Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0G14212g8.841ON32532517530.0
NCAS0D049408.841ON3273279091e-122
Skud_12.4na 1ON3253209091e-122
YLL062C (MHT1)na 1ON3243219001e-120
Suva_16.17singletonON3243218981e-120
YPL273W (SAM4)8.841ON3253288851e-118
Smik_12.1na 1ON3243148841e-118
Ecym_46128.841ON3263258811e-117
Suva_13.515na 2ON3253268791e-117
Kwal_27.102558.841ON3293298761e-117
KLLA0D01551g8.841ON3313158761e-117
SAKL0D01452g8.841ON3273278751e-117
TDEL0E00240singletonON3283268701e-116
Kpol_1068.78.841ON3233268651e-115
KAFR0B00210singletonON3263308591e-114
NDAI0F00250singletonON3293278581e-114
TBLA0B032608.841ON3263258521e-113
KNAG0B06970singletonON3323188521e-113
TPHA0I002608.841ON3233138511e-113
TDEL0E05690singletonON3283288511e-113
ABL125W8.841ON3363258411e-111
Smik_6.4848.841ON3253288391e-111
KLTH0C03850g8.841ON3293168331e-110
KAFR0F04420singletonON3263188301e-110
TPHA0G03760singletonON3313288271e-109
KAFR0L00150singletonON3263287961e-105
Suva_64.1singletonON2732717681e-101
Suva_16.328.841ON2592536787e-88
SAKL0D09306gna 3ON3263356742e-86
Skud_101.1singletonON2002005669e-72
Skud_100.1singletonON2002005669e-72
AFR410WsingletonON3703225811e-71
Kwal_0.322na 3ON3323375657e-70
KLTH0H12716gna 3ON3483405181e-62
Skud_47.2singletonON96922575e-27
YMR321Cna 2ON1051062174e-21
Smik_8.2944.383ON79685850.052
TPHA0D043008.185ON424103770.44
Kwal_55.214965.417ON94169722.0
Kwal_23.43735.60ON43558667.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0G14212g
         (325 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} simil...   679   0.0  
NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON}               354   e-122
Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON} YLL...   354   e-122
YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}  MH...   351   e-120
Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON} ...   350   e-120
YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}  SAM4S-adenos...   345   e-118
Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL0...   345   e-118
Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar ...   343   e-117
Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {O...   343   e-117
Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {O...   342   e-117
KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {O...   342   e-117
SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {O...   341   e-117
TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON}       339   e-116
Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}...   337   e-115
KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON}       335   e-114
NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON}       335   e-114
TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.84...   332   e-113
KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON}             332   e-113
TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841 ...   332   e-113
TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {...   332   e-113
ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-synteni...   328   e-111
Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W (...   327   e-111
KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {O...   325   e-110
KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON}               324   e-110
TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON}     323   e-109
KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON}      311   e-105
Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)        300   e-101
Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W (R...   265   7e-88
SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar...   264   2e-86
Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   222   9e-72
Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   222   9e-72
AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-synte...   228   1e-71
Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MH...   222   7e-70
KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} simi...   204   1e-62
Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)      103   5e-27
YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON} P...    88   4e-21
Smik_8.294 Chr8 (481015..483405) [2391 bp, 796 aa] {ON} YHR204W ...    37   0.052
TPHA0D04300 Chr4 (928596..929870) [1275 bp, 424 aa] {ON} Anc_8.1...    34   0.44 
Kwal_55.21496 s55 (863465..866290) [2826 bp, 941 aa] {ON} YDR359...    32   2.0  
Kwal_23.4373 s23 complement(691827..693134) [1308 bp, 435 aa] {O...    30   7.7  

>ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 325

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/325 (100%), Positives = 325/325 (100%)

Query: 1   MRQQLLEVLRDTDRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDV 60
           MRQQLLEVLRDTDRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDV
Sbjct: 1   MRQQLLEVLRDTDRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDV 60

Query: 61  VNSMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHY 120
           VNSMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHY
Sbjct: 61  VNSMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHY 120

Query: 121 LVGSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHEL 180
           LVGSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHEL
Sbjct: 121 LVGSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHEL 180

Query: 181 KSILSWDETKISKPFYVSLCVGDDGNLRDGTPLEQLVPLFANRSNKNLLLVGINCCSLSV 240
           KSILSWDETKISKPFYVSLCVGDDGNLRDGTPLEQLVPLFANRSNKNLLLVGINCCSLSV
Sbjct: 181 KSILSWDETKISKPFYVSLCVGDDGNLRDGTPLEQLVPLFANRSNKNLLLVGINCCSLSV 240

Query: 241 SSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQEYRKFG 300
           SSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQEYRKFG
Sbjct: 241 SSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQEYRKFG 300

Query: 301 ARAIGGCCRTTPLDIQEICKVVDRN 325
           ARAIGGCCRTTPLDIQEICKVVDRN
Sbjct: 301 ARAIGGCCRTTPLDIQEICKVVDRN 325

>NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  354 bits (909), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 172/327 (52%), Positives = 232/327 (70%), Gaps = 9/327 (2%)

Query: 2   RQQLLEVLR-DTDRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDV 60
           RQ + E L+ + D+VLV+DGGQGTELENRG+N++ P+WST+PF  E FW+ D+   DR +
Sbjct: 3   RQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWS-DKSSNDRQI 61

Query: 61  VNSMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHY 120
           V  MF+ ++ AGA++L T TYQTS+K++  +TDI T  +Y++LL+RIV F R CIG+  Y
Sbjct: 62  VKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQKY 121

Query: 121 LVGSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHEL 180
           L+G IGP+ AHV AE+ GDYG  PE IDY+QYF+PQ+ NF  NE +D+IG ETVPNV+EL
Sbjct: 122 LIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNEL 181

Query: 181 KSILSWDETKISKPFYVSLCVGDDGNLRDGTPLEQLVPLF---ANRSNKNLLLVGINCCS 237
           K+ILSWDE  +SKPFY+ L V ++G LRDGT +E++  +F    N+ N NLLL+GINC S
Sbjct: 182 KAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCVS 241

Query: 238 LSVSSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQEYR 297
            + S   L  +++ L   P  L+ YPNSGE+YD   + W      +S  L+W  +V+ Y 
Sbjct: 242 FNHSPSILEDIHKNLPDMP--LIAYPNSGEVYDTVKKIWLPQNSENS--LTWEQVVKRYI 297

Query: 298 KFGARAIGGCCRTTPLDIQEICKVVDR 324
           + GAR IGGCCRTTP DI EI K V +
Sbjct: 298 EAGARIIGGCCRTTPKDILEISKAVKK 324

>Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON}
           YLL062C (REAL)
          Length = 325

 Score =  354 bits (909), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 176/320 (55%), Positives = 227/320 (70%), Gaps = 10/320 (3%)

Query: 8   VLRDTDRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDVVNSMFKA 67
           +L    RVLV+DGGQGTELENRG+NI GP+WS  PFT + FW  +Q   DR+VV  M++ 
Sbjct: 10  ILEYPTRVLVLDGGQGTELENRGINIGGPVWSATPFTSDSFW--EQSSHDREVVEEMYRD 67

Query: 68  YVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHYLVGSIGP 127
           +++AGA +L T+TYQ ++K+I  +T I T + Y+  LDRIV F RR IG++ YLVGSIGP
Sbjct: 68  FMNAGANVLMTITYQANFKSISENTSIQTLSAYNGFLDRIVSFTRRFIGEERYLVGSIGP 127

Query: 128 YAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHELKSILSWD 187
           +AAHV +EYTG+YGP PE+IDY+ +F+PQ+ +FN N+ ID+IG ETVPN HELK+ILSW 
Sbjct: 128 WAAHVSSEYTGNYGPHPEDIDYYNFFKPQLDSFNENKDIDLIGFETVPNFHELKAILSWG 187

Query: 188 ETKISKPFYVSLCVGDDGNLRDGTPLEQL---VPLFANRSNKNLLLVGINCCSLSVSSQA 244
           E  ISKPFYV L V D+G LRDGT +E++   +    +R NK+LLL+G+NC S + S+  
Sbjct: 188 EDIISKPFYVGLSVHDNGLLRDGTTMEEVSAHIKGLGSRINKHLLLMGVNCISFNRSTLI 247

Query: 245 LSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQEYRKFGARAI 304
           L  L+E L  TP  LLVYPNSGE+YD K +TW  PT       SW   V+ +   GAR I
Sbjct: 248 LRTLHESLPDTP--LLVYPNSGEVYDVKEKTWHWPTDKPE---SWDITVKTFIDSGARII 302

Query: 305 GGCCRTTPLDIQEICKVVDR 324
           GGCCRT+P DI EI   V R
Sbjct: 303 GGCCRTSPKDIAEIATAVRR 322

>YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}
           MHT1S-methylmethionine-homocysteine methyltransferase,
           functions along with Sam4p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 324

 Score =  351 bits (900), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 170/321 (52%), Positives = 224/321 (69%), Gaps = 12/321 (3%)

Query: 8   VLRDTDRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDVVNSMFKA 67
           ++    +VL++DGGQGTELENRG+NI+ P+WS  PFT E FW  +    +R VV  M++ 
Sbjct: 10  IVEHPGKVLILDGGQGTELENRGININSPVWSAAPFTSESFW--EPSSQERKVVEEMYRD 67

