query: 104 VIEKFDGGVQHYLITQFGNDVLTPQDGEVFEREQKMLLSSTVESYDLSMFRGSANGAANG 163
           V+ KF+ GVQHYLI++FG DVLTP+D E +E+E  MLL ++VE YDL  F GS NGA N 
Sbjct: 116 VLGKFENGVQHYLISEFGTDVLTPKDKEQYEKELAMLLDASVEKYDLKKFDGSRNGAENR 175

Query: 164 EHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSDCTEDDKTLDALIAYSRQLQ 223
           +H+LLCVPLRDAE VLPLMFKHLMN+TYPHELIDLAFLVSDC++ D TL+AL+ YSR LQ
Sbjct: 176 DHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVSDCSDGDNTLEALLQYSRHLQ 235

Query: 224 SGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETVKESFSPPFHENYDKPFRSV 283
           +GTLSQVF             ++GT+ L+LKYMN +YL+ V+ +F+ P HENYDKPFRSV
Sbjct: 236 NGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKMVETAFNTPPHENYDKPFRSV 295

Query: 284 QVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELC 343
           Q+F+KDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWL ANALKPYHSWVYWRDAD+ELC
Sbjct: 296 QIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHSWVYWRDADIELC 355

Query: 344 PGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWMESGEALNLAKTLDEDDVIVE 403
           PG+++ED+M+ DYDV VPNVWRPLP+FLD EQPYDLNSW+ES EAL LAKTL EDDVIVE
Sbjct: 356 PGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWIESDEALKLAKTLPEDDVIVE 415

Query: 404 GYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAELFRRGIQFPAFTFENHAET 463
           GYAEYPT+RVHLAYIR+   DP  ++DLDGVGGVSILAKA+LFR G+ FPAFTFENHAET
Sbjct: 416 GYAEYPTWRVHLAYIREAQGDPTSVVDLDGVGGVSILAKAKLFRSGVHFPAFTFENHAET 475

Query: 464 EGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIANKERESRRE 509
           EGFGKMAK+MGYRVGGLPHYT+WHIYEPSDDDL+EIANKER+SR +
Sbjct: 476 EGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIANKERQSRHK 521

>SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 447

 Score =  655 bits (1690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/406 (76%), Positives = 350/406 (86%), Gaps = 2/406 (0%)

Query: 104 VIEKFDGGVQHYLITQFGNDVLTPQDGEVFEREQKMLLSSTVESYDLSMFRGSANGAANG 163
           +I+K+D G +H+LI+Q G +VLTP+D E +E+E +MLL +TV+ YDLS + GS NGA N 
Sbjct: 44  IIQKYDKGAEHFLISQGGAEVLTPEDNERYEKEVEMLLGATVDVYDLSKYEGSENGAENR 103

Query: 164 EHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSDCTEDDKTLDALIAYSRQLQ 223
           +HVLLCVPLR+A  VLPLMFKHLMNLTYPHELIDLAFLVSDC+EDD TLDALIAYS++LQ
Sbjct: 104 DHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDDTLDALIAYSKELQ 163

Query: 224 SGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETVKESFSPPFHENYDKPFRSV 283
           +GTLS++F              KG+  LYLKYMN DYL  V+ +F PPFH++YDKPFRSV
Sbjct: 164 NGTLSELFAEQDEMRRKASI--KGSPDLYLKYMNQDYLNMVEMAFKPPFHKDYDKPFRSV 221

Query: 284 QVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELC 343
           QVFQKDFGQ+IGQGFSDRHAV VQGIRRKLMGRARNWLTANALKPYHSWVYWRD D+ELC
Sbjct: 222 QVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANALKPYHSWVYWRDVDIELC 281

Query: 344 PGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWMESGEALNLAKTLDEDDVIVE 403
           PGSVIEDLMS + DVAVPNVWRPLP+FL GEQ YDLNSW+ESGEAL LA TLDEDDVIVE
Sbjct: 282 PGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVESGEALKLANTLDEDDVIVE 341

Query: 404 GYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAELFRRGIQFPAFTFENHAET 463
           GYAEYPT+RVHL YIR+P  +P EILDLDGVGGVSILAKA+LFR G+ FPAFTFENHAET
Sbjct: 342 GYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLFRAGVHFPAFTFENHAET 401

Query: 464 EGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIANKERESRRE 509
           E FGKMAKKM YRVGGLPHYT+WHIYEPSDDDL+EIA KERE RR+
Sbjct: 402 EAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDLKEIAKKEREKRRD 447

>Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON}
           (41403..42899) [1497 nt, 499 aa]
          Length = 498

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/489 (64%), Positives = 385/489 (78%), Gaps = 9/489 (1%)

Query: 22  KLPTSHSKLSPKGK-RSSWQNRKIVSWVIIT-VMVLILYKAFSGVVRGGREVMKTVGSNT 79
           +LP S S+ +PK K R  +      ++V I  ++ LIL+  F  + +       +   ++
Sbjct: 16  ELPISDSRWAPKSKYRHKFNPANSENFVKINAIITLILFLVF--ICQNSFSSSSSNVVDS 73

Query: 80  SSNDGQVLXXXXXXXXXXXXXXPKVIEKFDGGVQHYLITQFGNDVLTPQDGEVFEREQKM 139
            +N+ ++L                +++KFD G +HYLI+++G++VLTP+D   +E+E + 
Sbjct: 74  HTNEAKILEDNEYYDYDFKNFDEPLVKKFDDGAKHYLISKYGSEVLTPEDKSRYEQELQE 133

Query: 140 LLSSTVESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLA 199
           LLS+TV++YDLS + G+ NG  N EHVLLCVPLRDAE VLPLMFK++MNLTYPHELIDLA
Sbjct: 134 LLSTTVQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLA 193

Query: 200 FLVSDCTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPD 259
           FLVSDCTE D TL++LIAYSR LQ GTL+ +F              K +EKLYLKYMN D
Sbjct: 194 FLVSDCTEGDHTLESLIAYSRHLQDGTLAGLFQEMDKDDS-----KKDSEKLYLKYMNKD 248

Query: 260 YLETVKESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARN 319
           YL+ V++++SPPFH +Y+KPFRSVQ+FQKDFGQ +GQGF++RH+VKVQGIRRKLMGRARN
Sbjct: 249 YLKMVEDAYSPPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARN 308

Query: 320 WLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDL 379
           WL  NALKPYH+WVYWRDADVELCPG+VIEDLMSK++DV VPNVWRPLP+FL+ EQPYDL
Sbjct: 309 WLMTNALKPYHAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDL 368

Query: 380 NSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSI 439
           NSWMES EAL LAK LDEDDVIVEGYAEYPT+RVHLAYIR+   +PN+++DLDGVGGVSI
Sbjct: 369 NSWMESNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSI 428

Query: 440 LAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREI 499
           L KA+LFR GI FPAFTFENHAETE FGKMAKKMG+RVGGLPHYTLWHIYEPSDDDL EI
Sbjct: 429 LVKAKLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEI 488

Query: 500 ANKERESRR 508
           A+KERE+ R
Sbjct: 489 ASKERENNR 497

>KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 404

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/405 (75%), Positives = 344/405 (84%), Gaps = 2/405 (0%)

Query: 104 VIEKFDGGVQHYLITQFGNDVLTPQDGEVFEREQKMLLSSTVESYDLSMFRGSANGAANG 163
           ++ KFD G +HYLI++ G ++L   D E +E E K LL STVE YDL  F GSA G  N 
Sbjct: 1   MLRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNR 60

Query: 164 EHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSDCTEDDKTLDALIAYSRQLQ 223
           EHVLL VPLR+AE+VLPLMFK+LMNLTYPHELIDLAFLVSDC+EDDKTL+AL+ Y ++LQ
Sbjct: 61  EHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQ 120

Query: 224 SGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETVKESFSPPFHENYDKPFRSV 283
           SGTLS VF              KGT  L+LKYM P YL+ VK+++SPPFH+ YDKPFRSV
Sbjct: 121 SGTLSDVFAAHSSDEELIK--EKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRSV 178

Query: 284 QVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELC 343
           Q+FQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELC
Sbjct: 179 QIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELC 238

Query: 344 PGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWMESGEALNLAKTLDEDDVIVE 403
           PGSVI+DLMS D+DVAVPNVWRPLP+FL GEQPYDLNSW+ES  AL LA+TLDEDDVIVE
Sbjct: 239 PGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIVE 298

Query: 404 GYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAELFRRGIQFPAFTFENHAET 463
           GYAEYPT+RVHLAY+RDP  +P +I++LDGVGGVSILAKA+LFR G+ FPAFTFENHAET
Sbjct: 299 GYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAET 358

Query: 464 EGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIANKERESRR 508
           E FGKMAKKMGYRV GLPHYTLWHIYEPSDDDL +IA +ERE +R
Sbjct: 359 EAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREKKR 403

>TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.842
           YML115C
          Length = 520

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/499 (62%), Positives = 361/499 (72%), Gaps = 17/499 (3%)

Query: 22  KLPTSHSKLSPKGKRSSWQNRK-IVSWVIITVMVLILY---------------KAFSGVV 65
           +LPT+ SKL PK      + R     W  I    L +Y                A +   
Sbjct: 17  ELPTTRSKLYPKKSVYDRKRRSPAFYWTCILATCLAIYLLCKATLGDSSFDPLSAINNYN 76

Query: 66  RGGREVMKTVGSNTSSNDGQVLXXXXXXXXXXXXXXPKVIEKFDGGVQHYLITQFGNDVL 125
             G   + +  SN +  + + L                    FD G QHYLITQ+G DV+
Sbjct: 77  SYGSYPL-SRSSNKNYKNAKELEDVEYYDYDFRSIDEMSFHNFDQGEQHYLITQYGGDVV 135

Query: 126 TPQDGEVFEREQKMLLSSTVESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKH 185
           T +D E + +E + LLSS+V+ YDLS F G+ANGA N EH+L   PLRDAE VLP+MFKH
Sbjct: 136 TSKDKERYIQEMENLLSSSVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKH 195

Query: 186 LMNLTYPHELIDLAFLVSDCTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXS 245
           LMNLTYPHELID+AFLVSDC+E DKTLD LI ++R LQ GTL  +F             +
Sbjct: 196 LMNLTYPHELIDIAFLVSDCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKN 255

Query: 246 KGTEKLYLKYMNPDYLETVKESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVK 305
           +   K YLK+M+ +Y++    SF+ P H  Y+KPFRSVQ+FQKDFGQ+IGQGFSDRHAVK
Sbjct: 256 ENPNKHYLKFMDQNYIKMADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVK 315

Query: 306 VQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWR 365
           VQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVI+DLMSK+YDV VPNVWR
Sbjct: 316 VQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWR 375

Query: 366 PLPQFLDGEQPYDLNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDP 425
           PLP+FL+ EQPYDLNSWMESGEAL LAKTLDEDDVIVEGYAEYPT+RVHLAY+RDP  DP
Sbjct: 376 PLPEFLNKEQPYDLNSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDP 435

Query: 426 NEILDLDGVGGVSILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTL 485
           N+ LD+DGVGGVSILAKA+LFR G+ FPAFTFENHAETE FGKMAKKMGY VGGLP+Y L
Sbjct: 436 NQTLDIDGVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYML 495

Query: 486 WHIYEPSDDDLREIANKER 504
           WHIYEPSDDDL+++A  ER
Sbjct: 496 WHIYEPSDDDLKDMAAIER 514

>KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 501

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/405 (70%), Positives = 340/405 (83%), Gaps = 4/405 (0%)

Query: 104 VIEKFDGGVQHYLITQFGNDVLTPQDGEVFEREQKMLLSSTVESYDLSMFRGSANGAANG 163
            I+K+D GV HY+I++ G + L+ +D E FERE  MLL+ST + YDLS + G++NGAAN 
Sbjct: 98  TIKKYDEGVSHYIISKGGMEALSSEDKEAFEREADMLLASTTDLYDLSQYNGASNGAANR 157

Query: 164 EHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSDCTEDDKTLDALIAYSRQLQ 223
           +HVLLCVPLRDA  +LP++FK+LMNLTYPHELID+AFLVSDCT++ +T+ +L+ +S++LQ
Sbjct: 158 DHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCTDNGRTMSSLLDFSKELQ 217

Query: 224 SGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETVKESFSPPFHENYDKPFRSV 283
           +GTLS+                   E+LYLKYM  DYL+ VK +F+PPFH++YDKPFRS+
Sbjct: 218 NGTLSKTLQDFEADKDK----GNSAEQLYLKYMGKDYLKMVKNAFNPPFHDDYDKPFRSI 273

Query: 284 QVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELC 343
           Q+F+KDFGQ IGQGFSDRHAVKVQG+RRKLMGRARNWLTANALKPYHSWVYWRD DVELC
Sbjct: 274 QIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKPYHSWVYWRDVDVELC 333

Query: 344 PGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWMESGEALNLAKTLDEDDVIVE 403
           PG+VIEDLM  DYDV VPNVWRPLP FL G Q YDLNSW+ES EA+ LAKTLDEDDVIVE
Sbjct: 334 PGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESNEAIKLAKTLDEDDVIVE 393

