Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0G14190g8.840ON61061033060.0
YMR278W (PGM3)8.840ON62261621340.0
Smik_13.4918.840ON62260620820.0
Suva_13.4668.840ON62261620720.0
SAKL0D01474g8.840ON62462020140.0
NCAS0C004108.840ON62561820080.0
TDEL0B005708.840ON63061720020.0
Skud_13.4508.840ON62261419980.0
NDAI0K004108.840ON62662019840.0
KNAG0J002708.840ON62561719390.0
TPHA0I002508.840ON62962019100.0
CAGL0M02981g8.840ON61761518970.0
Kpol_1068.88.840ON63262118930.0
Kwal_27.102588.840ON62061818430.0
TBLA0B032508.840ON64363518240.0
KAFR0B039208.840ON62461418150.0
KLTH0C03872g8.840ON62162118140.0
KLLA0D01573g8.840ON60761717530.0
Ecym_46118.840ON63062617550.0
ABL126W8.840ON62462017470.0
CAGL0K07480g2.445ON567375980.003
TBLA0I013802.445ON571486980.004
TDEL0G046006.11ON52897940.009
NCAS0F002006.11ON54928930.012
SAKL0E03630g2.445ON571373930.013
TDEL0E00210singletonON570305910.024
CAGL0B03597g6.11ON54030900.027
TBLA0G009806.11ON55828900.029
KNAG0E009406.11ON538117890.034
CAGL0K03421g2.445ON568367890.036
Smik_13.2912.445ON569367890.038
NDAI0K028906.11ON56130880.047
YMR105C (PGM2)2.445ON569367880.055
Kpol_1032.26.11ON53928870.056
ZYRO0F00506g6.11ON550108870.062
KLTH0D04796g2.445ON570449870.068
NCAS0F014702.445ON569369860.083
KAFR0L003406.11ON54028860.087
Smik_5.296.11ON55549850.11
YEL058W (PCM1)6.11ON55728850.13
Skud_5.316.11ON55728840.13
Kpol_1033.542.445ON570128840.14
Suva_5.106.11ON55328840.14
TPHA0G029002.445ON569370820.23
KAFR0D030102.445ON569370820.27
KLLA0D00858g6.11ON54156810.32
TDEL0A022102.445ON572373810.35
Kwal_56.223556.11ON54120810.37
KLTH0C11506g6.11ON54420810.38
ZYRO0G02508g2.445ON569367800.40
Kpol_1018.1612.445ON569414800.41
SAKL0E00902g6.11ON54419800.45
KNAG0A062802.445ON570130800.46
TBLA0B090102.445ON569302790.61
ACR015W6.11ON55238790.63
Skud_13.2632.445ON569367780.81
TPHA0M002106.11ON54528770.93
NCAS0A043502.445ON569371770.99
SAKL0A09570g2.536ON21160751.2
Skud_11.1022.445ON570127751.9
KNAG0E023902.445ON569370752.0
Suva_13.2822.445ON569270742.2
ABL029W2.445ON568128742.6
Skud_7.5675.96ON115641742.7
Ecym_30146.11ON55119732.9
NDAI0H023502.445ON569367733.0
TBLA0A083804.190ON39956714.7
KLLA0E18459g2.536ON14826684.9
TPHA0G024702.445ON569128715.6
Kwal_26.76282.445ON570127698.2
TDEL0D010904.309ON642145698.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0G14190g
         (610 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...  1278   0.0  
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...   826   0.0  
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...   806   0.0  
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...   802   0.0  
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...   780   0.0  
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...   778   0.0  
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...   775   0.0  
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...   774   0.0  
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...   768   0.0  
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...   751   0.0  
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...   740   0.0  
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...   735   0.0  
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...   733   0.0  
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...   714   0.0  
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...   707   0.0  
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...   703   0.0  
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...   703   0.0  
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...   679   0.0  
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...   680   0.0  
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...   677   0.0  
CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa] ...    42   0.003
TBLA0I01380 Chr9 complement(297671..299386) [1716 bp, 571 aa] {O...    42   0.004
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...    41   0.009
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...    40   0.012
SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {...    40   0.013
TDEL0E00210 Chr5 (28244..29956) [1713 bp, 570 aa] {ON} Anc_2.445...    40   0.024
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...    39   0.027
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...    39   0.029
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...    39   0.034
CAGL0K03421g Chr11 complement(314680..316386) [1707 bp, 568 aa] ...    39   0.036
Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {...    39   0.038
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....    39   0.047
YMR105C Chr13 complement(475897..477606) [1710 bp, 569 aa] {ON} ...    39   0.055
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...    38   0.056
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...    38   0.062
KLTH0D04796g Chr4 (437416..439128) [1713 bp, 570 aa] {ON} highly...    38   0.068
NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {O...    38   0.083
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...    38   0.087
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)    37   0.11 
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...    37   0.13 
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)    37   0.13 
Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON} (1362...    37   0.14 
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)    37   0.14 
TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON}               36   0.23 
KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.4...    36   0.27 
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...    36   0.32 
TDEL0A02210 Chr1 (400375..402093) [1719 bp, 572 aa] {ON} Anc_2.4...    36   0.35 
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...    36   0.37 
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...    36   0.38 
ZYRO0G02508g Chr7 (192411..194120) [1710 bp, 569 aa] {ON} highly...    35   0.40 
Kpol_1018.161 s1018 (412372..414081) [1710 bp, 569 aa] {ON} (412...    35   0.41 
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...    35   0.45 
KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON}               35   0.46 
TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa] ...    35   0.61 
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...    35   0.63 
Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {...    35   0.81 
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...    34   0.93 
NCAS0A04350 Chr1 (878688..880397) [1710 bp, 569 aa] {ON} Anc_2.4...    34   0.99 
SAKL0A09570g Chr1 complement(838406..839041) [636 bp, 211 aa] {O...    33   1.2  
Skud_11.102 Chr11 (190406..192118) [1713 bp, 570 aa] {ON} YKL127...    33   1.9  
KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.4...    33   2.0  
Suva_13.282 Chr13 complement(457565..459274) [1710 bp, 569 aa] {...    33   2.2  
ABL029W Chr2 (343850..345556) [1707 bp, 568 aa] {ON} Syntenic ho...    33   2.6  
Skud_7.567 Chr7 complement(929563..933033) [3471 bp, 1156 aa] {O...    33   2.7  
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...    33   2.9  
NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {O...    33   3.0  
TBLA0A08380 Chr1 (2060218..2061417) [1200 bp, 399 aa] {ON} Anc_4...    32   4.7  
KLLA0E18459g Chr5 (1641507..1641953) [447 bp, 148 aa] {ON} simil...    31   4.9  
TPHA0G02470 Chr7 (507445..509154) [1710 bp, 569 aa] {ON} Anc_2.4...    32   5.6  
Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C...    31   8.2  
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    31   8.8  