Query: 68  YVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHYLVGSIGP 127
           ++ AGA +L T+TYQ ++++I  +T I T   Y + LD+IV F R  IG++ YL+GSIGP
Sbjct: 68  FMIAGANILMTITYQANFQSISENTSIKTLAAYKRFLDKIVSFTREFIGEERYLIGSIGP 127

Query: 128 YAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHELKSILSWD 187
           +AAHV  EYTGDYGP PE IDY+ +F+PQ+ NFN+N  ID+IG ET+PN HELK+ILSWD
Sbjct: 128 WAAHVSCEYTGDYGPHPENIDYYGFFKPQLENFNQNRDIDLIGFETIPNFHELKAILSWD 187

Query: 188 ETKISKPFYVSLCVGDDGNLRDGTPLEQL---VPLFANRSNKNLLLVGINCCSLSVSSQA 244
           E  ISKPFY+ L V D+  LRDGT LE++   +    N+ NKNLLL+G+NC S + S+  
Sbjct: 188 EDIISKPFYIGLSVDDNSLLRDGTTLEEISVHIKGLGNKINKNLLLMGVNCVSFNQSALI 247

Query: 245 LSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTG-LDSHRLSWPSLVQEYRKFGARA 303
           L  L+E L   P  LLVYPNSGEIY+ K +TW RPT  LD     W + V+++   GAR 
Sbjct: 248 LKMLHEHLPGMP--LLVYPNSGEIYNPKEKTWHRPTNKLD----DWETTVKKFVDNGARI 301

Query: 304 IGGCCRTTPLDIQEICKVVDR 324
           IGGCCRT+P DI EI   VD+
Sbjct: 302 IGGCCRTSPKDIAEIASAVDK 322

>Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON}
           YLL062C (REAL)
          Length = 324

 Score =  350 bits (898), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 166/321 (51%), Positives = 225/321 (70%), Gaps = 10/321 (3%)

Query: 8   VLRDTDRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDVVNSMFKA 67
           +L    +VLV+DGGQGTELENRG++I+ P+WS  PF  + FW  +   +DR +V  M++ 
Sbjct: 10  ILEHPQKVLVLDGGQGTELENRGIDINSPVWSAAPFISDSFW--ESTSSDRTLVEEMYRD 67

Query: 68  YVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHYLVGSIGP 127
           ++DAGA +L TVTYQ ++ +I  +T I T + Y++ LDR+V F RR IG+D YL+GSIGP
Sbjct: 68  FMDAGANVLMTVTYQANFSSISENTSIKTLSDYNRFLDRVVSFTRRVIGEDRYLIGSIGP 127

Query: 128 YAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHELKSILSWD 187
           +AAHV +EYTGDYG  PE+IDY Q+F+ Q+ NFN++  ID+IG ETVPN HELK+ILSWD
Sbjct: 128 WAAHVSSEYTGDYGSHPEDIDYLQHFKAQLDNFNKHTEIDLIGFETVPNFHELKAILSWD 187

Query: 188 ETKISKPFYVSLCVGDDGNLRDGTPLEQL---VPLFANRSNKNLLLVGINCCSLSVSSQA 244
           E  ISKPFYV L V D+G LRDGT +E++   V     + N++ LL+G+NC S + S+  
Sbjct: 188 ENIISKPFYVGLSVHDNGLLRDGTTMEEIAAYVKSLGRKINRHFLLLGVNCISFNQSTSI 247

Query: 245 LSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQEYRKFGARAI 304
           L  L++ L   P  LL YPNSGE+YD KT+TW +  G  +   SW  +V+E+   GAR I
Sbjct: 248 LKSLHQALPDMP--LLAYPNSGEVYDTKTKTWHQAKGKQN---SWEVVVEEFIDNGARII 302

Query: 305 GGCCRTTPLDIQEICKVVDRN 325
           GGCCRT+  DI EI   VD++
Sbjct: 303 GGCCRTSAKDISEIASAVDKH 323

>YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}
           SAM4S-adenosylmethionine-homocysteine methyltransferase,
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 325

 Score =  345 bits (885), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 164/328 (50%), Positives = 231/328 (70%), Gaps = 12/328 (3%)

Query: 2   RQQLLEVLRDT-DRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDV 60
           R  L + L D   +VLV+DGGQGTELENRG+ ++ P+WST+PF  E FW+ D+   +R +
Sbjct: 3   RLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWS-DESSANRKI 61

Query: 61  VNSMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHY 120
           V  MF  +++AGA++L T TYQTSYK++  +T I T ++Y+ LL+RIV F R CIG+D Y
Sbjct: 62  VKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDKY 121

Query: 121 LVGSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHEL 180
           L+G IGP+ AH+  E+TGDYG +PE ID++QYF+PQ+ NFN+N+ +D+IG ET+PN+HEL
Sbjct: 122 LIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHEL 181

Query: 181 KSILSWDETKISKPFYVSLCVGDDGNLRDGTPLE---QLVPLFANRSNKNLLLVGINCCS 237
           K+ILSWDE+ +S+PFY+ L V + G LRDGT +E   Q++    ++ N N   +GINC S
Sbjct: 182 KAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCVS 241

Query: 238 LSVSSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRL-SWPSLVQEY 296
            + S   L  L++ L +  M LL YPNSGE+YD + + W      +S +L SW ++V++Y
Sbjct: 242 FNQSPDILESLHQALPN--MALLAYPNSGEVYDTEKKIWLP----NSDKLNSWDTVVKQY 295

Query: 297 RKFGARAIGGCCRTTPLDIQEICKVVDR 324
              GAR IGGCCRT+P DIQEI   V +
Sbjct: 296 ISSGARIIGGCCRTSPKDIQEISAAVKK 323

>Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL062C
           (REAL)
          Length = 324

 Score =  345 bits (884), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 169/314 (53%), Positives = 223/314 (71%), Gaps = 12/314 (3%)

Query: 14  RVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDVVNSMFKAYVDAGA 73
           +VLV+DGGQGTELENRG+NI+ P+WS  PF  + FW  ++   +R VV  M++ +++AGA
Sbjct: 16  KVLVLDGGQGTELENRGININSPVWSAAPFVSDSFW--EKSSRERKVVEEMYRDFMNAGA 73

Query: 74  QLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHYLVGSIGPYAAHVG 133
            +L T+TYQ ++K+I  +T I T   Y + LD+IV F RR IG++ YL+GSIGP+AAHV 
Sbjct: 74  NVLMTITYQANFKSISKNTTIKTLPAYRRFLDQIVCFSRRLIGEERYLIGSIGPWAAHVS 133

Query: 134 AEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHELKSILSWDETKISK 193
           +EYTG+YGP PE+IDY+++F PQ+  FN NE ID+IG ET+PN HELK+ILSW E  IS+
Sbjct: 134 SEYTGNYGPHPEDIDYYEFFRPQLDTFNENEDIDLIGFETIPNFHELKAILSWGEDIISR 193

Query: 194 PFYVSLCVGDDGNLRDGTPLEQL---VPLFANRSNKNLLLVGINCCSLSVSSQALSHLNE 250
           PFYV L V D+G LRDGT LE++   +    ++ NKN LL+G+NC S + S+  L  L+E
Sbjct: 194 PFYVGLSVHDNGLLRDGTTLEEISAHIKGLGSKINKNFLLLGVNCISFNQSTLILKALHE 253

Query: 251 ILASTPMGLLVYPNSGEIYDHKTQTWSRPT-GLDSHRLSWPSLVQEYRKFGARAIGGCCR 309
           +L   P  LLVYPNSGEIYD K +TW  PT  LD    SW   V+++   GAR IGGCCR
Sbjct: 254 VLPDFP--LLVYPNSGEIYDPKEKTWYHPTDKLD----SWDVTVRKFIDSGARIIGGCCR 307

Query: 310 TTPLDIQEICKVVD 323
           T+P DI EI   VD
Sbjct: 308 TSPKDIAEIAASVD 321

>Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ABL125W
          Length = 326

 Score =  343 bits (881), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 165/325 (50%), Positives = 223/325 (68%), Gaps = 11/325 (3%)

Query: 3   QQLLEVLRDTDRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDVVN 62
           +QLL+   + D++L+MDGGQGTELENRG+N++ P+WST+PF  + FW+ D+   DR +V 
Sbjct: 7   KQLLQ--SNPDQILIMDGGQGTELENRGINVANPVWSTIPFINDSFWS-DRSSRDRQIVA 63

Query: 63  SMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHYLV 122
            MF+ Y+ AGA LL T+TYQ+S+K++  +TDI T  +Y+QLLDRIV F R CIG D+YLV
Sbjct: 64  GMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADNYLV 123

Query: 123 GSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHELKS 182
           G IG + AH+ AE++GDYG  PE I Y  YF PQ+ NFN  E ID+IG ET+PN+HEL +
Sbjct: 124 GCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHELTA 183