Query: 404 GYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAELFRRGIQFPAFTFENHAET 463
           GYAEYPT+RVHL Y+R    +P+++LDLDGVGGVSILA+A+LFR+GI FPAFTFENHAET
Sbjct: 394 GYAEYPTWRVHLGYLRKDNGNPDDLLDLDGVGGVSILARAQLFRKGIHFPAFTFENHAET 453

Query: 464 EGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIANKERESRR 508
           E FGKMAKKMG++VGGL HYTLWHIYEPSDDDLREIA  ERESRR
Sbjct: 454 EAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIAKLERESRR 498

>Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii ABL124W
          Length = 524

 Score =  608 bits (1568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/494 (62%), Positives = 354/494 (71%), Gaps = 12/494 (2%)

Query: 23  LPTSHSKLSPKGK-----RSSWQNRKIVSWVIITVMVLILYKAFSGVVRGGREVMKTVG- 76
           L   +S+  PK K     R S++ + ++  ++    +  L K    + R G       G 
Sbjct: 34  LSPQNSRYHPKVKGKFNFRLSYKLKNVIVSLLTIACIFFLIK--QTMDRNGSTPRSYAGL 91

Query: 77  -SNTSSNDGQVLXXXXXXXXXXXXXXPKVIEKFDGGVQHYLITQFGNDVLTPQDGEVFER 135
            S + S D  VL                 + ++D G +H LI Q G   L     E FE 
Sbjct: 92  LSISDSYDTAVLEESEYYNFEYRPLDLDTVRRYDDGFKHILIDQDG--TLNSNQEEGFEE 149

Query: 136 EQKMLLSSTVESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHEL 195
              MLLS+TVE+YDLS + G+ANGA N EHVL+CVPLR+AE VLPLMF+HLMNLTYPHEL
Sbjct: 150 HLDMLLSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHEL 209

Query: 196 IDLAFLVSDCTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTE-KLYLK 254
           IDLAFLVSDC++DD T+D+LI+Y+ +LQ GTLS+               SK  E  L+LK
Sbjct: 210 IDLAFLVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYKMHKKSKSKNKEGDLHLK 269

Query: 255 YMNPDYLETVKESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLM 314
           YMN DYL  V+ +   PFH+NYDKPFRSVQ+FQKDFGQ+IGQGFSDRH VKVQG RRKLM
Sbjct: 270 YMNKDYLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLM 329

Query: 315 GRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGE 374
           G+ARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMS  YDV VPNVWRPLP+FL  E
Sbjct: 330 GKARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSE 389

Query: 375 QPYDLNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGV 434
           Q YDLNSW+ES  ALNLAKTLDEDDVIVEGYAEY T+R HLA  RDP  +  ++LDLDGV
Sbjct: 390 QEYDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGV 449

Query: 435 GGVSILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDD 494
           GGVSILAKA+LFR G+ F AF FENHAETE FGKMAKKMGYRVGGL HYTLWHIYEPS+D
Sbjct: 450 GGVSILAKAKLFRNGVHFAAFAFENHAETEAFGKMAKKMGYRVGGLSHYTLWHIYEPSND 509

Query: 495 DLREIANKERESRR 508
           DL EIA KER SRR
Sbjct: 510 DLMEIARKERSSRR 523

>CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115c VAN1
           Vanadate resistance protein
          Length = 512

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/401 (70%), Positives = 326/401 (81%), Gaps = 5/401 (1%)

Query: 104 VIEKFDGGVQHYLITQFGNDVLTPQDGEVFEREQKMLLSSTVESYDLSMFRGSANGAANG 163
           ++ KFD G+ +YLI+++G +  +  D   +    +MLL STVE YDL  F+GSA+G    
Sbjct: 115 IVSKFDQGIMNYLISEYGTENPSESDLAEYNDNLQMLLDSTVEKYDLGNFQGSADGFEQQ 174

Query: 164 EHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSDCTEDDKTLDALIAYSRQLQ 223
           EH+L+CVPLRDAE+VLPLMFK+LMNLTYPHELIDLAFLVSDC+E DKTL+AL  YS+ LQ
Sbjct: 175 EHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSDCSEGDKTLEALETYSQLLQ 234

Query: 224 SGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETVKESFSPPFHENYDKPFRSV 283
            G L  +               K  E ++LKYM PDYL+ VK ++ PPFH NY KPFRSV
Sbjct: 235 EGILPDILADMDNYNK-----GKSNESIHLKYMEPDYLKRVKAAYKPPFHPNYSKPFRSV 289

Query: 284 QVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELC 343
           Q+FQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWL +NALKPYHSWVYWRDADVELC
Sbjct: 290 QIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPYHSWVYWRDADVELC 349

Query: 344 PGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWMESGEALNLAKTLDEDDVIVE 403
           PGSVIEDLM +DYDV VPNVWRPLP+FL+  QPYDLNSWMES EAL LAKTLDEDDVIVE
Sbjct: 350 PGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEALQLAKTLDEDDVIVE 409

Query: 404 GYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAELFRRGIQFPAFTFENHAET 463
           GYAEYPTYRVHLAYIR+   DP +++DLDGVGGVSILA+A +FR G+ F AFTFENHAET
Sbjct: 410 GYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFREGVHFSAFTFENHAET 469

Query: 464 EGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIANKER 504
           E FGKMAKK+G+RVGGLPHYTLWHIYEPSDDDL  +A  E+
Sbjct: 470 EAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMAKLEK 510

>ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML115C (VAN1)
          Length = 485

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/405 (67%), Positives = 325/405 (80%), Gaps = 4/405 (0%)

Query: 105 IEKFDGGVQHYLITQFGNDVLTPQDGEVFEREQKMLLSSTVESYDLSMFRGSANGAANGE 164
           + K+D G +HY +T+ G      +D   FE + + L+S+TVE YDL  + G+ NGA N E
Sbjct: 83  LAKYDEGFEHYFVTRDGQ---ISRDDPEFEEQMEELVSATVEQYDLRNYEGTPNGAENRE 139

Query: 165 HVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSDCTEDDKTLDALIAYSRQLQS 224
           HVL+C+PLR+A  VLP+MFKHLMNLTYPHELID+AFLVSDC+E+DKTL +L+ Y+  LQ 
Sbjct: 140 HVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSDCSENDKTLQSLMEYATYLQK 199

Query: 225 GTLSQVFXXXXXXXXX-XXXXSKGTEKLYLKYMNPDYLETVKESFSPPFHENYDKPFRSV 283
           GTL+ V                 G   LYLKYM+ +YL+ V+++FSPP+HENY+KPFRSV
Sbjct: 200 GTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQMVRDAFSPPYHENYEKPFRSV 259

Query: 284 QVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELC 343
           QVF+KDFGQ IGQGFSDRH VKVQGIRR+LMGRARNWLTANALKPYHSWVYWRD DVELC
Sbjct: 260 QVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTANALKPYHSWVYWRDVDVELC 319

Query: 344 PGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWMESGEALNLAKTLDEDDVIVE 403
           PGSVIEDLMS  YDV VPNVWRPLP+FL G+Q YDLNSW+ES +ALNLAK L+EDDVIVE
Sbjct: 320 PGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWIESTDALNLAKKLEEDDVIVE 379

Query: 404 GYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAELFRRGIQFPAFTFENHAET 463
           GYAEY T+R HL   R+   +P E++DLDGVGGVSILAKA+LFR+G  F AF FENHAET
Sbjct: 380 GYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKAKLFRQGAHFTAFAFENHAET 439

Query: 464 EGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIANKERESRR 508
           E FGKMAKKMGY+VGGLPHYTLWHIYEPSDDD+ +IA +ERE+RR
Sbjct: 440 EAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARRERENRR 484

>TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON}
           Anc_1.479 YEL036C
          Length = 525

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/490 (59%), Positives = 357/490 (72%), Gaps = 5/490 (1%)

Query: 21  YKLPTSHSKLSPKGKRSSWQNRKIVSWVIITVMVLILYKAFSGVVRGGREVMKTVGSNTS 80
           ++L   +SK      R    N  +   VI+  + +    + +  +      +    + T 
Sbjct: 33  FRLLPKYSKFKVTNFRDKVSNFNVALSVILLCIFIAKTISVNVSIYKYNSFVHEEETETV 92

Query: 81  SNDGQVLXXXXXXXXXXXXXXPKVIEKFDGGVQHYLITQFGND---VLTPQDGEVFEREQ 137
           + D QVL                 I K+D GV+ YL+  +  D    L+ Q  E ++ E 
Sbjct: 93  TFDTQVLTAPEYYNYDFHDYNLDTISKYDKGVRQYLLDTYKTDDVSQLSVQAKEAYDAEL 152

Query: 138 KMLLSSTVESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELID 197
             LLSS+V+ YD+  F G+++G ++ EHVLLC+PLRDAE VLPLMFK+LMNLTYPHELID
Sbjct: 153 PKLLSSSVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELID 212

Query: 198 LAFLVSDCTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTE--KLYLKY 255
           +AFLVSDC+E+D TL++L+ Y+R LQ+GTL  VF              +  +  KLYLKY
Sbjct: 213 VAFLVSDCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSKLYLKY 272

Query: 256 MNPDYLETVKESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMG 315
           M  +YL+ VKE+F  PFHENYDKPFRS+Q+++KDFGQ +GQ FSDRH VKVQGIRRKLMG
Sbjct: 273 MKKEYLQRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMG 332

Query: 316 RARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQ 375
           RARNWL  NALKPYHSWVYWRDADVELCPG+VIEDLMSKD+DV VPNVWRPLP+F++ EQ
Sbjct: 333 RARNWLMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQ 392

Query: 376 PYDLNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVG 435
           PYDLNSWMES EA++LAK L ED+VIVEGYAEYPT+RVHLAY+R+   DPN+++D+DGVG
Sbjct: 393 PYDLNSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKDGDPNQVVDVDGVG 452

Query: 436 GVSILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDD 495
           GVSILA+A LFR G+ FPAFTFENHAETE FGKMAKKMG+RVGGLPHYTLWHIYEPSDDD
Sbjct: 453 GVSILARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDD 512

Query: 496 LREIANKERE 505
           L  IA KE+E
Sbjct: 513 LMAIATKEKE 522

>Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {ON}
           YML115C (VAN1) - mannosyltransferase [contig 38] FULL
          Length = 339

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/340 (76%), Positives = 294/340 (86%), Gaps = 2/340 (0%)

Query: 170 VPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSDCTEDDKTLDALIAYSRQLQSGTLSQ 229
           VPLR+A+KVLPLMFK+LMNLTYPHELIDLAFLVSDC+EDD+T +AL+ Y+++LQSGTLSQ
Sbjct: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61

Query: 230 VFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETVKESFSPPFHENYDKPFRSVQVFQKD 289
           VF              +G+  L+LKYM P YL+ VK++F+PPFH+NYDKPFRSVQ+FQK+
Sbjct: 62  VFASHNSGENVLR--EEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKN 119

Query: 290 FGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIE 349
           FGQ+IGQ FSDRHAVKVQG RRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIE
Sbjct: 120 FGQVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIE 179

Query: 350 DLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWMESGEALNLAKTLDEDDVIVEGYAEYP 409
           DLM+  YDV VPNVWRPLP+FL GEQ YDLNSW+ES  AL+LAK LDEDDVIVEGYAEYP
Sbjct: 180 DLMATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYP 239

Query: 410 TYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAELFRRGIQFPAFTFENHAETEGFGKM 469
           T+RVHL YIR+   DP   +DLDGVGGVSILAKA+LFR G+ FPAFTFENHAETE FGKM
Sbjct: 240 TWRVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKM 299

Query: 470 AKKMGYRVGGLPHYTLWHIYEPSDDDLREIANKERESRRE 509
           AKKMGY V GLPHYTLWHIYEPSDDDL ++  +ERES+R+
Sbjct: 300 AKKMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKRQ 339

>Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {ON}
           similar to Ashbya gossypii AFR357W
          Length = 447

 Score =  385 bits (988), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 190/365 (52%), Positives = 240/365 (65%), Gaps = 50/365 (13%)

Query: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204
           V+ YDLS ++G+ +G    + VL CVPLRDA   LP+ FKHL ++TYPH LIDL+FLVSD
Sbjct: 50  VDYYDLSNYQGNKDGWQRADRVLFCVPLRDAANHLPMFFKHLKSMTYPHNLIDLSFLVSD 109

Query: 205 CTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETV 264
            T+D  T+  L+     LQS                    + GT++              
Sbjct: 110 STDD--TMGVLLNSLHDLQS-------------------QADGTKR-------------- 134

Query: 265 KESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 324
                          F  +++FQKDFGQ+IGQ FSDRH    QG RRKLM RARNWL + 
Sbjct: 135 ---------------FGDIEIFQKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSA 179

Query: 325 ALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWME 384
           A+KPYHSWVYWRD DVE  P +++EDLM  D D+ VPNVWRPLP++L+  QPYDLNSW+E
Sbjct: 180 AIKPYHSWVYWRDVDVEYVPETILEDLMHHDKDIIVPNVWRPLPKWLNYIQPYDLNSWVE 239

Query: 385 SGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAE 444
           S   L LA +L EDDVIVEGY EY T+RVHLAY+RDP  DP   ++LDG+GGVSIL+KA+
Sbjct: 240 SEGGLQLAASLKEDDVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSKAK 299