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score = 1278 bits (3306), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 610/610 (100%), Positives = 610/610 (100%)

Query: 1   MSSNIPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARM 60
           MSSNIPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARM
Sbjct: 1   MSSNIPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARM 60

Query: 61  EAGFSRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFE 120
           EAGFSRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFE
Sbjct: 61  EAGFSRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFE 120

Query: 121 VHYLNQGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDSA 180
           VHYLNQGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDSA
Sbjct: 121 VHYLNQGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDSA 180

Query: 181 IARSIESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFVTELDSLPKG 240
           IARSIESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFVTELDSLPKG
Sbjct: 181 IARSIESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFVTELDSLPKG 240

Query: 241 KPWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEEKGAL 300
           KPWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEEKGAL
Sbjct: 241 KPWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEEKGAL 300

Query: 301 DLAIKLAENHGIKLVIASDPDADRFSVAFKGPHGWQQLSGNDIGFLFAYYELQKYRGFDA 360
           DLAIKLAENHGIKLVIASDPDADRFSVAFKGPHGWQQLSGNDIGFLFAYYELQKYRGFDA
Sbjct: 301 DLAIKLAENHGIKLVIASDPDADRFSVAFKGPHGWQQLSGNDIGFLFAYYELQKYRGFDA 360

Query: 361 EYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYVPFGFE 420
           EYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYVPFGFE
Sbjct: 361 EYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYVPFGFE 420

Query: 421 EAIGYMFPATEHDKDGISAAVVFLQAYHSWISQGKSPLDILDEASAKYGVFREYNGYYLV 480
           EAIGYMFPATEHDKDGISAAVVFLQAYHSWISQGKSPLDILDEASAKYGVFREYNGYYLV
Sbjct: 421 EAIGYMFPATEHDKDGISAAVVFLQAYHSWISQGKSPLDILDEASAKYGVFREYNGYYLV 480

Query: 481 DEPSLTNKTFAYIREDYTPKGENYPRTIGDLQVKTFRDLTTGYQSDTPNNIPNLHVDPSS 540
           DEPSLTNKTFAYIREDYTPKGENYPRTIGDLQVKTFRDLTTGYQSDTPNNIPNLHVDPSS
Sbjct: 481 DEPSLTNKTFAYIREDYTPKGENYPRTIGDLQVKTFRDLTTGYQSDTPNNIPNLHVDPSS 540

Query: 541 QMITIVAQPKGGGSGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQTWDILREEW 600
           QMITIVAQPKGGGSGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQTWDILREEW
Sbjct: 541 QMITIVAQPKGGGSGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQTWDILREEW 600