Query: 183 ILSWDETKISKPFYVSLCVGDDGNLRDGTPLEQLVPLF---ANRSNKNLLLVGINCCSLS 239
           ILSWDE+ I KPFY+ + V + G LRDGT + Q+  LF     + N N L +GINCCS  
Sbjct: 184 ILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCCSFR 243

Query: 240 VSSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQEYRKF 299
            S   L  L+E L   P  L+ YPNSGE+YD   + W +    ++  ++W  +V+ Y + 
Sbjct: 244 YSHMILESLHEELPYIP--LIAYPNSGELYDTVKKIWLKN---ENCIVTWDEIVKSYLQS 298

Query: 300 GARAIGGCCRTTPLDIQEICKVVDR 324
           GAR IGGCCRTTP DI++I   V +
Sbjct: 299 GARIIGGCCRTTPNDIRQIVTAVKK 323

>Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {ON}
           YPL273W (REAL)
          Length = 325

 Score =  343 bits (879), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 164/326 (50%), Positives = 229/326 (70%), Gaps = 13/326 (3%)

Query: 3   QQLLEVLRDTDRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDVVN 62
           +QLL    D  +VLV+DGGQGTELENRG+ ++ P+WST+PF  E FW+ D+   +R +V 
Sbjct: 7   KQLLA--DDPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWS-DESSANRKIVK 63

Query: 63  SMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHYLV 122
            MF  ++ AGA++L T+TYQTS+K++  +T I T   YD LL RIV F R CIG++ +L+
Sbjct: 64  EMFNDFLAAGAEILMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLI 123

Query: 123 GSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHELKS 182
           G IGP+ AHV  E+TG+YGP PE ID++QYF+PQ+ NFN+N+ +D++G ET+PN+HELK+
Sbjct: 124 GCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKA 183

Query: 183 ILSWDETKISKPFYVSLCVGDDGNLRDGTPLE---QLVPLFANRSNKNLLLVGINCCSLS 239
           ILSWDE+ +SKPFY+ L V + G LRDGT +E   +++    ++ N N LL+GINC S +
Sbjct: 184 ILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFN 243

Query: 240 VSSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRL-SWPSLVQEYRK 298
            S   L  L+  L + P  LL YPNSGE+YD + + W      +S +L SW ++V++Y  
Sbjct: 244 QSPDILESLHRALPNMP--LLAYPNSGEVYDTEKKIWMP----NSDKLNSWDTVVKQYIG 297

Query: 299 FGARAIGGCCRTTPLDIQEICKVVDR 324
            GAR IGGCCRTTP DIQE+   V +
Sbjct: 298 SGARIIGGCCRTTPKDIQEVSAAVKK 323

>Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {ON}
           YPL273W (SAM4) - S-adenosylmethionine:homocysteine
           S-methyltransferase [contig 37] FULL
          Length = 329

 Score =  342 bits (876), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 167/329 (50%), Positives = 224/329 (68%), Gaps = 10/329 (3%)

Query: 1   MRQQLLEVLRDTDR-VLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNF-DQPYTDR 58
           +R  + E L    R VLV+DGGQGTELENRG+ ++ P+WST+PF  E FW+  DQ   DR
Sbjct: 2   VRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKDR 61

Query: 59  DVVNSMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDD 118
            +V  M+  ++ AGA++L TVTYQ S+K++  +T I T  +YD LL+RIV F R CIGDD
Sbjct: 62  QIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGDD 121

Query: 119 HYLVGSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVH 178
            +LVG IG + AH  +E+TGDYG +PE+ID+ QYF+PQ+ NF  NE ID+IG ET+PN+H
Sbjct: 122 KFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNIH 181

Query: 179 ELKSILSWDETKISKPFYVSLCVGDDGNLRDGTPLEQLVPL---FANRSNKNLLLVGINC 235
           EL++ILSWDE+ I+KPFY+ L V ++G LRDGT + Q+  L   F +R N N  L+GINC
Sbjct: 182 ELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGINC 241

Query: 236 CSLSVSSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQE 295
            S + S   L  L+E L   P  L+ YPNSGE+YD   + W+     +S  LSW  +V+ 
Sbjct: 242 VSYNQSHDILRSLHEELPEMP--LIAYPNSGEVYDTVKKIWNPK---NSQTLSWEQIVKS 296

Query: 296 YRKFGARAIGGCCRTTPLDIQEICKVVDR 324
           Y   GAR IGGCCRT+P DI+ I + V +
Sbjct: 297 YIDSGARIIGGCCRTSPKDIEAIHEAVQK 325

>KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase,
          Length = 331

 Score =  342 bits (876), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 162/315 (51%), Positives = 225/315 (71%), Gaps = 9/315 (2%)

Query: 13  DRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDVVNSMFKAYVDAG 72
           D VLVMDGGQGTELENRG+N++ P+WSTVPF  E FW+ D    DR +V  MF+ +++AG
Sbjct: 14  DVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDAS-KDRIIVKQMFEDFIEAG 72

Query: 73  AQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHYLVGSIGPYAAHV 132
           A +L T+TYQTS+K++  +T I T  +Y+ LLDRIV F R CIG+D YL+G IG + AHV
Sbjct: 73  ADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRYLIGCIGAWGAHV 132

Query: 133 GAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHELKSILSWDETKIS 192
            +E+TGDYGP P++IDY++YF PQ+ NF +++ IDIIG ET+PN+HEL++ILSWDET +S
Sbjct: 133 CSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHELRAILSWDETVLS 192

Query: 193 KPFYVSLCVGDDGNLRDGTPLEQLVPLFA---NRSNKNLLLVGINCCSLSVSSQALSHLN 249
           KPFY+ L V + G LRDGT ++Q+  L +   ++ N NL+ +GINCC+ + S   L  L+
Sbjct: 193 KPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCAFNQSHMILESLH 252

Query: 250 EILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQEYRKFGARAIGGCCR 309
               + P  L+VYPNSGEIYD   + W +    ++   +W  +V+ Y + GAR IGGCCR
Sbjct: 253 NSCPNMP--LIVYPNSGEIYDTVKKIWLKN---ENQLCTWDDVVKSYIENGARIIGGCCR 307

Query: 310 TTPLDIQEICKVVDR 324
           TT  DI+E+   V++
Sbjct: 308 TTVDDIKEVRLAVNK 322

>SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 327

 Score =  341 bits (875), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 160/327 (48%), Positives = 230/327 (70%), Gaps = 10/327 (3%)

Query: 2   RQQLLEVLRD-TDRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDV 60
           RQ + +  ++  D +LVMDGGQGTELENRG+ ++ P+WST+PF  E FW+ ++   DR +
Sbjct: 3   RQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWS-NESSRDRQI 61

Query: 61  VNSMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHY 120
           V  MF  ++  G+++L T TYQTS+K++  +T I T  +Y+QLL+RIV F R CIG+D Y
Sbjct: 62  VKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDKY 121

Query: 121 LVGSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHEL 180
           L+G IG + AHV  E+TGDYG  PE ID+ +YF PQ+ NFN +E ID+IG ET+PNVHEL
Sbjct: 122 LIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHEL 181

Query: 181 KSILSWDETKISKPFYVSLCVGDDGNLRDGTPLEQ---LVPLFANRSNKNLLLVGINCCS 237
           K+ILSWDE+ ISKPFY+ L V ++G LRDGT +++   ++    ++ N NL+L+GINC S
Sbjct: 182 KAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCVS 241

Query: 238 LSVSSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQEYR 297
            + S   LS L++ L   PM  +VYPNSGEIYD   + W      ++ +++W  +V+ Y 
Sbjct: 242 FNHSHLILSSLHKELPDMPM--IVYPNSGEIYDTVKKIWLHN---ENQKVTWDDVVKSYI 296

Query: 298 KFGARAIGGCCRTTPLDIQEICKVVDR 324
           + GAR IGGCCRT+P DI++I + +++
Sbjct: 297 ENGARIIGGCCRTSPQDIKDIVQAIEK 323

>TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  339 bits (870), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 162/326 (49%), Positives = 222/326 (68%), Gaps = 9/326 (2%)

Query: 2   RQQLLEVLRDTDRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDVV 61
           R  L +VL D+ ++LV+DGGQGTE+ENRG+ ++ P+WS++PF  E FW  D+   +R +V
Sbjct: 3   RVPLRKVLTDSRKILVLDGGQGTEMENRGIEVANPVWSSIPFVSESFWT-DEWSKERKIV 61

Query: 62  NSMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHYL 121
             ++K ++ +G+ +L TVTYQ S+K I  +T++ T ++Y+ LLDRIV F RRCIGD+ YL
Sbjct: 62  EEIYKDFMSSGSDMLMTVTYQASFKAIAENTELQTLSEYNSLLDRIVAFSRRCIGDERYL 121

Query: 122 VGSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHELK 181
           VGS+GP+AA+  +EYTGDYG   + IDY+ Y++PQ+ NFN+ E ID+IG+ETVPN HELK
Sbjct: 122 VGSVGPWAAYNASEYTGDYGLHADSIDYYGYYKPQLDNFNKQEEIDMIGIETVPNFHELK 181