Query: 445 LFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIANKER 504
           +FR G  FPAF+FE HAETE FGK++++M Y V GLPHY +WH+YEPS DDL+ +A    
Sbjct: 300 VFRTGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDLKHMAWMAE 359

Query: 505 ESRRE 509
           E +R+
Sbjct: 360 EEQRK 364

>AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL036C (ANP1)
          Length = 434

 Score =  384 bits (986), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 199/366 (54%), Positives = 237/366 (64%), Gaps = 52/366 (14%)

Query: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204
           VE +DLS  RG A+G A G+ VL CVPLRDA + LP+ FKHL  +TYPH L+DL+FLVSD
Sbjct: 42  VEYWDLSWSRGKADGWAQGDRVLFCVPLRDAAEHLPMFFKHLSEMTYPHNLVDLSFLVSD 101

Query: 205 CTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETV 264
               D+T+  L  + R+LQS                                 PD     
Sbjct: 102 SK--DETMSVLRQHVRELQS--------------------------------QPDNA--- 124

Query: 265 KESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 324
                        + F ++++FQKDFGQ IGQ FSDRH    QG RRKLM RARNWL + 
Sbjct: 125 -------------RQFGNIEIFQKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGSV 171

Query: 325 ALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWME 384
           ALKPYHSWVYWRD DVE  P ++IEDLM  D DV VPNVWRPLP +L   QPYDLNSW+E
Sbjct: 172 ALKPYHSWVYWRDVDVETVPQTIIEDLMHHDKDVIVPNVWRPLPDWLGDIQPYDLNSWVE 231

Query: 385 SGEALNL-AKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKA 443
           S   L L A T DED VIVEGY EY T+RVHLAY+RDP  DP   ++LDG+GGVSIL++A
Sbjct: 232 SEGGLQLAADTPDEDAVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSRA 291

Query: 444 ELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIA-NK 502
            +FR G  FPAF+F+ HAETEGFGK+++ MGY V GLPHY +WHIYEPS DDL+ +A   
Sbjct: 292 RVFRSGSHFPAFSFQKHAETEGFGKLSRAMGYSVVGLPHYVIWHIYEPSSDDLKHMAWMA 351

Query: 503 ERESRR 508
           E E RR
Sbjct: 352 EEEQRR 357

>KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {ON}
           similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 489

 Score =  383 bits (983), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 188/366 (51%), Positives = 240/366 (65%), Gaps = 50/366 (13%)

Query: 144 TVESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVS 203
            V+ YDL  ++G A+G   G+HVL  VPLRDA + LP+ F H+  ++YPH LIDL+FLVS
Sbjct: 52  NVQYYDLRNYQGHADGWQRGDHVLFTVPLRDAAEHLPMFFDHMDRISYPHNLIDLSFLVS 111

Query: 204 DCTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLET 263
           D ++D  T+  L+ Y ++ QS                                 PD  + 
Sbjct: 112 DSSDD--TMGVLLEYLQKAQS--------------------------------KPDRTQR 137

Query: 264 VKESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTA 323
                           F ++++++KDFGQ IGQ FSDRH    QG RRKLMGRARNWL +
Sbjct: 138 ----------------FGNIEIYEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLGS 181

Query: 324 NALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWM 383
            ALKPYHSWVYWRD DVE  P +++EDLM  D DV VPNVWRPLP +L   QPYDLNSW 
Sbjct: 182 VALKPYHSWVYWRDVDVETIPPTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQ 241

Query: 384 ESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKA 443
           ES   L LA++LDED VIVEGY EY T+R HLAY+RDP+ DP + ++LDG+GGVSIL+KA
Sbjct: 242 ESEGGLQLAESLDEDSVIVEGYPEYATWRTHLAYMRDPSGDPEDEMELDGIGGVSILSKA 301

Query: 444 ELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIANKE 503
           ++FR G  FPAF+FE HAETE FGK+++++GY V GLPHY +WHIYEPS DDL+ +A   
Sbjct: 302 KVFRAGSHFPAFSFEKHAETEAFGKLSRRLGYSVVGLPHYVIWHIYEPSSDDLKHMAWMA 361

Query: 504 RESRRE 509
            E +R+
Sbjct: 362 EEEKRK 367

>SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 483

 Score =  379 bits (973), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 184/365 (50%), Positives = 241/365 (66%), Gaps = 50/365 (13%)

Query: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204
           VE YDL+ ++G+A+G   G+ VL CVPLRDA + LP+ FKH+  ++YPH LIDL+FLVSD
Sbjct: 82  VEYYDLNNYQGNADGWQRGDRVLFCVPLRDAAEHLPMFFKHMDEISYPHNLIDLSFLVSD 141

Query: 205 CTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETV 264
            ++D  T+  L++  ++ QS                                        
Sbjct: 142 SSDD--TMGVLLSSLKKAQS---------------------------------------- 159

Query: 265 KESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 324
                   +++  + F ++++F+KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + 
Sbjct: 160 --------NQDKSQRFGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWLGSV 211

Query: 325 ALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWME 384
           ALKPYHSWVYWRD DVE  P +++EDLM  + DV VPNVWRPLP +L   QPYDLNSW E
Sbjct: 212 ALKPYHSWVYWRDVDVETIPRTILEDLMHHNKDVIVPNVWRPLPDWLGNIQPYDLNSWKE 271

Query: 385 SGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAE 444
           S   L LA +L+ED VIVEGY EY T+R HLAY+RDP+ DP   ++LDG+GGVSIL+KA+
Sbjct: 272 SEGGLQLADSLEEDAVIVEGYPEYATWRTHLAYMRDPSGDPEAEMELDGIGGVSILSKAK 331

Query: 445 LFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIANKER 504
           +FR G  FPAF+FE HAETE FGK++++M Y V GLPHY +WH+YEPS DDL+ +A    
Sbjct: 332 VFRTGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDLKHMAWMAE 391

Query: 505 ESRRE 509
           E +R+
Sbjct: 392 EEKRK 396

>Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {ON}
           YEL036C (ANP1) - subunit of mannosyltransferase complex
           [contig 41] FULL
          Length = 476

 Score =  377 bits (969), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 185/365 (50%), Positives = 239/365 (65%), Gaps = 50/365 (13%)

Query: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204
           VE YDL  ++G+ +G   G+ VL  VPLRDA + LP+ F H+  ++YPH LIDL+FLVSD
Sbjct: 53  VEYYDLRNYQGNRDGWQRGDRVLFTVPLRDAAEHLPMFFDHMDKISYPHNLIDLSFLVSD 112

Query: 205 CTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETV 264
            ++D  T+  L+ + ++ QS T                                      
Sbjct: 113 SSDD--TMGVLLDHLKKAQSKT-------------------------------------- 132

Query: 265 KESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 324
                     +  K F ++++F+KDFGQ IGQ FSDRH    QG RRKLMGRARNWL + 
Sbjct: 133 ----------DRKKRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLGSV 182

Query: 325 ALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWME 384
           ALKPYHSWVYWRD DVE  P +++EDLM  D DV VPNVWRPLP +L   QPYDLNSW E
Sbjct: 183 ALKPYHSWVYWRDVDVETIPRTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQE 242

Query: 385 SGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAE 444
           S   + LA++LDED VIVEGY EY T+R HLAY+RDP+ +P + ++LDG+GGVSIL+KA+
Sbjct: 243 SEGGMQLAESLDEDAVIVEGYPEYATWRTHLAYMRDPSGNPEDEMELDGIGGVSILSKAK 302

Query: 445 LFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIANKER 504
           +FR G  FPAF+FE HAETE FGK+++++GY V GLPHY +WHIYEPS DDL+ +A    
Sbjct: 303 VFRAGSHFPAFSFEKHAETEAFGKLSRRLGYSVIGLPHYVIWHIYEPSSDDLKHMAWMAE 362

Query: 505 ESRRE 509
           E +R+
Sbjct: 363 EEKRK 367

>KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}
           Anc_1.479 YEL036C
          Length = 457

 Score =  377 bits (967), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 185/367 (50%), Positives = 235/367 (64%), Gaps = 50/367 (13%)

Query: 143 STVESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLV 202
           +  E YDL  +RG++NG   G+ +L CVPLRDA + LP+ FKHL  +TYPH L+DL+FLV
Sbjct: 65  ANTEFYDLKNYRGNSNGWQTGDRILFCVPLRDAAEHLPMFFKHLNEMTYPHNLVDLSFLV 124

Query: 203 SDCTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLE 262
           SD  +D  T+  L++  +  QS                                      
Sbjct: 125 SDSKDD--TMGVLLSNLQTAQS-------------------------------------- 144

Query: 263 TVKESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLT 322
                      ++  K F +++ F+KDFGQ+IGQ FSDRH    QG RRKLM RARNWL 
Sbjct: 145 ----------QKDRSKRFGNIEFFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLG 194

Query: 323 ANALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSW 382
           + A+KPYHSWVYWRD DVE  P +++EDLM    DV VPNVWRPLP++L   QPYDLNSW
Sbjct: 195 SVAIKPYHSWVYWRDVDVETAPVTIMEDLMHHGKDVIVPNVWRPLPEWLGNIQPYDLNSW 254

Query: 383 MESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAK 442
            ES   L LA +LD+D VIVEGY EY T+R HLAY+RDP  DP   ++LDG+GGVSIL+K
Sbjct: 255 QESDAGLELADSLDDDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILSK 314

Query: 443 AELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIANK 502
           A +FR G  FPAF+FE HAETE FGK++++MGY V GLPHY +WHIYEPS +DL+ +A  
Sbjct: 315 ARVFRSGSHFPAFSFEKHAETEAFGKLSRRMGYSVVGLPHYVIWHIYEPSTEDLKHMAWM 374

Query: 503 ERESRRE 509
             E +R+
Sbjct: 375 AEEEQRK 381

>TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {ON}
           Anc_1.479 YEL036C
          Length = 572

 Score =  377 bits (969), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 186/365 (50%), Positives = 235/365 (64%), Gaps = 50/365 (13%)

Query: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204
           V  YDL+ +RG+++G    + +L CVPLRDA + LP  F HL  +TYPH LIDL+FLVSD
Sbjct: 72  VHFYDLNNYRGNSDGWQRNDRILFCVPLRDAAQHLPRFFNHLNTMTYPHNLIDLSFLVSD 131

Query: 205 CTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETV 264
             +D  T+  L+++ +  QS                                        
Sbjct: 132 SKDD--TMGVLLSHLQTAQS---------------------------------------- 149

Query: 265 KESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 324
                    +N  K F ++++++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + 
Sbjct: 150 --------QQNKLKRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSV 201

Query: 325 ALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWME 384
           ALKPYHSWVYWRD DVE CP +++EDLM    DV VPNVWRPLP +L   QPYDLNSW E
Sbjct: 202 ALKPYHSWVYWRDVDVETCPVTIMEDLMHHGKDVIVPNVWRPLPDWLGNIQPYDLNSWQE 261

Query: 385 SGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAE 444
           S   L LA +LDED VIVEGY EY T+R HLAY+RDP  DP E ++LDG+GGVSIL+KA+
Sbjct: 262 SEGGLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKAK 321

Query: 445 LFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIANKER 504
           +FR G  FPAF+FE HAETE FGK++++M Y V GLPHY +WHIYEPS +DL+ +A    
Sbjct: 322 VFRSGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDLKHMAWMAE 381

Query: 505 ESRRE 509
           E +R+
Sbjct: 382 EEKRK 386

>YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}
           ANP1Subunit of the alpha-1,6 mannosyltransferase
           complex; type II membrane protein; has a role in
           retention of glycosyltransferases in the Golgi; involved
           in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol
          Length = 500

 Score =  375 bits (963), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 183/359 (50%), Positives = 233/359 (64%), Gaps = 50/359 (13%)

Query: 142 SSTVESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFL 201
           + +VE YDL  ++G+ +G   G+ +L CVPLRDA + LP+ F HL  +TYPH LIDL+FL
Sbjct: 59  TPSVEFYDLRNYQGNKDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFL 118

Query: 202 VSDCTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYL 261
           VSD +  D T+  L++  +  QS                                     
Sbjct: 119 VSDSS--DNTMGVLLSNLQMAQS------------------------------------- 139

Query: 262 ETVKESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWL 321
                       ++  K F ++++++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL
Sbjct: 140 -----------QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWL 188

Query: 322 TANALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNS 381
            + ALKPYHSWVYWRD DVE  P +++EDLM  D DV VPNVWRPLP +L   QPYDLNS
Sbjct: 189 GSVALKPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNS 248

Query: 382 WMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILA 441
           W ES   L LA +LDED VIVEGY EY T+R HLAY+RDP  +P + ++LDG+GGVSILA
Sbjct: 249 WKESEGGLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILA 308

Query: 442 KAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIA 500
           KA++FR G  FPAF+FE HAETE FG+++++M Y V GLPHY +WHIYEPS DDL+ +A
Sbjct: 309 KAKVFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  373 bits (957), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 182/356 (51%), Positives = 230/356 (64%), Gaps = 50/356 (14%)

Query: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204
           VE YDL  ++G+ +G   G+ +L CVPLRDA + LP+ F HL  +TYPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFLVSD 121

Query: 205 CTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETV 264
            +  D T+  L++   + QS                                        
Sbjct: 122 SS--DNTMGVLLSNLHKAQS---------------------------------------- 139