Query: 601 FNRPGLTTKF 610
           FNRPGLTTKF
Sbjct: 601 FNRPGLTTKF 610

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score =  826 bits (2134), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/616 (63%), Positives = 480/616 (77%), Gaps = 12/616 (1%)

Query: 5   IPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARMEAGF 64
           +P +LK PISLW  QDRN KT +E+  LC   +W+ELH+R +SR+QFGTAGLR++M+AGF
Sbjct: 9   VPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGLRSQMQAGF 68

Query: 65  SRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFEVHYL 124
           SRMNTLVVIQA+QGLA Y+++QFPD+LVAVVGHDHRF+S +FA+ATA   L  GF+VHYL
Sbjct: 69  SRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLLKGFKVHYL 128

Query: 125 NQGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDSAIARS 184
           N    +VHTP+VPF VD++KASVGVMITASHNPK+DNGYKVYY+NGCQIIPPHD AI+ S
Sbjct: 129 NPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDHAISDS 188

Query: 185 IESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFVTELDSLP---KGK 241
           I++NLEP   VWD+D  + +A  +GKL+Y R++ML+ Y+  V  + V E++ L    K K
Sbjct: 189 IDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLV-EINPLKLEVKAK 247

Query: 242 PWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEEKGALD 301
           PWFVYTPMHGVG+ +F  I  K L L   +D+L V EQ NPDP FPTV FPNPEEKGALD
Sbjct: 248 PWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALD 307

Query: 302 LAIKLAENHGIKLVIASDPDADRFSVAFKGPHG--WQQLSGNDIGFLFAYYELQKYRGFD 359
           + I LAE H I L++A+DPDADRFSVA K      W+QL+GN+IGFLFA+YE QKY+  D
Sbjct: 308 IGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYEYQKYKSMD 367

Query: 360 AEYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYVPFGF 419
            E+Q  HPLAMLNSTVSSQMI  MA +EGFH+EDTLTGFKWIGNRA+ LE +GYYVPFGF
Sbjct: 368 KEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKGYYVPFGF 427

Query: 420 EEAIGYMFPATEHDKDGISAAVVFLQAYHSW-ISQGKSPLDILDEASAKYGVFREYNGYY 478
           EEAIGYMFPA EHDKDGISA++VFLQAY  W I     PL++L+    KYGVF+EYNGYY
Sbjct: 428 EEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYGVFKEYNGYY 487

Query: 479 LVDEPSLTNKTFAYIREDYTPKGENYPRTIG-DLQVKTFRDLTTGYQSDTPNNIPNLHVD 537
           +V  P++T   F YIR  YTP+G +YP +IG +++V  +RDLTTGYQSDT N+ P L VD
Sbjct: 488 VVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINHKPTLPVD 547

Query: 538 PSSQMITIVAQPKGGGSGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQTWDILR 597
           P+SQMIT+ A+P  G   EH+RFT+RGSGTEPKLKVYIEA A  + RA  LA+ TW++LR
Sbjct: 548 PTSQMITVSARPSNGSENEHIRFTIRGSGTEPKLKVYIEACANEEQRASFLAKLTWNVLR 607

Query: 598 EEWFNRP---GLTTKF 610
            EWF RP    + TKF
Sbjct: 608 REWF-RPDEMNIVTKF 622

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  806 bits (2082), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/606 (62%), Positives = 471/606 (77%), Gaps = 7/606 (1%)

Query: 5   IPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARMEAGF 64
           +P NLK+ ISLW  QD+N +T +E+  LC   +W+ELH R +SR+QFGTAGLR++M+AGF
Sbjct: 9   VPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGLRSQMQAGF 68

Query: 65  SRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFEVHYL 124
           +RMNTLV+IQA+QGLA Y K+QFP++LVAVVGHDHRF+S +FA+ATAT  L  GF+VHYL
Sbjct: 69  NRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLLKGFKVHYL 128

Query: 125 NQGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDSAIARS 184
           N    +VHTP+VPF VD++KASVGVM+TASHNPK+DNGYKVYY+NGCQIIPPHD AI+ S
Sbjct: 129 NPDHEFVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDHAISDS 188

Query: 185 IESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFVTE--LDSLPKGKP 242
           I+ NLEP   VW++D  + +   +GKL+Y R+++L+ Y+  V  + V    L    K KP
Sbjct: 189 IDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGTDPLKFEVKAKP 248

Query: 243 WFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEEKGALDL 302
           WFVYTPMHGVG+ +F  I  K + L   +D+L V EQ  PDP FPTV FPNPEEKGALDL
Sbjct: 249 WFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNPEEKGALDL 308

Query: 303 AIKLAENHGIKLVIASDPDADRFSVAFKGPHG--WQQLSGNDIGFLFAYYELQKYRGFDA 360
            I LAENHGI L+IA+DPDADRFSVA K      W+QL+GN+IGFLFA +E QK++  + 
Sbjct: 309 GINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEFQKFKSMEK 368