Query: 182 SILSWDETKISKPFYVSLCVGDDGNLRDGTPLE---QLVPLFANRSNKNLLLVGINCCSL 238
           +ILSWDE KI+KPFYVSL   D G LRDGT +E   Q +    N  N N +L+GINC S 
Sbjct: 182 AILSWDEKKIAKPFYVSLTTHDSGVLRDGTAMEDIAQYIKCLGNNLNPNFMLLGINCVSF 241

Query: 239 SVSSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQEYRK 298
           + S   L  L+  L    M LL YPNSGE+Y+ K + W           SW S+V+ +  
Sbjct: 242 NDSRDILELLHNALPE--MLLLAYPNSGEVYEPKKKIW---LANKCKTTSWDSVVKSFIN 296

Query: 299 FGARAIGGCCRTTPLDIQEICKVVDR 324
            GAR IGGCCRT+P DI ++   V +
Sbjct: 297 SGARIIGGCCRTSPQDIADVSIAVKK 322

>Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}
           complement(11996..12967) [972 nt, 324 aa]
          Length = 323

 Score =  337 bits (865), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 159/326 (48%), Positives = 229/326 (70%), Gaps = 7/326 (2%)

Query: 1   MRQQLLEVLRDT-DRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRD 59
           MR  + E++R+  D VLV DGG GT LE+RG+N+S P+WSTVPF K++FW+ +   +DR+
Sbjct: 1   MRVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRN 60

Query: 60  VVNSMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDH 119
           ++  +++ Y+ +G+++LST+TYQTS+  I  HT++ T   Y QL+  I  FCR  IG+D+
Sbjct: 61  IIEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDN 120

Query: 120 YLVGSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHE 179
           YL+GSIGP+ A +GAEYTG+YG  P  I+Y +YF+PQ+  FN N+ IDIIG ETVPN +E
Sbjct: 121 YLIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYE 180

Query: 180 LKSILSWDETKISKPFYVSLCVGDDGNLRDGTPLEQLVPLFANRSNK-NLLLVGINCCSL 238
           L++ILSWD++ ISKP+YVSL + D+G LRDGT  E++  +F   SN  NL+L G NC S 
Sbjct: 181 LEAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSNNDNLILTGANCISF 240

Query: 239 SVSSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQEYRK 298
             +S+ +S L++ + + P  L+VYPNSGEIYD  T+ W   T   +  L+W  L++E R 
Sbjct: 241 KYASENISKLHQAIPTLP--LIVYPNSGEIYDPLTKKW---TIDQTFGLTWEDLIKELRT 295

Query: 299 FGARAIGGCCRTTPLDIQEICKVVDR 324
              R +GGCCRTTP DI +I  ++ +
Sbjct: 296 SNVRIVGGCCRTTPDDINKIKDMITK 321

>KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  335 bits (859), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 163/330 (49%), Positives = 228/330 (69%), Gaps = 14/330 (4%)

Query: 2   RQQLLEVLRDT-DRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDV 60
           RQ + E L +   +VLV+DGGQGTELENRG++++ P+WST+PF  E FW+ +    DR++
Sbjct: 3   RQPIKEYLEENPKKVLVLDGGQGTELENRGIHVANPVWSTIPFISESFWS-NASSKDREI 61

Query: 61  VNSMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHY 120
           V  MF+ ++DAGA +L T+TYQTS+K++  +T I T  +Y++LL+RIV F R CIGD+ Y
Sbjct: 62  VKGMFQDFLDAGADILMTITYQTSFKSVTENTPIKTLKEYNELLERIVSFSRSCIGDEKY 121

Query: 121 LVGSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHEL 180
           L+G IGP+ AHV AE+ GDYG  PE IDY+ YF+PQ+ NF +N+ +D+IG ETVPN HEL
Sbjct: 122 LIGCIGPWGAHVCAEFNGDYGGHPENIDYYAYFKPQLDNFFQNKDLDLIGFETVPNFHEL 181

Query: 181 KSILSWDETKISKPFYVSLCVGDDGNLRDGTPLEQL---VPLFANRSNKNLLLVGINCCS 237
           K+ILSWD+T +SKPFY+ L V ++G LRDGT + ++   +    ++ N N LL+GINC S
Sbjct: 182 KAILSWDDTILSKPFYIGLSVHENGVLRDGTTMNEIGYYIKSLGSKINPNFLLLGINCVS 241

Query: 238 LSVSSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHR--LSWPSLVQE 295
            S S   L  +++ L   P  L+ YPNSGEIYD   + W     L +H   ++W  +V  
Sbjct: 242 FSDSPDILESIHKELPDMP--LIAYPNSGEIYDTVKKIW-----LPNHYSDITWNDVVNR 294

Query: 296 YRKFGARAIGGCCRTTPLDIQEICKVVDRN 325
           Y K GAR IGGCCRT P DI+++   V ++
Sbjct: 295 YIKAGARIIGGCCRTMPDDIEQVSAAVKKS 324

>NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  335 bits (858), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 159/327 (48%), Positives = 229/327 (70%), Gaps = 9/327 (2%)

Query: 2   RQQLLEVLRDT-DRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDV 60
           RQ + + L +   ++L++DGGQGTELENRG+N++ P+WST+PF  + FW+  Q   DR++
Sbjct: 3   RQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWS-GQSSKDREI 61

Query: 61  VNSMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHY 120
           V  MF  +++AGA++L T TYQTS+K++  +T+I T  +YD+LL RIV F R CIG++ Y
Sbjct: 62  VKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENKY 121

Query: 121 LVGSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHEL 180
           L+G IGP+ AH+ +E+TG+YG  PE IDY++YF+PQ+ NF +N+ +DIIG ET+PNV+EL
Sbjct: 122 LIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYEL 181

Query: 181 KSILSWDETKISKPFYVSLCVGDDGNLRDGTPLEQLVPL---FANRSNKNLLLVGINCCS 237
           K+ILSW    + KPFY+ L V ++G LRDGT + Q+  +    +++ N NL+L+GINC S
Sbjct: 182 KTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCVS 241

Query: 238 LSVSSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQEYR 297
           L+ S   L  ++  L   P  L+VYPNSGE+YD   + W  P   D   +SW  +V+ Y 
Sbjct: 242 LAHSPDILDSIHSNLPDLP--LIVYPNSGEVYDTVKKIWLPPN--DETYMSWDEVVERYL 297

Query: 298 KFGARAIGGCCRTTPLDIQEICKVVDR 324
           K GAR IGGCCRTTP DI++I   V +
Sbjct: 298 KAGARIIGGCCRTTPNDIKQISDAVHK 324

>TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.841
           YPL273W
          Length = 326

 Score =  332 bits (852), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 167/325 (51%), Positives = 221/325 (68%), Gaps = 7/325 (2%)

Query: 1   MRQQLLEVLR-DTDRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRD 59
           MRQ   E      + V+VMDGGQGTELE RG+++S  +WSTVPF   EFW  D+   +  
Sbjct: 1   MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNIS 60

Query: 60  VVNSMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDH 119
           +V  MF+A+V AG+Q L ++TYQ S+ TI ++T I    +Y++LL++IV FCR CIG+  
Sbjct: 61  IVKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSK 120

Query: 120 YLVGSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHE 179
           YL+GSIGPYA+HV AEYTGDYG  PE +DY  YF+PQ+ NFN N+ ID+I +ETVPN +E
Sbjct: 121 YLIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQLDNFNDNDDIDLIAMETVPNKYE 180

Query: 180 LKSILSWDETKISKPFYVSLCVGDDGNLRDGTPLEQLVPLFANR--SNKNLLLVGINCCS 237
           LK++LSWD T I KPFY+SL VGDDGNLRDGT ++ +  +F NR   N NL++VG+NC S
Sbjct: 181 LKALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVKNPNLMMVGVNCVS 240

Query: 238 LSVSSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQEYR 297
              +   +  L   +   P  L+ YPNSGE+YD  TQ+W   T  D    SW +LV++  
Sbjct: 241 YDKTLMIIKKLQIAVPDLP--LVCYPNSGEVYDQITQSWK--TNNDIKLDSWETLVKDLV 296

Query: 298 KFGARAIGGCCRTTPLDIQEICKVV 322
             G R +GGCCRTTP DI +I + V
Sbjct: 297 ANGVRMVGGCCRTTPDDIHKIAQAV 321

>KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON} 
          Length = 332

 Score =  332 bits (852), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 163/318 (51%), Positives = 217/318 (68%), Gaps = 10/318 (3%)

Query: 2   RQQLLEVLRDTDR-VLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDV 60
           RQ + E L+   R VLV+DGGQGTELENRG+N++ P+WSTVPF    FW+ ++   DR +
Sbjct: 3   RQPIQEYLKVNPRKVLVLDGGQGTELENRGINVANPVWSTVPFIDSSFWS-NKSSKDRVI 61

Query: 61  VNSMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHY 120
           V  MF A++DAGA++L T TYQTS+K++  +T I    +Y  LLDRIV F R CIG D Y
Sbjct: 62  VKGMFDAFLDAGAEILMTTTYQTSFKSVSENTPIQNLEEYSSLLDRIVQFSRDCIGPDKY 121

Query: 121 LVGSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHEL 180
           L+G IGP+ AHV AE+ GDYGP P EIDY  YF+PQ+ NF  N+ +D+IG ET+PN+HEL
Sbjct: 122 LIGCIGPWGAHVCAEFNGDYGPNPAEIDYLSYFKPQLDNFFHNDNLDLIGFETIPNIHEL 181