Query: 265 KESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 324
                    ++  K F ++++++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + 
Sbjct: 140 --------QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSV 191

Query: 325 ALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWME 384
           ALKPYHSWVYWRD DVE  P +++EDLM  D DV VPNVWRPLP +L   QPYDLNSW E
Sbjct: 192 ALKPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKE 251

Query: 385 SGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAE 444
           S   L LA  L+ED VIVEGY EY T+R HLAY+RDP  +P + ++LDG+GGVSILAKA+
Sbjct: 252 SEGGLQLADALEEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAK 311

Query: 445 LFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIA 500
           +FR G  FPAF+FE HAETE FG+++++M Y V GLPHY +WHIYEPS DDL+ +A
Sbjct: 312 VFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479
          Length = 494

 Score =  373 bits (957), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 182/365 (49%), Positives = 235/365 (64%), Gaps = 50/365 (13%)

Query: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204
           VE YDL  ++G+ +G    + +L CVPLRDA + LP+ F HL  +TYPH LIDL+FLVSD
Sbjct: 82  VEFYDLGNYQGNKDGWQRNDRILFCVPLRDAAEHLPMFFDHLNKMTYPHNLIDLSFLVSD 141

Query: 205 CTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETV 264
            +  D T+  L++  +  QS                                        
Sbjct: 142 SS--DNTMGVLLSNLQNAQS---------------------------------------- 159

Query: 265 KESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 324
                    ++  K F ++++F+KDFGQ+IGQ FSDRH  K QG RRKLM RARNWL + 
Sbjct: 160 --------QQDRSKRFGNIEIFEKDFGQIIGQSFSDRHGFKAQGPRRKLMARARNWLGSV 211

Query: 325 ALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWME 384
           A+KPYHSWVYWRD DVE  P +++EDLM  D DV VPNVWRPLP +L   QPYDLNSW E
Sbjct: 212 AIKPYHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQE 271

Query: 385 SGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAE 444
           S   L LA +LDED VIVEGY EY T+R HLAY+RDP  +P + ++L+G+GGVSIL+KA+
Sbjct: 272 SEGGLQLANSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELNGIGGVSILSKAK 331

Query: 445 LFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIANKER 504
           +FR G  FPAF+FE HAETE FGK++++M + V GLPHY +WHIYEPS +DL+ +A    
Sbjct: 332 VFRSGSHFPAFSFEKHAETEAFGKLSRRMNFNVIGLPHYVIWHIYEPSKEDLKHMAWMAE 391

Query: 505 ESRRE 509
           E +R+
Sbjct: 392 EEKRK 396

>Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  372 bits (955), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 181/356 (50%), Positives = 230/356 (64%), Gaps = 50/356 (14%)

Query: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204
           VE YDL  ++G+ +G   G+ +L CVPLRDA + LP+ F HL  ++YPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMSYPHNLIDLSFLVSD 121

Query: 205 CTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETV 264
            +  D T+  L++  +  QS                                        
Sbjct: 122 SS--DNTMGVLLSSLQTAQS---------------------------------------- 139

Query: 265 KESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 324
                    ++  K F ++++++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + 
Sbjct: 140 --------QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSV 191

Query: 325 ALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWME 384
           ALKPYHSWVYWRD DV+  P +++EDLM  D DV VPNVWRPLP +L   QPYDLNSW E
Sbjct: 192 ALKPYHSWVYWRDVDVQTIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKE 251

Query: 385 SGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAE 444
           S   L LA  LDED VIVEGY EY T+R HLAY+RDP  +P + ++LDG+GGVSILAKA+
Sbjct: 252 SEGGLQLADALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAK 311

Query: 445 LFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIA 500
           +FR G  FPAF+FE HAETE FG+++++M Y V GLPHY +WHIYEPS DDL+ +A
Sbjct: 312 VFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.479
           YEL036C
          Length = 455

 Score =  370 bits (951), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 182/364 (50%), Positives = 235/364 (64%), Gaps = 50/364 (13%)

Query: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204
           VE YDL  ++G+++G    + +L CVPLRDA + LP+ F+HL  +TYPH  IDL+FLVSD
Sbjct: 62  VEYYDLRNYQGNSDGWQRNDRILFCVPLRDAAEHLPMFFEHLNLMTYPHNFIDLSFLVSD 121

Query: 205 CTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETV 264
            ++D  T+  L+++ +  QS                                        
Sbjct: 122 SSDD--TMGVLLSHLQSAQSQM-------------------------------------- 141

Query: 265 KESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 324
                     +  K F ++++++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + 
Sbjct: 142 ----------DKSKRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSV 191

Query: 325 ALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWME 384
           ALKPYHSWVYWRD DVE  P +++EDLM  D DV VPNVWRPLP +L   QPYDLNSW E
Sbjct: 192 ALKPYHSWVYWRDVDVETVPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQE 251

Query: 385 SGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAE 444
           S   L LA+ L+ED VIVEGY EY T+R HLAY+RDP  DP E ++LDG+GGVSIL+KA+
Sbjct: 252 SEGGLQLAEALEEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKAK 311

Query: 445 LFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIANKER 504
           +FR G  FPAF+FE HAETE FG+++++M Y V GLPHY +WHIYEPS +DL+ +A    
Sbjct: 312 VFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVVGLPHYVIWHIYEPSTEDLKHMAWMAE 371

Query: 505 ESRR 508
           E +R
Sbjct: 372 EEKR 375

>Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON}
           YEL036C (REAL)
          Length = 495

 Score =  372 bits (954), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 182/356 (51%), Positives = 230/356 (64%), Gaps = 50/356 (14%)

Query: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204
           VE YDL  ++G+ +G   G+ +L CVPLRDA + LP+ F HL  ++YPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFDHLNAMSYPHNLIDLSFLVSD 121

Query: 205 CTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETV 264
            +  D T+  L++  +  QS                                        
Sbjct: 122 SS--DNTMGVLLSKLQMAQS---------------------------------------- 139

Query: 265 KESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 324
                    ++  K F ++++++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + 
Sbjct: 140 --------QQDKTKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSV 191

Query: 325 ALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWME 384
           ALKPYHSWVYWRD DVE  P +++EDLM  D DV VPNVWRPLP +L   QPYDLNSW E
Sbjct: 192 ALKPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKE 251

Query: 385 SGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAE 444
           S   L LA  LDED VIVEGY EY T+R HLAY+RDP  +P + ++LDG+GGVSILAKA+
Sbjct: 252 SEGGLQLANALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAK 311

Query: 445 LFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIA 500
           +FR G  FPAF+FE HAETE FG+++++M Y V GLPHY +WHIYEPS DDL+ +A
Sbjct: 312 VFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]
           {ON} similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 450

 Score =  370 bits (949), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 190/393 (48%), Positives = 243/393 (61%), Gaps = 56/393 (14%)

Query: 116 LITQFGNDVLTPQDGEVFEREQKMLLSSTVESYDLSMFRGSANGAANGEHVLLCVPLRDA 175
           +I QF   V +P  G  F           VE YDL  ++G+ANG   G+ V+ CVPLRDA
Sbjct: 34  IIWQFVPFVSSPVTGNRFRN------IPGVEYYDLINYQGNANGWQTGDRVVFCVPLRDA 87

Query: 176 EKVLPLMFKHLMNLTYPHELIDLAFLVSDCTEDDKTLDALIAYSRQLQSGTLSQVFXXXX 235
              L + F  L  LTYPH LIDL+FLVSD ++D  T+  L+++ R+ QS           
Sbjct: 88  AAHLDMFFDTLDKLTYPHNLIDLSFLVSDSSDD--TMKTLLSHLRRAQS----------- 134

Query: 236 XXXXXXXXXSKGTEKLYLKYMNPDYLETVKESFSPPFHENYDKPFRSVQVFQKDFGQMIG 295
                                                +++  + F ++++F+KDFGQ +G
Sbjct: 135 -------------------------------------NQDKSRRFANIEIFEKDFGQSVG 157

Query: 296 QGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKD 355
           Q FSDRH    QG RRK M RARNWL + ALKPYHS+VYWRD DV+  P +++EDLM  D
Sbjct: 158 QSFSDRHGFAAQGPRRKSMARARNWLGSAALKPYHSYVYWRDVDVQTIPNTILEDLMHHD 217

Query: 356 YDVAVPNVWRPLPQFLDGEQPYDLNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHL 415
            DV VPNVWRPLP +L   QPYDLNSW+ES   L LA +LDED  IVEGY EY T+R HL
Sbjct: 218 KDVIVPNVWRPLPDWLGNIQPYDLNSWVESEGGLQLADSLDEDACIVEGYPEYATWRTHL 277

Query: 416 AYIRDPTQDPNEILDLDGVGGVSILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGY 475
           AY+RDP+ DP   ++LDG+GGVSIL+KA++FR G  FPAF+FE HAETE FGK++++M Y
Sbjct: 278 AYMRDPSGDPEVEMELDGIGGVSILSKAKVFRTGSHFPAFSFEKHAETEAFGKLSRRMQY 337

Query: 476 RVGGLPHYTLWHIYEPSDDDLREIANKERESRR 508
            V GLPHY +WHIYEPS DDL+ +A    E +R
Sbjct: 338 SVVGLPHYVIWHIYEPSSDDLKHMAWMAEEEKR 370

>NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}
           Anc_1.479 YEL036C
          Length = 504

 Score =  372 bits (954), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 182/356 (51%), Positives = 231/356 (64%), Gaps = 50/356 (14%)

Query: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204
           VE YDL+ ++G+ +G    + +L CVPLRDA + LP+ F HL  ++YPH  IDL+FLVSD
Sbjct: 87  VEFYDLANYQGNKDGWQKNDRILFCVPLRDAAEHLPMFFDHLNKMSYPHNSIDLSFLVSD 146

Query: 205 CTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETV 264
            ++D  T+  L++  +  QS                                        
Sbjct: 147 SSDD--TMGVLLSNLQNAQS---------------------------------------- 164

Query: 265 KESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 324
                    ++  K F ++++F+KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + 
Sbjct: 165 --------QQDKSKRFGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWLGSV 216

Query: 325 ALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWME 384
           A+KPYHSWVYWRD DVE  P +++EDLM  D DV VPNVWRPLP +L   QPYDLNSW E
Sbjct: 217 AIKPYHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKE 276

Query: 385 SGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAE 444
           S   L LA TL EDDVIVEGY EY T+R HLAY+RDP  +P + ++LDG+GGVSILAKA+
Sbjct: 277 SEGGLQLADTLGEDDVIVEGYPEYATWRSHLAYMRDPNGNPEDEMELDGIGGVSILAKAK 336

Query: 445 LFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIA 500
           +FR G  FPAF+FE HAETE FGK+++KM Y V GLPHY +WHIYEPS +DL+ +A
Sbjct: 337 VFRTGSHFPAFSFEKHAETEAFGKLSRKMNYNVIGLPHYVIWHIYEPSKEDLKHMA 392

>CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa]
           {ON} highly similar to uniprot|P32629 Saccharomyces
           cerevisiae YEL036c ANP1 required for protein
           glycosylation in the golgi
          Length = 447

 Score =  369 bits (948), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 184/365 (50%), Positives = 234/365 (64%), Gaps = 52/365 (14%)

Query: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204
           VE YDL+ + G  +G    + +L CVPLRDA + LP+ F HL  +TYPH LIDL+FLVSD
Sbjct: 54  VEFYDLNDYTGLPDGWQRNDRILFCVPLRDAAEHLPMFFDHLNAMTYPHHLIDLSFLVSD 113

Query: 205 CTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETV 264
            +  D T+  L+ + +Q Q                                         
Sbjct: 114 SS--DNTMGVLMHHLQQAQ----------------------------------------- 130

Query: 265 KESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 324
                    ++ +K F ++++F+KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + 
Sbjct: 131 ---------KDKNKRFGNIEIFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSV 181

Query: 325 ALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWME 384
           A+KPYHSWVYWRD DVE+ P S++EDLM  D DV VPNVWRPLP +L   QPYDLNSW+E
Sbjct: 182 AIKPYHSWVYWRDVDVEVIPRSIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWVE 241

Query: 385 SGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAE 444
           S   L LA TL ED VIVEGY EY T+R HLAY+RDP  +P + + LDG+GGVSIL+KA 
Sbjct: 242 SEGGLQLADTLSEDSVIVEGYPEYATWRTHLAYMRDPNGNPEDEMMLDGIGGVSILSKAR 301

Query: 445 LFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIANKER 504
           +FR G  FPAF+F+ HAETE FGK++++MG+ V GLPHY +WHIYEPS DDL+ +A    
Sbjct: 302 VFRAGSHFPAFSFQKHAETEAFGKLSRRMGFDVVGLPHYVIWHIYEPSTDDLKYMAWMAE 361

Query: 505 ESRRE 509
           E +R+
Sbjct: 362 EEKRK 366

>Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)
           [1938 nt, 646 aa]
          Length = 645

 Score =  372 bits (956), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 176/356 (49%), Positives = 233/356 (65%), Gaps = 50/356 (14%)

Query: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204
           VE YDLS ++G+ +G    + +L C+PLRDA + LP+ F H+  +TYPH L+DL+FLVSD
Sbjct: 66  VEFYDLSNYQGNKDGWQQNDRILFCIPLRDAAQHLPMFFDHMNKMTYPHNLVDLSFLVSD 125