Query: 181 KSILSWDETKISKPFYVSLCVGDDGNLRDGTPLE---QLVPLFANRSNKNLLLVGINCCS 237
           ++ILSWDET +SKPFY+ L V ++G LRDG+ ++    L+  F  + NKNL L+GINC S
Sbjct: 182 RAILSWDETILSKPFYIGLSVHNNGLLRDGSTMKDVADLIKSFGGKLNKNLTLLGINCVS 241

Query: 238 LSVSSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQEYR 297
            S S   L  +++ L   P  L+ YPNSGE+YD   + W     +    ++W  +V  Y 
Sbjct: 242 FSDSPDILESIHKELPDMP--LIAYPNSGEVYDTVKKIWLPNRDM---VMTWEEVVDRYI 296

Query: 298 KFGARAIGGCCRTTPLDI 315
           K GAR +GGCCRT+P DI
Sbjct: 297 KAGARIVGGCCRTSPKDI 314

>TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841
           YPL273W
          Length = 323

 Score =  332 bits (851), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 156/313 (49%), Positives = 217/313 (69%), Gaps = 7/313 (2%)

Query: 13  DRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDVVNSMFKAYVDAG 72
           + +LV+DGGQGTELENRG+NI+ P+WST+ F  ++FW+ +   T+R  +  MF  + DAG
Sbjct: 14  NEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERKCIREMFNDFKDAG 73

Query: 73  AQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHYLVGSIGPYAAHV 132
           A + ST+TYQTS+ ++  +TDI +  +Y +LL +I GFCRRCI DD YL+G IG YAA +
Sbjct: 74  ANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDDYLLGCIGAYAASI 133

Query: 133 GAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHELKSILSWDETKIS 192
           GAEY G+YG    +IDY +YF+PQ+  FN +  IDIIG ET+PN HEL++ILSWDE  I+
Sbjct: 134 GAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHELEAILSWDEDIIN 193

Query: 193 KPFYVSLCVGDDGNLRDGTPLEQLVPLFANRS--NKNLLLVGINCCSLSVSSQALSHLNE 250
           +PF+++L + D   LRDGT  E++  LFA     NKNL+ VG NC S + S   +  L++
Sbjct: 194 RPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGRNKNLVYVGGNCISYAYSIDNIRKLHD 253

Query: 251 ILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQEYRKFGARAIGGCCRT 310
           I+    + L+ YPNSGEIYD K++ WS  + +   ++SW  +V EY   G + IGGCCRT
Sbjct: 254 IVPH--LNLIAYPNSGEIYDQKSKQWSSTSAI---KISWEEVVNEYADAGVKIIGGCCRT 308

Query: 311 TPLDIQEICKVVD 323
           TP DI++I K VD
Sbjct: 309 TPDDIKQIKKAVD 321

>TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {ON}
           
          Length = 328

 Score =  332 bits (851), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 158/328 (48%), Positives = 223/328 (67%), Gaps = 11/328 (3%)

Query: 1   MRQQLLEVLRDTDRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDV 60
           +R  + +++ ++  +LV+DGGQGTELENRG+ ++ P+WST+PF  E FW  D    +R +
Sbjct: 2   VRIPIKKLVIESKEILVLDGGQGTELENRGIEVANPVWSTIPFLSESFWT-DSSSKERKI 60

Query: 61  VNSMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHY 120
           V S+F  +  +G+ +L T+TYQTS+ +I  +T   T  +Y+ LLDRIV F R CIGD+ Y
Sbjct: 61  VESVFDDFKKSGSNILMTITYQTSFTSIVENTQFKTLAEYNTLLDRIVKFSRSCIGDERY 120

Query: 121 LVGSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHEL 180
           L+GS+GP+ AHV  E+TG+YG  PE IDY++YF+PQ+ NFN  + ID+IG ETVPN HEL
Sbjct: 121 LIGSVGPWGAHVCCEFTGNYGLHPESIDYYEYFKPQLDNFNGQDEIDLIGFETVPNFHEL 180

Query: 181 KSILSWDETKISKPFYVSLCVGDDGNLRDGTPLEQL---VPLFANRSNKNLLLVGINCCS 237
           K+ILSWDETKI+KPFY+ L V ++G LRDGT +E++   +     + + N LL+G+NC S
Sbjct: 181 KAILSWDETKIAKPFYIGLSVHNNGVLRDGTTMEEIGEYIKGLGEKISSNFLLLGVNCVS 240

Query: 238 LSVSSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTW-SRPTGLDSHRLSWPSLVQEY 296
            + SS  +  +++ L   P  LL YPNSGE+YD + + W      LD    SW S+V+ Y
Sbjct: 241 FNDSSDMVKSIHKALPDMP--LLAYPNSGEVYDTEKKIWFDNKDKLD----SWDSVVRSY 294

Query: 297 RKFGARAIGGCCRTTPLDIQEICKVVDR 324
              GAR IGGCCRT+P DI E+   V +
Sbjct: 295 IDNGARIIGGCCRTSPRDIAEVSAAVKK 322

>ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 336

 Score =  328 bits (841), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 165/325 (50%), Positives = 219/325 (67%), Gaps = 14/325 (4%)

Query: 1   MRQQLLEVLRDTDRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYT-DRD 59
           +RQ L E   D  RVLVMDGGQGTELENRG+ ++ P+WS  PF     W   QP + +R 
Sbjct: 6   IRQYLEE---DPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQ--QPDSRERA 60

Query: 60  VVNSMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDH 119
           +V S+ + +V AGA+++ T+TYQ S+ ++  +T I T   Y+ LLDRIVGFCR  +GDD 
Sbjct: 61  IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 120

Query: 120 YLVGSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHE 179
           YLVGSIG + AHV AE+TGDYGP+P+ IDY  YF+PQ+ NFN    +D+IG ET+PN HE
Sbjct: 121 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 180

Query: 180 LKSILSWDETKISKPFYVSLCVGDDGNLRDGTPLEQLVPLFANRS--NKNLLLVGINCCS 237
           L++ILSWDE+ I+KPFYV+L V D G LRDGTP+  +  + A  +  N N L +GINC S
Sbjct: 181 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMADVAAIVAAAAPLNPNFLGLGINCSS 240

Query: 238 LSVSSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQEYR 297
           LS +   L+ L+ +L + PM   +YPNSGEIYD   + W+       H + W ++V  Y 
Sbjct: 241 LSRTPAILAELHALLPALPM--TIYPNSGEIYDPVKKVWNA----SPHVVDWGAVVASYI 294

Query: 298 KFGARAIGGCCRTTPLDIQEICKVV 322
           + GAR IGGCCRT P DI++I   V
Sbjct: 295 RSGARIIGGCCRTIPNDIRQIADAV 319

>Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W
           (REAL)
          Length = 325

 Score =  327 bits (839), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 164/328 (50%), Positives = 227/328 (69%), Gaps = 12/328 (3%)

Query: 2   RQQLLEVLRDT-DRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDV 60
           R  L ++L D   +VLV+DGGQGTELENRG+ ++ P+WST+PF  E F   D+  + R +
Sbjct: 3   RLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESF-WSDESSSSRKI 61

Query: 61  VNSMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHY 120
           V  MF  ++DAGA++L T TYQTSYK++  +T I T ++Y+ LL RIV F R CIG+D Y
Sbjct: 62  VKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDKY 121

Query: 121 LVGSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHEL 180
           L+G IGP+ AH+  E+TGDYG  PE ID++QYF+PQ+ NFN+N+ +D+IG ET+PN+HEL
Sbjct: 122 LIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQLDNFNKNDNLDLIGFETIPNIHEL 181

Query: 181 KSILSWDETKISKPFYVSLCVGDDGNLRDGTPLEQLVPL---FANRSNKNLLLVGINCCS 237
           K+ILSWDE+ +SKPFY+ L V + G LRDGT ++++  +     ++ N N  L+GINC S
Sbjct: 182 KAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCVS 241

Query: 238 LSVSSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRL-SWPSLVQEY 296
            + S   L  L++ L    M LL YPNSGE+YD + + W      +S +L SW ++V+ Y
Sbjct: 242 FNQSPDILESLHQALPD--MALLAYPNSGEVYDTEKKIWLP----NSDKLNSWDAVVKRY 295

Query: 297 RKFGARAIGGCCRTTPLDIQEICKVVDR 324
              GAR IGGCCRT+P DIQEI   V +
Sbjct: 296 ISSGARIIGGCCRTSPKDIQEIFTAVKK 323

>KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 329

 Score =  325 bits (833), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 156/316 (49%), Positives = 216/316 (68%), Gaps = 9/316 (2%)

Query: 13  DRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNF-DQPYTDRDVVNSMFKAYVDA 71
           + VLV+DGGQGTELENRG+ ++ P+WST+PF  + FW   D    DR +V  M++ ++ A
Sbjct: 15  EEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKDRQIVKEMYEDFLKA 74

Query: 72  GAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHYLVGSIGPYAAH 131
           GA++L TVTYQ S+K++  +T I T  +YD LL RIV F R CIGDD +LVG IGP+ AH
Sbjct: 75  GARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGDDKWLVGCIGPWGAH 134

Query: 132 VGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHELKSILSWDETKI 191
             +E+TGDYG +PE+IDY QYF+PQ+ NF  N+ +D+IG ET+PN+HEL++ILSWD T +
Sbjct: 135 NCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNIHELRAILSWDTTIL 194

Query: 192 SKPFYVSLCVGDDGNLRDGTPLEQLVPL---FANRSNKNLLLVGINCCSLSVSSQALSHL 248
            KPFY+ L V + G LRDGT + ++  L     ++ N N +L+GINC S + S + L  L
Sbjct: 195 PKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGINCVSYNHSPEILRSL 254

Query: 249 NEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQEYRKFGARAIGGCC 308
           ++ +   P  L+ YPNSGE+YD   + W+ P G   H L+W  +V+ Y   GAR IGGCC
Sbjct: 255 HQEIPELP--LIAYPNSGEVYDTVKKIWN-PKG--DHTLTWDQVVKSYIDSGARIIGGCC 309

Query: 309 RTTPLDIQEICKVVDR 324
           RT+P DI  I   V++
Sbjct: 310 RTSPKDIAAINAAVNK 325

>KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  324 bits (830), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 157/318 (49%), Positives = 213/318 (66%), Gaps = 9/318 (2%)

Query: 8   VLRDTDRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDVVNSMFKA 67
           +LR++D++LV+DGGQGTELE RG+NIS P+WST+PF  E FW+ +    DR ++  M+  
Sbjct: 10  LLRNSDKILVLDGGQGTELEKRGINISSPVWSTLPFINESFWS-NSSSNDRKIIKDMYSD 68

Query: 68  YVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHYLVGSIGP 127
           ++ AGA +LST TYQTS+ +I  +T+I T   Y +LL+RI  F R CIGD  YLVGSIG 
Sbjct: 69  FISAGADVLSTTTYQTSFASISENTNIQTLKDYHELLNRITKFTRECIGDSKYLVGSIGT 128

Query: 128 YAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHELKSILSWD 187
           YAA++ AEYTGD+G   + IDY  YF+PQ+ NFNR+  IDIIG ET+PN+HEL++ILS +
Sbjct: 129 YAAYLSAEYTGDFGDAADTIDYHGYFKPQLDNFNRSTEIDIIGFETIPNIHELRAILSLN 188

Query: 188 ETKISKPFYVSLCVGDDGNLRDGTPLEQLVPL---FANRSNKNLLLVGINCCSLSVSSQA 244
           +  +SKPFY+SL       LRDGT L+ +V +   F +  N NL+L+GINC  L+ S   
Sbjct: 189 KKDLSKPFYISLSTNSKAQLRDGTSLKGVVDVIKSFESTLNPNLILLGINCIGLNSSHLT 248

Query: 245 LSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQEYRKFGARAI 304
           + +LN  L   P  L+VYPNSGE YD   + W      +    +W  +V  Y   GAR +
Sbjct: 249 MEYLNNHLPQFP--LIVYPNSGEKYDPVRKIW---LADEDPAFTWEYIVHRYLDAGARIV 303

Query: 305 GGCCRTTPLDIQEICKVV 322
           GGCCRTTP DI+ I + +
Sbjct: 304 GGCCRTTPSDIRSISEAI 321

>TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON} 
          Length = 331

 Score =  323 bits (827), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 156/328 (47%), Positives = 221/328 (67%), Gaps = 16/328 (4%)

Query: 2   RQQLLEVLRDT-DRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDV 60
           RQ +   L++  ++VLVMDGGQGTELENRG+ ++ P+WST+PF  E FW+ DQ   DR +
Sbjct: 3   RQCIKNYLQENPNKVLVMDGGQGTELENRGIKVANPVWSTIPFISESFWS-DQSSEDRKI 61

Query: 61  VNSMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHY 120
           V  MF  +++AGA++L T TYQTS+K++  +T I     Y++LL+RI+ F R CIG++ Y
Sbjct: 62  VKEMFNDFINAGAEILMTTTYQTSFKSVSENTPIKNTKHYNELLNRIIDFSRDCIGEERY 121

Query: 121 LVGSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHEL 180
           L+G IG + AH+ AE+ GDYG  PE ID+++YF+PQ+ NF  N  +D+IG ETVPN+HEL
Sbjct: 122 LIGCIGSWGAHICAEFHGDYGEHPENIDFYEYFKPQLDNFFNNNKLDLIGFETVPNIHEL 181

Query: 181 KSILSWDETKISKPFYVSLCVGDDGNLRDGTPLEQLVPL---FANRSNKNLLLVGINCCS 237
           K+ILSWDE  +SKPFY+ L V ++G LRDGT ++++  L   F  + N NL L+GINC S
Sbjct: 182 KAILSWDEKILSKPFYIGLSVHENGLLRDGTSMQEVANLIKGFGEKLNPNLTLLGINCVS 241

Query: 238 LSVSSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTW---SRPTGLDSHRLSWPSLVQ 294
            + S+  +  +++ L + P  L+ YPNSGEIYD   + W     P        +W  +V+
Sbjct: 242 YNHSNDIIKSIHKELPNLP--LIAYPNSGEIYDTTKKIWLPNKNPI------FTWDDIVK 293

Query: 295 EYRKFGARAIGGCCRTTPLDIQEICKVV 322
            Y + G R IGGCCRTTP DI+ +   V
Sbjct: 294 GYIEAGVRIIGGCCRTTPNDIKAVTIAV 321

>KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  311 bits (796), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 149/328 (45%), Positives = 218/328 (66%), Gaps = 10/328 (3%)

Query: 1   MRQQLLEVLRDT-DRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRD 59
           +R  L + L++  ++VLV DGGQG ELE RG++I   +WST PF  + FW+ D    D  
Sbjct: 2   VRVPLKKYLKENPEKVLVSDGGQGLELERRGLDIKHRLWSTRPFLSKSFWS-DPSSNDIR 60

Query: 60  VVNSMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDH 119
           +V  MF+ +V+AGA++L T TYQTS+K +   T++ +  +Y++LLD+IVGF R CIGD+ 
Sbjct: 61  IVKGMFEDFVNAGAEILMTTTYQTSFKAVSESTELKSLREYNELLDKIVGFTRACIGDNR 120

Query: 120 YLVGSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHE 179
           YL+GSIG Y A VG EY+GDYG  PE +D++ YF+PQ+ NF  N+ IDI+G ET+ N  E
Sbjct: 121 YLIGSIGSYGALVGGEYSGDYGDSPETVDFYSYFKPQLDNFLNNDEIDIVGFETIANFTE 180

Query: 180 LKSILSWDETKISKPFYVSLCVGDDGNLRDGTPLEQL---VPLFANRSNKNLLLVGINCC 236
           LKS+LSWDE K+SKPFY+SL V D+GNLRDGTP+  +   +   A   N NL  +G+NC 
Sbjct: 181 LKSLLSWDEKKVSKPFYISLSVHDNGNLRDGTPMHLITDYIKSLATAINPNLTFLGVNCV 240

Query: 237 SLSVSSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQEY 296
           + + +++ +  ++  L + P+   V+PNSGE+++ +   W   T       SW ++V+ +
Sbjct: 241 NYNKATEIIDSIHNGLPTMPLS--VFPNSGEVFNVEKGIW---TANPEAAASWEAVVKRF 295

Query: 297 RKFGARAIGGCCRTTPLDIQEICKVVDR 324
              G R +GGCCRT P DI++I K V +
Sbjct: 296 ISSGVRIVGGCCRTRPHDIEQISKAVKK 323

>Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)
          Length = 273

 Score =  300 bits (768), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 140/271 (51%), Positives = 195/271 (71%), Gaps = 8/271 (2%)

Query: 3   QQLLEVLRDTDRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDVVN 62
           +QLL    D  +VLV+DGGQGTELENRG+ ++ P+WST+PF  E FW+ D+   +R +V 
Sbjct: 7   KQLLA--DDPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWS-DESSANRKIVK 63

Query: 63  SMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHYLV 122
            MF  ++ AGA++L T+TYQTS+K++  +T I T   YD LL RIV F R CIG++ +L+
Sbjct: 64  EMFNDFLAAGAEILMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLI 123

Query: 123 GSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHELKS 182
           G IGP+ AHV  E+TG+YGP PE ID++QYF+PQ+ NFN+N+ +D++G ET+PN+HELK+
Sbjct: 124 GCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKA 183

Query: 183 ILSWDETKISKPFYVSLCVGDDGNLRDGTPLE---QLVPLFANRSNKNLLLVGINCCSLS 239
           ILSWDE+ +SKPFY+ L V + G LRDGT +E   +++    ++ N N LL+GINC S +
Sbjct: 184 ILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFN 243

Query: 240 VSSQALSHLNEILASTPMGLLVYPNSGEIYD 270
            S   L  L+  L + P  LL YPNSGE+YD
Sbjct: 244 QSPDILESLHRALPNMP--LLAYPNSGEVYD 272

>Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W
           (REAL)
          Length = 259