Query: 205 CTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETV 264
            ++D  T+  L+++ + +QS                                        
Sbjct: 126 SSDD--TMGVLLSHLQTVQS---------------------------------------- 143

Query: 265 KESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 324
                    ++  K F ++++++KDFGQ+IGQ FSDRH    QG RRKLM +ARNWL + 
Sbjct: 144 --------QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMAKARNWLGSV 195

Query: 325 ALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWME 384
           ALKPYHSWVYWRD D+E  P +++EDLM  D D+ VPNVWRPLP +L   QPYDLNSW E
Sbjct: 196 ALKPYHSWVYWRDVDIETAPVTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDLNSWQE 255

Query: 385 SGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAE 444
           S   L LA  LDE+ VIVEGY EY T+R HLAY+RDP  DP + ++LDG+GGVSIL+KA+
Sbjct: 256 SEGGLQLANQLDENAVIVEGYPEYATWRPHLAYMRDPNGDPEDEMELDGIGGVSILSKAK 315

Query: 445 LFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIA 500
           +FR G  FPAF+FE HAETE FGK++++M Y V GLPHY +WHIYEPS +DL+ +A
Sbjct: 316 VFRSGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDLKHMA 371

>NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {ON}
           Anc_1.479
          Length = 446

 Score =  364 bits (935), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 183/366 (50%), Positives = 232/366 (63%), Gaps = 54/366 (14%)

Query: 144 TVESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVS 203
           +VE YD+S ++G  +G      +L+CVPL+DA   LPL FK L  +TYPHELIDL+FLVS
Sbjct: 54  SVEFYDMSNYQGHKDGWNQNNRILICVPLKDASNALPLFFKTLEKMTYPHELIDLSFLVS 113

Query: 204 DCTEDDKTLDALIAYSRQLQ--SGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYL 261
           D +  D T+  L+   ++LQ   GT  +                                
Sbjct: 114 DSS--DNTMYNLLNMLKRLQIDGGTSGK-------------------------------- 139

Query: 262 ETVKESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWL 321
                             F ++++++KDFGQ+IGQGFSDRH    QG RRKLMG+ARNWL
Sbjct: 140 ------------------FGNIEIYEKDFGQVIGQGFSDRHGFAAQGPRRKLMGKARNWL 181

Query: 322 TANALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNS 381
              A+KPYHSWVYWRD DVE+ P +++EDLM  D DV VPNVWRPLP +L   QPYDLNS
Sbjct: 182 NTVAIKPYHSWVYWRDVDVEIIPETILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNS 241

Query: 382 WMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILA 441
           W ES   L L+ +L ED VIVEGY EY T+R HLAY+RDP  DP   ++LDGVGGVSIL+
Sbjct: 242 WKESEAGLALSNSLGEDAVIVEGYPEYATWRSHLAYMRDPNGDPEREMELDGVGGVSILS 301

Query: 442 KAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIAN 501
           KA +FR G  FPAF+F+ HAETE FGK++K M + V GLP+Y +WHIYEPS +DL+ +A 
Sbjct: 302 KANVFRSGSHFPAFSFKKHAETEAFGKLSKHMNFTVIGLPNYVVWHIYEPSKEDLQYMAK 361

Query: 502 KERESR 507
            E + R
Sbjct: 362 LEEKER 367

>TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.479
           YEL036C
          Length = 548

 Score =  366 bits (940), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 177/358 (49%), Positives = 227/358 (63%), Gaps = 50/358 (13%)

Query: 142 SSTVESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFL 201
           +  VE YDL  ++G+ +G    + ++ CVPLRDA + LP  F HL  ++YPH LIDL+FL
Sbjct: 62  TPNVEFYDLRNYKGNKDGWQRNDRIVFCVPLRDAAQHLPRFFDHLDKMSYPHNLIDLSFL 121

Query: 202 VSDCTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYL 261
           VSD ++D  T+  L++  +  QS                                     
Sbjct: 122 VSDSSDD--TMGVLLSNLQTAQS------------------------------------- 142

Query: 262 ETVKESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWL 321
                        +  K F ++++++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL
Sbjct: 143 -----------QRDKSKRFGNIEIYEKDFGQVIGQSFSDRHGFAGQGPRRKLMARARNWL 191

Query: 322 TANALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNS 381
            + ALKPYHSWVYWRD D+E  P +++EDLM  D D+ VPNVWRPLP +L   QPYDLNS
Sbjct: 192 GSVALKPYHSWVYWRDVDIETAPRTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDLNS 251

Query: 382 WMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILA 441
           W ES   L LA  L+ED VIVEGY EY T+R HLAY+RDP  DP   ++LDG+GGVSIL+
Sbjct: 252 WQESEGGLQLANQLNEDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILS 311

Query: 442 KAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREI 499
           KA +FR G  FPAF+FE HAETE FGK++++MGY V GLPHY +WHIYEPS +DL+ +
Sbjct: 312 KANVFRSGSHFPAFSFEKHAETEAFGKLSRRMGYNVIGLPHYVVWHIYEPSTEDLKHM 369

>TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {ON}
           Anc_1.479 YEL036C
          Length = 462

 Score =  362 bits (930), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 182/365 (49%), Positives = 231/365 (63%), Gaps = 51/365 (13%)

Query: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204
           VE YDL  ++G  +G   G  +L  VPLRDA + LP  F H+  L+YPH LID++FLVSD
Sbjct: 57  VEYYDLRNYQGDRDGWQRGNRILFLVPLRDAAQHLPRFFGHMSELSYPHNLIDMSFLVSD 116

Query: 205 CTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETV 264
            ++D  T+  L+ + +  QS                                        
Sbjct: 117 SSDD--TMGELLHHLQIAQS---------------------------------------- 134

Query: 265 KESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 324
                    ++ +K F ++++F+KDFGQ IGQ FSDRH    QG RRKLM RARNWL + 
Sbjct: 135 --------QKDRNKRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGSV 186

Query: 325 ALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWME 384
            LKPYHSWVYWRD DVE+ P S++EDLM  D DV VPNVWRPLP +L   QPYDLNSW E
Sbjct: 187 TLKPYHSWVYWRDVDVEIAPISIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWKE 246

Query: 385 SGEALNLAKTL-DEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKA 443
           S   + LA TL DED VIVEGY E+ T+R HLAY+RDP  +P + ++LDG+GGVSILAKA
Sbjct: 247 SEAGIQLANTLTDEDSVIVEGYPEFATWRTHLAYMRDPNGNPEDEMELDGIGGVSILAKA 306

Query: 444 ELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIANKE 503
           ++FR G  FPAF+FE HAETE FGK++++M Y V GLPHY +WHIYEPS +DL+ +A   
Sbjct: 307 KVFRTGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVIWHIYEPSTEDLKHMAWMA 366

Query: 504 RESRR 508
            E +R
Sbjct: 367 EEEKR 371

>ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 608

 Score =  357 bits (917), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 178/358 (49%), Positives = 228/358 (63%), Gaps = 51/358 (14%)

Query: 144 TVESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVS 203
            VE YDL  ++G  +G      +L  VPLRDA + LP  F H+  +TYPH LID +FLVS
Sbjct: 62  NVEYYDLRNYQGDPDGWQRDNRILFLVPLRDAAEHLPRFFNHMDKMTYPHNLIDFSFLVS 121

Query: 204 DCTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLET 263
           D ++D  T+ AL+++  + QS                                       
Sbjct: 122 DSSDD--TMGALLSHLEKAQS--------------------------------------- 140

Query: 264 VKESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTA 323
                    +++  + F ++++++KDFGQ IGQ FSDRH    QG RRKLM RARNWL  
Sbjct: 141 ---------NKDKTRRFGNIEIYEKDFGQAIGQSFSDRHGFDAQGPRRKLMARARNWLGT 191

Query: 324 NALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWM 383
            ALK YHSWVYWRD DVELCP S++EDLM  D DV VPNVWRPLP +L   QPYDLNSW 
Sbjct: 192 VALKAYHSWVYWRDVDVELCPQSIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWK 251

Query: 384 ESGEALNLAKTLDEDD-VIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAK 442
           ES   + LA +L +DD VIVEGY +Y T+R HLAY+RDP  +P + L+LDG+GGVSIL+K
Sbjct: 252 ESEVGVQLADSLPDDDAVIVEGYPDYSTWRTHLAYMRDPNGNPEDELELDGIGGVSILSK 311

Query: 443 AELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIA 500
            ++FR G  FPAF+FE HAETE FGK++++MGY V GLPHY +WHIYEPS +DL+ +A
Sbjct: 312 GKVFRTGSHFPAFSFEKHAETEAFGKLSRRMGYNVVGLPHYVIWHIYEPSTEDLQHMA 369

>NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {ON}
           Anc_8.500
          Length = 393

 Score =  195 bits (495), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 122/352 (34%), Positives = 172/352 (48%), Gaps = 61/352 (17%)

Query: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204
           +  YDL+    +++ A N E +L+  P+   +K     +++L+ LTYP ELI+L F+   
Sbjct: 94  IAHYDLNKLHSTSDAAINKEKILILTPI---QKFHQEYWENLLQLTYPRELIELGFIAPR 150

Query: 205 CTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETV 264
               D+ L AL A   ++QS   +Q F             +K TEK              
Sbjct: 151 TPTGDQALAALEAAVDKVQSDKKNQRFSKVTILRQDSVGFNKLTEK-------------- 196

Query: 265 KESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 324
                                              +RHA++VQ  RR  M  ARN L  +
Sbjct: 197 -----------------------------------ERHALEVQKERRASMALARNELLFS 221

Query: 325 ALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQ------PYD 378
            + P+ SWV W DAD+   P S+I+D+ + D  V   NV++   ++ D E+      PYD
Sbjct: 222 TIGPHTSWVLWLDADIIETPASLIQDMTAHDRAVLSANVFQ---RYYDEEKKQKAIRPYD 278

Query: 379 LNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVS 438
            N+W ES   L LA  + +D++IVEGYAE  TYR  +AY  DP     E + LDGVGG  
Sbjct: 279 FNNWQESDTGLELASKMKDDEIIVEGYAEIATYRPLMAYFHDPDNSVAEEMRLDGVGGGC 338

Query: 439 ILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYE 490
            L KAE+ R G  FP F F +  ETEGF KMAK++ Y V GLP+Y ++HI E
Sbjct: 339 TLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHIEE 390

>KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]
           {ON} highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 392

 Score =  192 bits (489), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 116/352 (32%), Positives = 173/352 (49%), Gaps = 61/352 (17%)

Query: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204
           +  YDL+  + ++N   N E VL+  P++   +     + +L++LTYP  LI+L F++  
Sbjct: 96  IAHYDLNKLKSTSNALVNKERVLILTPMQTFHQQ---YWNNLLSLTYPRALIELGFIIPR 152

Query: 205 CTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETV 264
               D  L  L +  R++Q+G                                       
Sbjct: 153 TASGDAALQKLESAVREVQTG--------------------------------------- 173

Query: 265 KESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 324
                       DK F  + + ++        G  DRHA++VQ  RR  M  ARN L  +
Sbjct: 174 ----------KQDKRFAKITILRQASQSFDRLGEKDRHALEVQKERRAAMALARNELLFS 223

Query: 325 ALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQ------PYD 378
            + P+ SW+ W DAD+   P +VI+DL S +  V   NV++   +F D +Q      PYD
Sbjct: 224 TIGPHTSWILWLDADIVETPVTVIQDLTSHNKPVLAANVYQ---KFYDKDQKKESIRPYD 280

Query: 379 LNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVS 438
            N+W ES   L LA+ L ++++IVEGY+E  TYR  +A+  D     N +++LDGVGG  
Sbjct: 281 FNNWAESEIGLKLAQQLGDNEIIVEGYSEIATYRPLMAHFYDANGATNSLMELDGVGGGC 340

Query: 439 ILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYE 490
            L KAE+ R G  F  F F +  ETE F KMAK++GY V GLP+Y ++HI E
Sbjct: 341 TLVKAEVHRDGAMFTNFPFYHLIETEAFAKMAKRLGYSVFGLPNYLVYHIEE 392

>TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.500
           YPL050C
          Length = 393

 Score =  190 bits (483), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 116/355 (32%), Positives = 178/355 (50%), Gaps = 67/355 (18%)

Query: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204
           +  YDL+    +++ A N E VL+  P++         +++L+ LTYP ELI+L F++  
Sbjct: 94  IAHYDLNKLHSTSDAAVNKEQVLILTPMQTFHDEF---WQNLLQLTYPRELIELGFILPR 150

Query: 205 CTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETV 264
               D  L AL A  +++Q+   +Q                                   
Sbjct: 151 SDSGDAALKALEAAVKKVQTDKKNQ----------------------------------- 175

Query: 265 KESFSPPFHENYDKPFRSVQVFQKD---FGQMIGQGFSDRHAVKVQGIRRKLMGRARNWL 321
                          F  + + ++D   FGQ++ +   +RHA+ VQ  RR  M  ARN L
Sbjct: 176 --------------RFSKITILRQDSQGFGQLMEK---ERHALHVQKERRAAMALARNEL 218