 Score =  265 bits (678), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 128/253 (50%), Positives = 177/253 (69%), Gaps = 10/253 (3%)

Query: 76  LSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHYLVGSIGPYAAHVGAE 135
           L T+TYQTS+K++  +T I T   YD LL RIV F R CIG++ +L+G IGP+ AHV  E
Sbjct: 11  LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE 70

Query: 136 YTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHELKSILSWDETKISKPF 195
           +TG+YGP PE ID++QYF+PQ+ NFN+N+ +D++G ET+PN+HELK+ILSWDE+ +SKPF
Sbjct: 71  FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF 130

Query: 196 YVSLCVGDDGNLRDGTPLE---QLVPLFANRSNKNLLLVGINCCSLSVSSQALSHLNEIL 252
           Y+ L V + G LRDGT +E   +++    ++ N N LL+GINC S + S   L  L+  L
Sbjct: 131 YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL 190

Query: 253 ASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRL-SWPSLVQEYRKFGARAIGGCCRTT 311
            + P  LL YPNSGE+YD + + W      +S +L SW ++V++Y   GAR IGGCCRTT
Sbjct: 191 PNMP--LLAYPNSGEVYDTEKKIWLP----NSDKLNSWDTVVKQYIGSGARIIGGCCRTT 244

Query: 312 PLDIQEICKVVDR 324
           P DIQE+   V +
Sbjct: 245 PKDIQEVSAAVKK 257

>SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar to
           uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 326

 Score =  264 bits (674), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 146/335 (43%), Positives = 214/335 (63%), Gaps = 24/335 (7%)

Query: 2   RQQLLEVLRDTDRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDVV 61
           RQ + E L  +  +LV+DGGQGTE+E RG+++  P+WST+PF K+   + +        +
Sbjct: 3   RQPIAEYLESS--ILVLDGGQGTEMERRGIDVIHPLWSTLPFIKKNPTHLNH-------I 53

Query: 62  NSMFKAYVDAGAQLLSTVTYQTSYKTICAHTD--IHTRTQYDQLLDRIVGFCR-RCIGDD 118
             M+  +  +GA+ LST+TYQ S+ T+  ++D  + T  QY Q L+ I+GF R +CI D 
Sbjct: 54  KGMYHDFSTSGARALSTITYQASFATLKQYSDGQVVTEQQYQQFLNDIIGFTRDQCISDS 113

Query: 119 HYLVGSIGPYAAHV--GAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPN 176
            YL+G +GPYAA++  GAEY+GDYG   E+ID+ QYF+PQ+  F+R++ ID++G ET+PN
Sbjct: 114 QYLIGCVGPYAAYLCNGAEYSGDYGS--EKIDFKQYFKPQLDVFSRDDRIDMVGFETIPN 171

Query: 177 VHELKSILSWDETKI--SKPFYVSLCVGDDGNLRDGTPLEQLVPLF--ANRSN-KNLLLV 231
           + ELK++LS D T +  +KPFY+S+    +GNLRDGTP+ ++      A++S   NLL +
Sbjct: 172 IEELKTLLSKDFTSMLGTKPFYISISTDSNGNLRDGTPVAKICETIKDADKSTPPNLLFL 231

Query: 232 GINCCSLSVSSQALSHLNEILASTPMGLL--VYPNSGEIYDHKTQTWSRPTGLDSHRLSW 289
           GINC     S   LS LN  L      L   VYPNSGEIYD  T TW   + + +  L+W
Sbjct: 232 GINCVDYHHSYNILSRLNGGLGDDCSLLFKAVYPNSGEIYDGNTHTWHTNSEI-APELTW 290

Query: 290 PSLVQEYRKFGARAIGGCCRTTPLDIQEICKVVDR 324
             LV ++ +   + IGGCCRTTP DI++I   V++
Sbjct: 291 NYLVSKFAEQKCQLIGGCCRTTPDDIKQIADAVNK 325

>Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  222 bits (566), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 103/200 (51%), Positives = 144/200 (72%), Gaps = 5/200 (2%)

Query: 78  TVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHYLVGSIGPYAAHVGAEYT 137
           T TYQTSYK++  +T I T ++Y+ LL RIV F R CIG++ YL+G IGP+ AH+  E+T
Sbjct: 2   TTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRDCIGENKYLIGCIGPWGAHICREFT 61

Query: 138 GDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHELKSILSWDETKISKPFYV 197
           GDYGP PE ID+++YF+PQ+ NFN+N+ +D+IG ET+PNVHEL++ILSWDE+ +SKPFY+
Sbjct: 62  GDYGPDPESIDFYEYFKPQLDNFNKNDKLDLIGFETIPNVHELRAILSWDESILSKPFYI 121

Query: 198 SLCVGDDGNLRDGTPLEQLVPL---FANRSNKNLLLVGINCCSLSVSSQALSHLNEILAS 254
            L V + G LRDGT +E++  +     ++ N N  L+GINC S + S   L  L++ L  
Sbjct: 122 GLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQALPD 181

Query: 255 TPMGLLVYPNSGEIYDHKTQ 274
             M LL YPNSGE+YD + +
Sbjct: 182 --MALLAYPNSGEVYDTEKK 199

>Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  222 bits (566), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 146/200 (73%), Gaps = 5/200 (2%)

Query: 78  TVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHYLVGSIGPYAAHVGAEYT 137
           T TYQTSYK++  +T I T ++Y+ LL RIV F R CIG+D YL+G IGP+ AH+  E+T
Sbjct: 2   TTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRVCIGEDKYLIGCIGPWGAHICCEFT 61

Query: 138 GDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHELKSILSWDETKISKPFYV 197
           GDYGP P+ ID+++YF+PQ+ NFN+++ +D+IG ET+PNVHEL++ILSWDE+ +SKPFY+
Sbjct: 62  GDYGPDPQSIDFYKYFKPQLDNFNKSDKLDLIGFETIPNVHELRAILSWDESILSKPFYI 121

Query: 198 SLCVGDDGNLRDGTPLEQLVPL---FANRSNKNLLLVGINCCSLSVSSQALSHLNEILAS 254
            L V + G LRDGT +E++  +     ++ N N  L+GINC S + S   L  L+++L +
Sbjct: 122 GLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQVLPN 181

Query: 255 TPMGLLVYPNSGEIYDHKTQ 274
             M LL YPNSGE+YD + +
Sbjct: 182 --MALLAYPNSGEVYDTEKK 199

>AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 370

 Score =  228 bits (581), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 127/322 (39%), Positives = 190/322 (59%), Gaps = 22/322 (6%)

Query: 15  VLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDVVNSMFKAYVDAGAQ 74
           VLVMDGG G ELE RGM++  P+WST PF + +           D +  +++ +  AG++
Sbjct: 59  VLVMDGGMGVELERRGMDVKSPLWSTAPFLRGD-------RAALDTIRGLYREFRAAGSR 111

Query: 75  LLSTVTYQTSYKTICAHT-DIHTRTQYDQLLDRIVGFC-RRCIGDDH-YLVGSIGPYAAH 131
            +ST+TYQ S+ ++  ++  + +R  Y++ L+++V F  R C+     Y++GS+GPYAA 
Sbjct: 112 GISTLTYQASFHSMVKYSGSVSSRADYEKFLEQVVDFTYRECVDPARDYIIGSVGPYAAF 171

Query: 132 V--GAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHELKSILSWDET 189
           +  GAEYTGDYG   E I+++ YFEPQV+ F  +  ID I  ETVPNV EL ++L  +  
Sbjct: 172 LCNGAEYTGDYG--FETINFFNYFEPQVSKFATDPRIDAIAFETVPNVVELMAMLQPEFH 229

Query: 190 KI--SKPFYVSLCVGDDGNLRDGTPLEQLVPLFANRSNK---NLLLVGINCCSLSVSSQA 244
            +  +KPFY+S+   D+  LRDGTPL  +  L   R +    NLL  G+NC  L+ S+  
Sbjct: 230 ALLKNKPFYISISAKDEHVLRDGTPLAVVGQLIRERMDDLPPNLLCFGLNCVDLTRSAAM 289

Query: 245 LSHLNEILASTPMGL-LVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQEYRKFGARA 303
           L+ LN  L   P+    +YPN   ++D     W RP+  D+  L+W   V+ Y     R 
Sbjct: 290 LAELNMQLQDCPIKFQAIYPNGTSVFDESLSAW-RPSK-DAESLTWAEAVKLYLNQDCRM 347

Query: 304 IGGCCRTTPLDIQEICKVVDRN 325
           IGGCC TTP D+++I + +D N
Sbjct: 348 IGGCCGTTPQDMRQIAEALDVN 369

>Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MHT1)
           - S-methylmethionine:homocysteine S-methyltransferase
           [contig 86] FULL
          Length = 332

 Score =  222 bits (565), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 125/337 (37%), Positives = 196/337 (58%), Gaps = 27/337 (8%)

Query: 1   MRQQLLEVLRDTDRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDV 60
           MR QL E L+    +L++DGGQGTELE RG+NI+ P+WST+P+  ++  +         +
Sbjct: 1   MRLQLEEYLKH--EILLLDGGQGTELEKRGINIAHPLWSTLPYVTKDKKHL-------KI 51

Query: 61  VNSMFKAYVDAGAQLLSTVTYQTSYKTICAHTD--IHTRTQYDQLLDRIVGFCR-RCIGD 117
           +  M+ A+  AG   L T+TYQ S+ ++  H+D  I+   +Y + LD ++ +   +CI  
Sbjct: 52  IKEMYSAFESAGCNALMTITYQASFLSMKNHSDGLINNEKEYTRFLDYVIDYTENQCISP 111

Query: 118 DHYLVGSIGPYAAHV--GAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVP 175
           + YLVGS+GPYAA++  GAEY+G Y    + ID+ ++F PQV +F  +  ID+IG+ET+P
Sbjct: 112 NSYLVGSVGPYAAYLSNGAEYSGHY--IEDNIDFIEFFRPQVQHFAVSSRIDLIGIETIP 169

Query: 176 NVHELKSILSWDETKIS--KPFYVSLCVGDDGNLRDGTPLEQLVPLFANRSNK---NLLL 230
           N  E K++L  + +++   KP+Y+S+   ++GNLRDGT  + +       +     NL+ 
Sbjct: 170 NFEEFKALLRPEFSRLCALKPYYISITTDNEGNLRDGTARQDICETIKRSAQDLPPNLVF 229

Query: 231 VGINCCSLSVSSQALSHLNEILASTPMG-----LLVYPNSGEIYDHKTQTWSRPTGLDSH 285
            GINC S +  +  L  LN+ L    +        VYPNSGE+Y   T +W  P      
Sbjct: 230 FGINCVSFAHCADILKLLNDSLDDIGVENRLRFRAVYPNSGEVYHGDTHSWG-PNPEIGP 288

Query: 286 RLSWPSLVQEYRKFGARAIGGCCRTTPLDIQEICKVV 322
             +W +L  +  + G   IGGCCRT+P D+++I  VV
Sbjct: 289 ADTWENLASKVVQQGCLMIGGCCRTSPADLRQIASVV 325

>KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 348

 Score =  204 bits (518), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 118/340 (34%), Positives = 186/340 (54%), Gaps = 27/340 (7%)

Query: 1   MRQQLLEVLRDTDRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDV 60
           MR+ L E  ++   +L++DGGQGTELE +G++IS P+WST+PF  +         T  + 
Sbjct: 1   MRKPLKEFFKNN--ILLLDGGQGTELEKKGVSISHPLWSTLPFIIKN-------KTHLEA 51

Query: 61  VNSMFKAYVDAGAQLLSTVTYQTSYKTICAHTD--IHTRTQYDQLLDRIVGFC-RRCIGD 117
           +  M++ + +AG+  L T+TYQ S+ ++  +++  +++   Y   LD ++GF  R CI  
Sbjct: 52  IKEMYRDFAEAGSNALMTITYQASFSSMKKYSEGLVNSEEDYAAFLDYVIGFTDRECITP 111

Query: 118 DHYLVGSIGPYAAHV--GAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVP 175
           D YLVGS+GPYA  +  GAEY+G YG    +ID+  Y+ PQV +F  +  ID+IG+ET+P
Sbjct: 112 DKYLVGSVGPYAGLLSNGAEYSGYYGEG--KIDFIDYYSPQVKHFALSPRIDLIGIETIP 169

Query: 176 NVHELKSILS--WDETKISKPFYVSLCVGDDGNLRDGTPLEQLVPLFANRSN---KNLLL 230
           N+ E K++LS  +     SKP+Y+S+   ++G LRDGT L ++       ++    N + 
Sbjct: 170 NIDEFKALLSPEFSRLSFSKPYYISVTTDNNGCLRDGTSLNEICRAIKQSASLLPDNFVF 229

Query: 231 VGINCCSLSVSSQALSHLNEILASTPMGLL-----VYPNSGEIYDHKTQTWSRPTGLDSH 285
             INC       + L  LN+ L    +         YPNSGEIY   T +WS        
Sbjct: 230 FAINCVEFLHCVEILQSLNDCLEMQGVDRRFRFRGAYPNSGEIYHGGTHSWSS-NPYAGP 288

Query: 286 RLSWPSLVQEYRKFGARAIGGCCRTTPLDIQEICKVVDRN 325
             +W +L           +GGCCRT   +I+++     +N
Sbjct: 289 EDTWENLTLGLLSQECLMLGGCCRTGSEEIRQMALTTKKN 328

>Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)
          Length = 96

 Score =  103 bits (257), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 46/92 (50%), Positives = 68/92 (73%), Gaps = 3/92 (3%)

Query: 3  QQLLEVLRDTDRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDVVN 62
          +QLLE   +  +VLV+DGGQGTELENRG+ ++ P+WST+PF  + FW+ D+   +R +V 
Sbjct: 7  KQLLE--DNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWS-DESSANRKIVK 63

Query: 63 SMFKAYVDAGAQLLSTVTYQTSYKTICAHTDI 94
           MF  +++AGA++L T TYQTSYK++  +T I
Sbjct: 64 GMFNDFLNAGAEILMTTTYQTSYKSVSENTPI 95

>YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON}
           Putative protein of unknown function; proposed to be a
           palmitoylated membrane protein
          Length = 105

 Score = 88.2 bits (217), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 65/106 (61%), Gaps = 7/106 (6%)

Query: 220 FANRSNKNLLLVGINCCSLSVSSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRP 279
             ++ N NL  +GINC S + S   L  L++ L +  M LL YPNSGE+YD + + W   
Sbjct: 4   LGDKINPNLSFLGINCVSFNQSPDILESLHQALPN--MALLAYPNSGEVYDTEKKIWLP- 60

Query: 280 TGLDSHRL-SWPSLVQEYRKFGARAIGGCCRTTPLDIQEICKVVDR 324
              +S +L SW ++V++Y   GAR IGGCCRT+P DIQEI   V +
Sbjct: 61  ---NSDKLNSWDTVVKQYISSGARIIGGCCRTSPKDIQEISAAVKK 103

>Smik_8.294 Chr8 (481015..483405) [2391 bp, 796 aa] {ON} YHR204W
           (REAL)
          Length = 796

 Score = 37.4 bits (85), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 37/85 (43%), Gaps = 10/85 (11%)

Query: 89  CAHTDIHTRTQYDQLLDRIVGFCRRCIGDDH---YLVGSIGPYAAHVGAEYTGDYGPKPE 145
           C   D   + + + L  RIVGF +     D     + G I  Y   + AE  G    KP 
Sbjct: 528 CQRKDKELQAEVNTLSQRIVGFAKSIFQQDQPDKEVAGVIPEY--QINAEIPGTCSMKPR 585

Query: 146 EI---DYWQYFEPQVANFNRNETID 167
            +   +YW  + P ++NFNR   ID
Sbjct: 586 HVIDNEYW--YSPMLSNFNRLFEID 608

>TPHA0D04300 Chr4 (928596..929870) [1275 bp, 424 aa] {ON} Anc_8.185
           YER143W
          Length = 424

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 49/103 (47%), Gaps = 20/103 (19%)

Query: 24  TELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDVVNSMFKAYVDAGAQLLSTVTYQT 83
           TEL N+  +I   + + + +T E F      Y D ++  +  KA+VD GAQ+        
Sbjct: 181 TELTNQ-QDIDEQMRNALEYTPEVFTTVSMLYIDLEINGTAVKAFVDTGAQM-------- 231

Query: 84  SYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHYL-VGSI 125
              TI + T +  +T  D+L+D      +R  G+ H + VG I
Sbjct: 232 ---TILS-TKLAKKTGLDRLID------KRFTGEAHGVGVGKI 264

>Kwal_55.21496 s55 (863465..866290) [2826 bp, 941 aa] {ON} YDR359C
           (VID21) - vacuolar import degradation [contig 129] FULL
          Length = 941

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 29/69 (42%), Gaps = 11/69 (15%)

Query: 117 DDHYLVGSIGPYA-------AHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDII 169
           DDH LV +I  YA       AHV +  T  Y    E    WQ FE  V    R + ID+ 
Sbjct: 596 DDHELVKNINTYAYNWELISAHVSSRPTRSYCSNIERRTPWQCFERFVQLNERFQFIDMK 655

Query: 170 GLETVPNVH 178
           G    P  H
Sbjct: 656 G----PRAH 660

>Kwal_23.4373 s23 complement(691827..693134) [1308 bp, 435 aa] {ON}
           YHR176W - 1:1 [contig 1] FULL
          Length = 435

 Score = 30.0 bits (66), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 14/58 (24%), Positives = 34/58 (58%)

Query: 7   EVLRDTDRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDVVNSM 64
           E+ RD + V+V +G  G+++ N+  +++  ++ +VP   +  WN +   T   V++++
Sbjct: 181 ELYRDKNVVVVGNGSSGSDIANQVSSVAKHVYHSVPDVGKTQWNENPVVTAVPVISNL 238

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.427 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,460,083
Number of extensions: 1686332
Number of successful extensions: 3889
Number of sequences better than 10.0: 41
Number of HSP's gapped: 3831
Number of HSP's successfully gapped: 41
Length of query: 325
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 215
Effective length of database: 40,868,139
Effective search space: 8786649885
Effective search space used: 8786649885
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)