Query: 322 TANALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQ------ 375
             + + P+ SWV W DAD+   P +VI+D+ + D  V   NV++   ++ D E+      
Sbjct: 219 LFSTIGPHTSWVLWLDADIVETPPTVIQDMTAHDKAVLAANVYQ---RYFDEEKKEKSIR 275

Query: 376 PYDLNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVG 435
            YD N+W ES   L +A  +++D++IVEGY+E  TYR  +A+  DPT   N  + LDGVG
Sbjct: 276 AYDFNNWQESDTGLQIAAGMNDDEIIVEGYSEIATYRPLMAHFYDPTASVNSEMMLDGVG 335

Query: 436 GVSILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYE 490
           G   L KA++ R G  FP F F +  ETEGF KMAK++ Y V GLP+Y ++H+ E
Sbjct: 336 GGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHMEE 390

>KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  190 bits (483), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 121/352 (34%), Positives = 174/352 (49%), Gaps = 61/352 (17%)

Query: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204
           +  YDL+    +   A N E VL+  P++   +     + +++++TYP ELI+L F+   
Sbjct: 97  IAHYDLNKLHSTKQAAVNKERVLILTPMQTFHEQ---YWDNILHMTYPRELIELGFIAPR 153

Query: 205 CTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETV 264
               D  L  L A  +++QSG  ++ F                             L   
Sbjct: 154 TPTGDAALKKLEAAIKKIQSGKKNERFAKIII------------------------LRQE 189

Query: 265 KESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 324
            +SF                        M+ +   DRHA+ VQ  RR  M  ARN L  +
Sbjct: 190 SQSFD-----------------------MLAE--KDRHALAVQKQRRSAMALARNELLFS 224

Query: 325 ALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGE------QPYD 378
            L P+ SWV W DAD+   P +VI+DL + D  V   NV++   +F + E      +PYD
Sbjct: 225 TLGPHTSWVLWLDADIVETPPTVIQDLAAHDKPVLAANVYQ---RFFNDELSKADIRPYD 281

Query: 379 LNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVS 438
            N+W ES   L LA +L  D++IVEGYAE  T+R  +A+  D ++  +E + LDGVGG  
Sbjct: 282 FNNWQESETGLELANSLPADEIIVEGYAEMATFRPLMAHFFDESKPVSEEMALDGVGGGC 341

Query: 439 ILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYE 490
            L KAE+ R G  FP F F +  ETEGF KMAK++GY V GLP+Y ++HI E
Sbjct: 342 TLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPNYLVYHIEE 393

>NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {ON}
           Anc_8.500
          Length = 396

 Score =  189 bits (481), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 117/352 (33%), Positives = 177/352 (50%), Gaps = 61/352 (17%)

Query: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204
           +  +DL+    + + + N E VL+  PL   +K     +++++ L+YP ELI+L F+V  
Sbjct: 97  IAEFDLNKLHSTKDASINKEKVLILTPL---QKFHQEYWENILQLSYPRELIELGFIVPR 153

Query: 205 CTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETV 264
               D  L +L                              K  EK           +T 
Sbjct: 154 TQTGDLALQSL-----------------------------EKAVEKT----------QTD 174

Query: 265 KESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 324
           K+          ++ F  V + ++D          +RHA+ VQ  RR  M  ARN L  +
Sbjct: 175 KK----------NQRFAKVTILRQDSESFNKLAEKERHALNVQKERRSSMALARNELLFS 224

Query: 325 ALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQ------PYD 378
            + P+ SWV W DAD+   P ++I+D+ + D  V   NV++   ++ D E+      PYD
Sbjct: 225 TIGPHTSWVLWLDADIVETPSTLIQDMTAHDKSVLAANVFQ---RYYDDEKKASATRPYD 281

Query: 379 LNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVS 438
            N+W ES   L LA  +++D++IVEGY+E  TYR  +AY  D T+  +E + LDGVGG  
Sbjct: 282 FNNWQESEIGLELASKMNDDEIIVEGYSEIATYRPLMAYFHDTTKPVSEEMILDGVGGGC 341

Query: 439 ILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYE 490
            L KAE+ R G  FP+F F +  ETEGF KMAK++GY + GLP+Y ++HI E
Sbjct: 342 TLVKAEVHRDGAMFPSFPFYHLIETEGFAKMAKRLGYEIFGLPNYLVYHIEE 393

>TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8.500
           YPL050C
          Length = 392

 Score =  187 bits (476), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 110/352 (31%), Positives = 172/352 (48%), Gaps = 61/352 (17%)

Query: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204
           +  YDL+    + +     EHVL+  P++         + +L+ ++YP  L++L F++  
Sbjct: 96  IAHYDLNKLHSTKDAMKLKEHVLIATPMQTFHDAY---WSNLLKMSYPRSLLELGFIIPR 152

Query: 205 CTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETV 264
               D+TL  L A  + +Q+G +                                     
Sbjct: 153 TPTGDETLKKLEAAVKNVQTGKV------------------------------------- 175

Query: 265 KESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 324
                       +  F  + + ++D       G  +RH++ VQ  RR  M  ARN L  +
Sbjct: 176 ------------EDRFAKITILRQDSQSFDKLGEKERHSLAVQKERRSAMALARNELLFS 223

Query: 325 ALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQ------PYD 378
           ++ P  SWV W DAD+   P +VI+D+ + +  V   NV++   +F D E+      PYD
Sbjct: 224 SIGPSTSWVLWLDADIVETPATVIQDMTNHNKPVLAANVYQ---RFFDKEKNENSIRPYD 280

Query: 379 LNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVS 438
            N+W ES + L +AK ++ED++IVEGYAE  TYR  +A+  D     + ++ LDGVGG  
Sbjct: 281 FNNWAESEKGLEIAKNMNEDEIIVEGYAEIATYRPLMAHFYDKAGKIDALMALDGVGGGC 340

Query: 439 ILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYE 490
            L KAE+ R G  FP F F +  ETEGF KMAK++ Y + GLP+Y ++HI E
Sbjct: 341 TLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEIFGLPNYLVYHIEE 392

>Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  187 bits (475), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 115/352 (32%), Positives = 168/352 (47%), Gaps = 61/352 (17%)

Query: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204
           +  YDL+    + + AAN EHVL+  P++   +     + +L+ LTYP ELI+L F+   
Sbjct: 96  IAHYDLNKLHSTPDAAANKEHVLILTPMQTFHQQY---WDNLLQLTYPRELIELGFITPR 152

Query: 205 CTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETV 264
               D  L  L    +++Q+   +Q F              K  EK              
Sbjct: 153 TATGDLALKKLENAVKKVQADKKAQRFSKITIMRQNSQSFDKLMEK-------------- 198

Query: 265 KESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 324
                                              +RHA+ VQ  RR  M  ARN L  +
Sbjct: 199 -----------------------------------ERHALDVQKERRAAMALARNELLFS 223

Query: 325 ALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQ------PYD 378
            + P+ SWV W DAD+   P ++I+D+   +  V   N+++   +F D E+      PYD
Sbjct: 224 TIGPHTSWVLWLDADIIETPTTLIQDMTQHNKAVLAANIYQ---RFYDQEKKQSSIRPYD 280

Query: 379 LNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVS 438
            N+W ES   L +A  +D+D++IVEGYAE  TYR  +A+     + P++ + LDGVGG  
Sbjct: 281 FNNWQESDTGLEIASQMDDDEIIVEGYAEIATYRPLMAHFYSANELPSKEMVLDGVGGGC 340

Query: 439 ILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYE 490
            L KAE+ R G  FP F F +  ETEGF KMAK++ Y V GLP+Y ++HI E
Sbjct: 341 TLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHIEE 392

>ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 396

 Score =  187 bits (475), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 117/363 (32%), Positives = 179/363 (49%), Gaps = 61/363 (16%)

Query: 134 EREQKMLLSSTVESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPH 193
           +R + ++  + +  YDL+    +A  A N EHVL+  P++   +     + +L+ LTYP 
Sbjct: 86  DRVEDIIPENHIAHYDLNKLHSTAEAALNKEHVLILTPMQTFHQEY---WDNLLQLTYPR 142

Query: 194 ELIDLAFLVSDCTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYL 253
           E  +L F++   +  D  L  L A  +++Q+   +Q F             S G +KL  
Sbjct: 143 EFTELGFILPRTSSGDIALSKLEAAVKKVQTDKKNQRFSKITILRQN----SAGFDKLME 198

Query: 254 KYMNPDYLETVKESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKL 313
           K                                             +RHA++VQ  RR  
Sbjct: 199 K---------------------------------------------ERHALEVQKERRSA 213

Query: 314 MGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDG 373
           M  ARN L  ++L P  SWV W DAD+   P ++I+D+ S +  V   NV++   ++ D 
Sbjct: 214 MASARNELLFSSLGPKTSWVLWLDADIVETPPNLIQDMTSHNKAVLSANVYQ---KYYDD 270

Query: 374 E------QPYDLNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNE 427
           +      +PYD N+W ES  AL LAK + +D+++VEGY +  TYR  +AY  D T   N 
Sbjct: 271 QAKKVQIRPYDFNNWQESDTALELAKQMGDDEILVEGYGDLATYRALMAYFYDATGATNA 330

Query: 428 ILDLDGVGGVSILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWH 487
            ++LDGVGG   L KA++ R G  FP F F +  ETEGF KMA+++ Y + GLP+Y ++H
Sbjct: 331 EMNLDGVGGGCTLVKADVHRDGAMFPTFPFYHLIETEGFAKMAQRLNYDIFGLPNYLVYH 390

Query: 488 IYE 490
           I E
Sbjct: 391 IEE 393

>Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  187 bits (474), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 114/352 (32%), Positives = 169/352 (48%), Gaps = 61/352 (17%)

Query: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204
           +  YDL+    + + A N EH+L+  P++   +     + +L+ L YP ELI+L F+   
Sbjct: 96  IAHYDLNKLHSTPDAAVNKEHILILTPMQTFHQQ---YWDNLLQLNYPRELIELGFITPR 152

Query: 205 CTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETV 264
               D  L  L +  +++Q+   +Q F              K  EK              
Sbjct: 153 TATGDSALKKLESAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEK-------------- 198

Query: 265 KESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 324
                                              +RHA++VQ  RR  M  ARN L  +
Sbjct: 199 -----------------------------------ERHALEVQKERRAAMALARNELLFS 223

Query: 325 ALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQ------PYD 378
            + P+ SWV W DAD+   P S+I+D+   +  V   N+++   +F D E+      PYD
Sbjct: 224 TIGPHTSWVLWLDADIIETPTSLIQDMTQHNKAVLAANIYQ---RFYDQEKKQASIRPYD 280

Query: 379 LNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVS 438
            N+W ES   L++A  + +D++IVEGYAE  TYR  +A+  D ++  NE + LDGVGG  
Sbjct: 281 FNNWQESDIGLDIASQMGDDEIIVEGYAEIATYRPLMAHFFDASKPQNEEMALDGVGGGC 340

Query: 439 ILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYE 490
            L KAE+ R G  FP F F +  ETEGF KMAK++ Y V GLP+Y ++HI E
Sbjct: 341 TLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEE 392

>KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {ON}
           Anc_8.500 YPL050C
          Length = 398

 Score =  185 bits (469), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 113/352 (32%), Positives = 171/352 (48%), Gaps = 61/352 (17%)

Query: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204
           +  YDL+  R +A  A N E VL+  P++   K     +++L+ LTYP ELI+L F++  
Sbjct: 99  IAHYDLNKLRSTAYAAVNKERVLILTPMQTFHKQ---YWENLLQLTYPRELIELGFIIPR 155

Query: 205 CTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETV 264
               +  L  L    +++QS   +Q                                   
Sbjct: 156 TKTGENALKELEIAIKKVQSDKKNQ----------------------------------- 180

Query: 265 KESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 324
                          F  + + ++D          DRH++ VQ  RR  M  ARN L  +
Sbjct: 181 --------------RFAKITILRQDSQSFDQLAEKDRHSILVQKERRAAMALARNELLFS 226

Query: 325 ALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQ------PYD 378
            L P+ +WV W DAD+   P +VI+D+ S D  V   NV++   ++ D ++      PYD
Sbjct: 227 TLGPHTAWVLWLDADIIETPPTVIQDMTSHDKSVLAANVYQ---KYFDNDEKKMAIRPYD 283

Query: 379 LNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVS 438
            N+W ES   L +A  +DE+++IVEGY+E  TYR  +A+  +      + ++LDGVGG  
Sbjct: 284 FNNWRESDIGLEIAANMDENEIIVEGYSEIATYRPLMAHFYNADGQVTDEMELDGVGGGC 343

Query: 439 ILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYE 490
            L KA++ R G  FP F F +  ETEGF KMAK++ Y V GLP+Y ++HI E
Sbjct: 344 TLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYGVFGLPNYLVYHIEE 395

>SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {ON}
           highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 393

 Score =  184 bits (468), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 116/352 (32%), Positives = 168/352 (47%), Gaps = 61/352 (17%)

Query: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204
           +  YDL+    + N A N E VL+  P+++  +     + +L+ LTYP ELI+L F+V  
Sbjct: 95  IAHYDLNKLTSTQNAALNKEQVLILTPMQNFHQK---YWDNLLQLTYPRELIELGFIVPR 151

Query: 205 CTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETV 264
               +  L+ L A  +++Q+G     F              K  EK              
Sbjct: 152 TGSGNVALEQLEAAVKKVQTGKKEDRFGKITILRQASQSFDKLLEK-------------- 197

Query: 265 KESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 324
                                              +RHA++VQ  RR  M  ARN L  +
Sbjct: 198 -----------------------------------ERHALEVQKERRAAMALARNELLFS 222

Query: 325 ALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQ------PYD 378
            + PY SW+ W DAD+   P SVIED+ + +  V   NV++   ++ D EQ      PYD
Sbjct: 223 TIGPYTSWILWLDADIVETPPSVIEDMTAHNKPVLAANVYQ---RYYDQEQKKESIRPYD 279

Query: 379 LNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVS 438
            N+W ES   L LA  +  D+++VEGY E  TYR  +A+  + +      ++LDGVGG  
Sbjct: 280 YNNWAESDIGLQLASQMSADEILVEGYPEIATYRPLMAHFYEDSAPATVEMELDGVGGGC 339

Query: 439 ILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYE 490
            L KA++ R G  FP F F +  ETEGF KMAK++GY V GLP+Y ++HI E
Sbjct: 340 TLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPNYLVYHIDE 391

>KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 394

 Score =  184 bits (466), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 114/373 (30%), Positives = 179/373 (47%), Gaps = 70/373 (18%)

Query: 133 FEREQKMLLSSTVES---------YDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMF 183
           ++++   L S TVE          YDL+    +    AN E VL+  P++         +
Sbjct: 75  YKKKSNWLFSDTVEDNIPAGHISHYDLNKLTSTDKAFANKEQVLILTPMQTFHDQY---W 131

Query: 184 KHLMNLTYPHELIDLAFLVSDCTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXX 243
            +L+ LTYP +LI+L F++      D  L  L A  ++ Q G                  
Sbjct: 132 DNLLQLTYPRDLIELGFIIPRTATGDTALRKLEAAVKRTQLG------------------ 173

Query: 244 XSKGTEKLYLKYMNPDYLETVKESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHA 303
                                            D+ F  + + ++D          +RHA
Sbjct: 174 -------------------------------KKDQRFSKITILRQDSQSFDSLQEKERHA 202

Query: 304 VKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNV 363
           +KVQ  RR  M  ARN L  + + P+ SW+ W DAD+   P S+I+D+ + +  V   NV
Sbjct: 203 LKVQKERRAAMALARNELLFSTIGPHTSWILWLDADIIETPPSLIQDMTAHNKPVLAANV 262

Query: 364 WRPLPQFLD------GEQPYDLNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAY 417
           ++   ++++       E+PYD N+W +S +AL +A  + +D+V+ EGYAE PTYR  +A+
Sbjct: 263 YQ---KYMNEETKKIAERPYDFNNWADSEKALQMAAGMADDEVLFEGYAELPTYRTLMAH 319

Query: 418 IRDPTQDPNEILDLDGVGGVSILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRV 477
           + D +      + LDGVGG   L KAE+ R G  FP+F F +  ETEGF KMA+++ Y +
Sbjct: 320 MYDASGSQAAEMSLDGVGGGCTLVKAEVHRDGAMFPSFPFYHLIETEGFAKMARRLEYEI 379

Query: 478 GGLPHYTLWHIYE 490
            GLP+Y ++HI E
Sbjct: 380 FGLPNYLVYHIEE 392

>Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  183 bits (465), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 114/352 (32%), Positives = 167/352 (47%), Gaps = 61/352 (17%)

Query: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204
           +  YDL+    +++ A N EHVL+  P++   +     + +L+ L+YP ELI+L F+   
Sbjct: 96  IAHYDLNKLHSTSDAAVNKEHVLILTPMQTFHQQ---YWDNLLQLSYPRELIELGFITPR 152

Query: 205 CTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETV 264
               D  L  L    +++Q+   +Q F              K  EK              
Sbjct: 153 TATGDLALKNLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEK-------------- 198

Query: 265 KESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 324
                                              +RHA+ VQ  RR  M  ARN L  +
Sbjct: 199 -----------------------------------ERHALDVQKERRAAMALARNELLFS 223

Query: 325 ALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQ------PYD 378
            + P+ SW+ W DAD+   P S+I+D+   D  V   N+++   +F D E+      PYD
Sbjct: 224 TIGPHTSWILWLDADIIETPVSLIQDMTQHDKAVLAANIYQ---RFYDQEKKQPSIRPYD 280

Query: 379 LNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVS 438
            N+W ES   L +A  + +D++IVEGYAE  TYR  +A+  +    PNE + LDGVGG  
Sbjct: 281 FNNWQESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHHYNADGLPNEEMALDGVGGGC 340

Query: 439 ILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYE 490
            L KA++ R G  FP F F +  ETEGF KMAK++ Y V GLP+Y ++HI E
Sbjct: 341 TLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYNVFGLPNYLVYHIEE 392

>Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050C
           (MNN9) - Protein required for complex glycosylation
           [contig 27] FULL
          Length = 453

 Score =  184 bits (468), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 113/349 (32%), Positives = 171/349 (48%), Gaps = 55/349 (15%)

Query: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204
           +  YDL+    +AN A N E VL+  P++   +     + +L+ LTYP EL++L F++  
Sbjct: 155 ITHYDLNKLTSTANAALNKEQVLILTPMQTFHEE---YWNNLLQLTYPRELLELGFIIPR 211

Query: 205 CTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETV 264
            T  D  L  L A  ++ Q   LS+                                   
Sbjct: 212 TTSGDNALRKLEAAVKKTQ---LSK----------------------------------- 233

Query: 265 KESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 324
                       D+ F  + + ++D          DRHA++VQ  RR  M  ARN L  +
Sbjct: 234 -----------KDQRFLKITILRQDSQSFDLLKEKDRHALEVQKKRRSAMALARNELLFS 282

Query: 325 ALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQ---PYDLNS 381
            + PY SWV W DAD+   P ++I+D+ + D  V   NV++       G++   PYD N+
Sbjct: 283 TIGPYTSWVLWLDADIIETPPTLIQDMTAHDKAVLAANVYQHSIDKKTGQKTKGPYDFNN 342

Query: 382 WMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILA 441
           W +S  AL +A ++ +D V+ EGY E  TYR  +A+     + P+  + LDGVGG   L 
Sbjct: 343 WADSDTALQMAASMPDDGVLFEGYGEMATYRTLMAHFYKEGESPSAEMVLDGVGGGCTLV 402

Query: 442 KAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYE 490
           KAE+ R G  FP+F F +  ETEGF KMA+++ Y + GLP+Y ++HI E
Sbjct: 403 KAEVHRDGAMFPSFPFYHLIETEGFAKMAQRLDYEIYGLPNYLVYHIEE 451

>Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON}
           (197094..198272) [1179 nt, 393 aa]
          Length = 392

 Score =  183 bits (464), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 114/363 (31%), Positives = 172/363 (47%), Gaps = 61/363 (16%)

Query: 134 EREQKMLLSSTVESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPH 193
           +R + ++    +  YDL+    +++  ++ EHVL+  P++   +     +++L+ L+YP 
Sbjct: 85  DRVEDIIPEGHIAHYDLNKLHSTSDSISDKEHVLVLTPMQTFHEK---YWENLLKLSYPR 141

Query: 194 ELIDLAFLVSDCTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYL 253
           ELI+L F++      D  L  L    + +QS   +  F              K  EK   
Sbjct: 142 ELIELGFIIPRSDAGDAALKKLETAVKNVQSDKKNNRFSKITILRQESQSFDKLEEK--- 198

Query: 254 KYMNPDYLETVKESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKL 313
                                                         +RH++ VQ  RR  
Sbjct: 199 ----------------------------------------------ERHSLAVQKERRAA 212

Query: 314 MGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDG 373
           M  ARN L  + L P+ SWV W D+D+   P +VIE +   D  V   NV++   +F D 
Sbjct: 213 MALARNELLFSTLGPHTSWVLWLDSDIVETPTTVIESMTKHDKPVLAANVYQ---RFFDN 269

Query: 374 EQ------PYDLNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNE 427
           ++      PYD N+W ES   L LA  + +D++IVEGYAE  TYR  +A+  +P+ D  E
Sbjct: 270 DKQQDSIRPYDFNNWAESDIGLQLASKMGDDEIIVEGYAEIATYRPLMAHFYNPSGDVGE 329

Query: 428 ILDLDGVGGVSILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWH 487
            + LDGVGG   L KAE+ R G  FP F F +  ETEGF KMAK++ Y V GLP++ ++H
Sbjct: 330 EMALDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNFLVYH 389

Query: 488 IYE 490
           I E
Sbjct: 390 IEE 392

>CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050c required for complex N-glycosylation
          Length = 393

 Score =  182 bits (463), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 116/355 (32%), Positives = 171/355 (48%), Gaps = 61/355 (17%)

Query: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204
           V  YDL+    +++ A N E VL+  P++   +     + +L+ LTYP +L++L F++  
Sbjct: 94  VAKYDLNKLHSTSDAAVNKEQVLILTPMQTFHQA---YWDNLLQLTYPRDLLELGFIIPK 150

Query: 205 CTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETV 264
               D  L  L A  ++ Q+   +  F             SKG +KL  K          
Sbjct: 151 SASGDAALKQLEAAVKRAQTDKKNNRFGKVTILRQD----SKGFDKLQEK---------- 196

Query: 265 KESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 324
                                              +RHA+ VQ  RR  M  ARN L  +
Sbjct: 197 -----------------------------------ERHALAVQKERRSAMALARNELLFS 221

Query: 325 ALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQ------PYD 378
            + P+ SWV W DAD+     S+I+D+ + +  V   NV++   ++ D  +      PYD
Sbjct: 222 TIGPHTSWVLWLDADIIETKPSLIQDMTALNKPVLAANVYQ---RYFDEAENKPSIRPYD 278

Query: 379 LNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVS 438
            N+W +S  A  L   + +D++IVEGYAE  TYR  +A+   P   PNE++ LDGVGG  
Sbjct: 279 FNNWADSQIAQELGDKMGDDEIIVEGYAEIATYRPLMAHFYTPDGPPNELMSLDGVGGGC 338

Query: 439 ILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSD 493
            L KAE+ R G  FP F F +  ETEGF KMAK++ Y V GLP+Y ++HI E +D
Sbjct: 339 TLVKAEVHRDGAMFPTFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVFHIEERND 393

>YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON}
           MNN9Subunit of Golgi mannosyltransferase complex also
           containing Anp1p, Mnn10p, Mnn11p, and Hoc1p that
           mediates elongation of the polysaccharide mannan
           backbone; forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 395

 Score =  182 bits (462), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 113/352 (32%), Positives = 164/352 (46%), Gaps = 61/352 (17%)

Query: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204
           +  YDL+    ++  A N EH+L+  P++   +     + +L+ L YP ELI+L F+   
Sbjct: 96  IAHYDLNKLHSTSEAAVNKEHILILTPMQTFHQQ---YWDNLLQLNYPRELIELGFITPR 152

Query: 205 CTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETV 264
               D  L  L    +++Q+   +Q F              K  EK              
Sbjct: 153 TATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEK-------------- 198

Query: 265 KESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 324
                                              +RHA+ VQ  RR  M  ARN L  +
Sbjct: 199 -----------------------------------ERHALDVQKERRAAMALARNELLFS 223

Query: 325 ALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQ------PYD 378
            + P+ SWV W DAD+   P S+I+D+   +  +   N+++   +F D E+      PYD
Sbjct: 224 TIGPHTSWVLWLDADIIETPPSLIQDMTKHNKAILAANIYQ---RFYDEEKKQPSIRPYD 280

Query: 379 LNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVS 438
            N+W ES   L +A  + +D++IVEGYAE  TYR  +A+  D    P E + LDGVGG  
Sbjct: 281 FNNWQESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGC 340

Query: 439 ILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYE 490
            L KAE+ R G  FP F F +  ETEGF KMAK++ Y V GLP+Y ++HI E
Sbjct: 341 TLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEE 392

>AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL050C
           (MNN9)
          Length = 389

 Score =  181 bits (460), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 112/348 (32%), Positives = 170/348 (48%), Gaps = 60/348 (17%)

Query: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204
           +  YDL+  + +A  AANGE VL+  P++   +     + +L+ LTYP + I L FL+  
Sbjct: 94  LREYDLNTLQSTAMAAANGEQVLILTPMQIFHQQ---YWDNLLLLTYPRKYIHLGFLLPR 150

Query: 205 CTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETV 264
            +  +  L  L    R++Q+G                                       
Sbjct: 151 TSSGNTALRKLEKAVRKVQTGP-------------------------------------- 172

Query: 265 KESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 324
                       D+ F  + + ++DF        S RH   VQ  RR  M  ARN L  +
Sbjct: 173 -----------KDQRFGKITILRQDFASFNKLSQSARHRFHVQKERRSAMALARNELLFS 221

Query: 325 ALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQP----YDLN 380
            + PY SWV W D+D+   P ++IED+ S +  +   NV++   ++++  +P    YDLN
Sbjct: 222 TIGPYTSWVLWLDSDIVETPNTLIEDMTSHNKPILAANVYQ---RYVENGEPAIRAYDLN 278

Query: 381 SWMESGEALNLAKTLDEDDVIVEGYA-EYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSI 439
           +W ES   L +A  L ED +IVEGY  E+ TYR  +A++    +  +E++ LDGVGG   
Sbjct: 279 NWAESELGLKIASELPEDQIIVEGYGDEFATYRPLMAHMYSDKRPKDELMALDGVGGGCT 338

Query: 440 LAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWH 487
           L KAE+ R G  FP F F +  ETEGF KMAK++ Y + GLP+Y ++H
Sbjct: 339 LVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEIYGLPNYLVYH 386

>TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  177 bits (449), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 114/366 (31%), Positives = 173/366 (47%), Gaps = 61/366 (16%)

Query: 134 EREQKMLLSSTVESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPH 193
           +R + ++    +  YDL+    +A  A N E VL+  P++   +     + +L+ LTYP 
Sbjct: 86  DRVEDIIPEGHIAHYDLNKLHSTAKAALNKEQVLILTPMQTFHEQ---YWDNLLQLTYPR 142

Query: 194 ELIDLAFLVSDCTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYL 253
           ELI+L F+V      D  L  L    +++Q+   +Q                        
Sbjct: 143 ELIELGFIVPRTQSGDVALAKLEEAVKKVQTDKKNQ------------------------ 178

Query: 254 KYMNPDYLETVKESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKL 313
                                     F  V + ++D          +RHA+ VQ  RR  
Sbjct: 179 -------------------------RFVKVTILRQDSKSFDKLQEKERHALAVQKERRAA 213

Query: 314 MGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDG 373
           M  ARN L  + + P+ SWV W DAD+   P ++I+D+ + +  V   NV++   ++ D 
Sbjct: 214 MALARNELLFSTIGPHTSWVLWLDADIVEAPPNLIQDMTAHNKPVLAANVYQ---RYYDE 270

Query: 374 EQ------PYDLNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNE 427
           E+       YD N+W ES   L LA  + ED++IVEGY+E  TYR  +AY  D    P  
Sbjct: 271 EKKESSIRAYDFNNWAESETGLELASQMAEDEIIVEGYSELATYRPLMAYYYDANGSPGA 330

Query: 428 ILDLDGVGGVSILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWH 487
            + LDGVGG   L +A++ R G  FP F F +  ETEGF KMAK++ + V GLP+Y ++H
Sbjct: 331 EMALDGVGGGCTLVQADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNHEVFGLPNYLVYH 390

Query: 488 IYEPSD 493
           I E +D
Sbjct: 391 IEEWND 396

>Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar to
           Ashbya gossypii AGL259C
          Length = 390

 Score =  173 bits (438), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 107/351 (30%), Positives = 166/351 (47%), Gaps = 60/351 (17%)

Query: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204
           +  YD++    +++  AN E VL+  P+   +K     +++L++LTYP +L  L F++  
Sbjct: 95  IMKYDMNTLTTTSSPLANKEIVLILTPM---QKFHDKYWENLLSLTYPRKLTQLGFIIPR 151

Query: 205 CTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETV 264
               D  +  L    +++QSG  +Q F             +K  EK              
Sbjct: 152 TPTGDVAMKRLEDAVKKVQSGKENQRFLKITILRQDSQSFNKLDEK-------------- 197

Query: 265 KESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 324
                                              +RHA  VQ  RR  M  ARN L  +
Sbjct: 198 -----------------------------------ERHAFNVQKERRAAMALARNELVFS 222

Query: 325 ALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGE-----QPYDL 379
            + P  SW+ W DAD+   P +VI+D+ + D  +   NV++   +++D +     +PYD 
Sbjct: 223 TIGPSTSWILWLDADIVETPATVIQDMAAHDKAILAANVFQ---RYIDDQNQENIRPYDF 279

Query: 380 NSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSI 439
           N+W ES   L +A ++ +D++IVE Y E  TYR  +A + DP   P+  + LDGVGG   
Sbjct: 280 NNWQESQTGLEIAASMKDDEIIVESYHEIVTYRPLMAKLYDPNGSPSAEMSLDGVGGGCT 339

Query: 440 LAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYE 490
           L KA++ R G  FP F F +  ETEGF  MAK++ Y V GLP+Y ++H  E
Sbjct: 340 LVKAQVHRDGAMFPNFPFYHLIETEGFAHMAKRLNYEVFGLPNYLVYHFNE 390

>NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {ON}
           Anc_8.500
          Length = 400

 Score =  167 bits (422), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 109/357 (30%), Positives = 169/357 (47%), Gaps = 54/357 (15%)

Query: 134 EREQKMLLSSTVESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPH 193
           +R +  +    +  YDL+  + SAN A N EHVL+  PL+  E+     + +L+ L+YP 
Sbjct: 92  DRAEDTIPEGHIAHYDLNKLQSSANAAENKEHVLILTPLKSFEQG---YWDNLLKLSYPR 148

Query: 194 ELIDLAFLVSDCTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYL 253
           + I+L F++    + D +L  L +  +++Q+      F                  K+ +
Sbjct: 149 DAIELGFIIPRTKKGDHSLKKLESAIKKVQTAKQGDKF-----------------SKITI 191

Query: 254 KYMNPDYLETVKESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKL 313
              N    ETV E                 +V + ++ + I                R  
Sbjct: 192 LRQNSKGFETVPEK---------------KEVSEIEYEKQI----------------RAE 220

Query: 314 MGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDG 373
           M  ARN L A+ L P  +W+ W D+D+   P S+I+D+   D  V   NV+        G
Sbjct: 221 MALARNELLASTLGPQTAWILWLDSDIVETPPSLIQDMTHHDKPVLAANVYERYKDRESG 280

Query: 374 E---QPYDLNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILD 430
           E   +PYD  +W+ES EAL LA  + ED++IVEG A   T R  + +       P+  + 
Sbjct: 281 ELSIRPYDFRNWIESTEALQLASGMQEDEIIVEGLAGISTNRQLMTHFYQQDGSPSSEIS 340

Query: 431 LDGVGGVSILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWH 487
           LDGVG   +L K+E+ R G  FP F F +  E+EGF KMAK++ Y V GLP+Y ++H
Sbjct: 341 LDGVGASCLLVKSEVHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVYGLPNYLVYH 397

>NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON}
           Anc_8.500
          Length = 402

 Score =  151 bits (382), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 105/351 (29%), Positives = 163/351 (46%), Gaps = 61/351 (17%)

Query: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204
           +  YDL+    SAN   N EHVL+  PL+  ++     +++L+NL+YP +LI+L F+V +
Sbjct: 102 IAHYDLNKLVSSANALENKEHVLILTPLQSFDEK---YWENLLNLSYPRDLIELGFMVPN 158

Query: 205 CTEDDKTLDALIAYSRQLQSGTLSQVFXXXXXXXXXXXXXSKGTEKLYLKYMNPDYLETV 264
             + D+ L  L    + +Q                       G+ K              
Sbjct: 159 TKKGDQILKQLENAVKNVQG-----------------IDKKLGSNK-------------- 187

Query: 265 KESFSPPFHENYDKPFRSVQVF-QKDFGQMIGQGFSDR------HAVKVQGIRRKLMGRA 317
                          F  + +  QKD G      F+DR      + ++++  +R  M  A
Sbjct: 188 ---------------FAKITILRQKDSG---FHKFNDRKDKKEMNDIELEKEKRAEMALA 229

Query: 318 RNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGE--Q 375
           RN L ++ L    +W+ W D++V   P ++I+D+   D  V   NV+       D    +
Sbjct: 230 RNELLSSTLSHSTAWILWLDSNVIETPNTLIQDMTQHDKPVLATNVYMKDSNDKDKANIR 289

Query: 376 PYDLNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVG 435
           PYD  +W+ES  AL LA  + ED++IVEG A   T R  +    +    P E L LDG+G
Sbjct: 290 PYDFRNWIESDTALQLASEMPEDEIIVEGMAGLATNRQLMTNFYESDGSPTEELALDGIG 349

Query: 436 GVSILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLW 486
               L K+E+ R G  FP F F +  E+EGF KMAK++ Y V GLP+Y ++
Sbjct: 350 AACTLVKSEVHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVVGLPNYLVF 400

>KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {ON} 
          Length = 357

 Score = 94.0 bits (232), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 86/175 (49%), Gaps = 3/175 (1%)

Query: 311 RKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQF 370
           RK +   +N L  + L PY SWV W D+ +   P ++++DL +    +   +++      
Sbjct: 183 RKQLAALKNQLLFSTLPPYCSWVLWLDSQITGTPTTLVQDLANHGKAILTTHIFNNSDGS 242

Query: 371 LDGEQPYDLNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILD 430
            D E    LN+W+ S    +LA  +    V++EG +   T R  +    D        ++
Sbjct: 243 PDSET---LNNWVASDTWRSLATGMPHSRVVIEGVSHVYTDRPLMGQFYDAAASVLTEME 299

Query: 431 LDGVGGVSILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTL 485
           LD V     L KAE+ R G  FP F F +  ETEGF +MA+ + ++  GLP+Y +
Sbjct: 300 LDSVSTACTLVKAEVHRDGAMFPNFAFHHLVETEGFARMARLLKHQAFGLPNYVV 354

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 3/71 (4%)

Query: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204
           +  Y+L+    S +   + EH+L+ +PL +        F++L  LTYP +LIDL  +V D
Sbjct: 79  ISYYNLNELAASPDAEGHSEHILVLIPLINFNS---RFFENLFALTYPKQLIDLGVIVPD 135

Query: 205 CTEDDKTLDAL 215
                  L AL
Sbjct: 136 SKNATGILQAL 146

>SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, 565
           aa] {ON} weakly similar to gnl|GLV|DEHA0C12881g
           Debaryomyces hansenii DEHA0C12881g
          Length = 565

 Score = 69.7 bits (169), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 56/210 (26%), Positives = 92/210 (43%), Gaps = 35/210 (16%)

Query: 300 DRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVA 359
           DRH   VQ  RRK + + RN+L  N       +    D+D+ + P  ++E  +    ++ 
Sbjct: 368 DRHKDSVQRARRKTIAKVRNFL-YNRSHMDEKYTLTIDSDMMVIPSDMLEKFVKMGKELI 426

Query: 360 VPNVWRPLPQFLDGEQPYDLNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVH--LAY 417
           VP + R     +  ++ YD N+W+  GE     +T  ED      Y  Y    V+    +
Sbjct: 427 VPRILR-----VGSDREYDKNTWI--GE-----RTKPEDTSKQNNYESYVPRPVNGKTKF 474

Query: 418 IRD----------PTQDPNEILDLDGVGGVSILAKAELFRRGIQFPAFTF---------- 457
           ++D          P    + +++LD VGG  +    ++F +GIQFP F            
Sbjct: 475 LQDCVDEKITLNSPEAYTDNVVELDSVGGAILFWDNKIFDQGIQFPVFYLIGSDWDHSEG 534

Query: 458 ENHAETEGFGKMAKKMGYRVGGLPHYTLWH 487
            +  ETEG    AK +GY+  G+P+    H
Sbjct: 535 YDGVETEGLCYQAKTLGYKCYGVPNVICRH 564

>YCR019W Chr3 (152837..153928) [1092 bp, 363 aa] {ON}  MAK32Protein
           necessary for structural stability of L-A
           double-stranded RNA-containing particles
          Length = 363

 Score = 34.3 bits (77), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 59/135 (43%), Gaps = 16/135 (11%)

Query: 342 LCPGS----VIEDLM----SKDYDVAVPNVWRPLPQFLDGEQPYDLNSWMESGE-ALNLA 392
           LC GS    +I DL+    SK     V  +W P P   D +   D+ S M+  +  + L+
Sbjct: 145 LCSGSRCLDIINDLLRVKSSKGTKPIV--IWEPFPDLCDFDHQNDIKSVMQRNDVTVILS 202

Query: 393 KTLDEDDVIVEGYAEYPTY---RVHLAYIRDPTQDPNE--ILDLDGVGGVSILAKAELFR 447
              +E   +    ++ PT     + LA+  D   D N   IL    +G +S+  K +  R
Sbjct: 203 PNAEESSRLFGLSSKEPTSLEECLALAHRFDDFMDENNMCILRCGALGSISVSEKFKNGR 262

Query: 448 RGIQFPAFTFENHAE 462
               FPA+ F+  ++
Sbjct: 263 TYDHFPAYHFKTQSK 277

>ZYRO0G12540g Chr7 (989838..992690) [2853 bp, 950 aa] {ON} similar
           to uniprot|P38244 Saccharomyces cerevisiae YBR074W
           Hypothetical ORF
          Length = 950

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 3/63 (4%)

Query: 428 ILDLDGVGGVSILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWH 487
           +++L+G G   I  KA LFR      A  ++N  ++  FG    + G+  GG+   T + 
Sbjct: 215 VINLEGTG---IGGKAVLFRTSDVSTAKIYQNAVKSNPFGNSLFQQGFYEGGVGSETDYR 271

Query: 488 IYE 490
           IYE
Sbjct: 272 IYE 274

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,732,899
Number of extensions: 2140667
Number of successful extensions: 4680
Number of sequences better than 10.0: 68
Number of HSP's gapped: 4721
Number of HSP's successfully gapped: 112
Length of query: 509
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 395
Effective length of database: 40,409,475
Effective search space: 15961742625
Effective search space used: 15961742625
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)