Query: 361 EYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYVPFGFE 420
           ++Q +HPLAML+STVSSQMI  MA +EGFH+E+TLTGFKWIGNRA+ LE  GYYVPFGFE
Sbjct: 369 QFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEGYYVPFGFE 428

Query: 421 EAIGYMFPATEHDKDGISAAVVFLQAYHSW-ISQGKSPLDILDEASAKYGVFREYNGYYL 479
           EAIGYMFPA EHDKDG+SA++VFLQAY  W I     P+ IL++   KYGVF+EYNGYY+
Sbjct: 429 EAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKYGVFKEYNGYYI 488

Query: 480 VDEPSLTNKTFAYIREDYTPKGENYPRTIG-DLQVKTFRDLTTGYQSDTPNNIPNLHVDP 538
           V  P +TN+ F YIR  YTPKG +YP +IG +++V  +RDLT GYQSDT N+ P L +DP
Sbjct: 489 VSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNHKPTLPIDP 548

Query: 539 SSQMITIVAQPKGGGSGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQTWDILRE 598
           SSQMIT+ A+P  G  GEH+RFT+RGSGTEPK+KVYIEA A  + RA  LA+ TW++L+ 
Sbjct: 549 SSQMITVSAKPSDGNEGEHIRFTIRGSGTEPKIKVYIEACADEEQRATFLAKLTWNVLKR 608

Query: 599 EWFNRP 604
           EWF RP
Sbjct: 609 EWF-RP 613

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  802 bits (2072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/616 (62%), Positives = 469/616 (76%), Gaps = 12/616 (1%)

Query: 5   IPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARMEAGF 64
           +P +LK PISLW  QDRN +T +E+  LC   +W ELH+R ++R+QFGTAGLR+ M+AGF
Sbjct: 9   VPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGLRSEMQAGF 68

Query: 65  SRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFEVHYL 124
           SRMNTLV+IQATQGLA YIK+QFPD+LV VVGHDHRF+S +FA+ATAT  L  GF+VHYL
Sbjct: 69  SRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLLKGFKVHYL 128

Query: 125 NQGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDSAIARS 184
           N    +VHTP+VPF VD++KASVGVMITASHNPK+DNGYKVYY+NGCQIIPPHD AI+ S
Sbjct: 129 NPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDHAISDS 188

Query: 185 IESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFVTELDSLP---KGK 241
           I+ NLEP   VW +   + +A  +GKL+Y R++ML  Y   V  + V E + L    K K
Sbjct: 189 IDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLV-ETNPLKLEIKAK 247

Query: 242 PWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEEKGALD 301
           PWFVYTPMHGVG+ +F  I  K + L    D+L V EQ NPDP FPTV FPNPEEKGALD
Sbjct: 248 PWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNPEEKGALD 307

Query: 302 LAIKLAENHGIKLVIASDPDADRFSVAFKGPHG--WQQLSGNDIGFLFAYYELQKYRGFD 359
           + ++LAE H I L++A+DPDADRFS+A K      W+QL+GN+IGFLFA++E Q+Y+  D
Sbjct: 308 IGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFFEFQRYKNKD 367

Query: 360 AEYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYVPFGF 419
            E+Q+SHPLAML+STVSSQMI  MA +EGF +EDTLTGFKWIGNRA+ LE  GYYVPFGF
Sbjct: 368 EEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEKEGYYVPFGF 427

Query: 420 EEAIGYMFPATEHDKDGISAAVVFLQAYHSW-ISQGKSPLDILDEASAKYGVFREYNGYY 478
           EEAIGYMFPA EHDKDGISAAVV LQAY  W I     P+DIL+    KYGVF+EYNGYY
Sbjct: 428 EEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVFKEYNGYY 487

Query: 479 LVDEPSLTNKTFAYIREDYTPKGENYPRTIG-DLQVKTFRDLTTGYQSDTPNNIPNLHVD 537
           +V  P +T + F YIR  YTP G  YP +IG +++V  +RDLTTGYQSDTP++ P L VD
Sbjct: 488 VVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDHKPVLPVD 547

Query: 538 PSSQMITIVAQPKGGGSGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQTWDILR 597
           P+SQMIT+  +P  G   EH+RFT+RGSGTEPKLKVYIEA A ++ RA  LA+ TWD+LR
Sbjct: 548 PTSQMITLSGKPSDGNGNEHIRFTIRGSGTEPKLKVYIEACADNEKRASYLAKLTWDVLR 607

Query: 598 EEWFNRP---GLTTKF 610
             WF RP    +TT F
Sbjct: 608 RGWF-RPEIMNITTDF 622

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score =  780 bits (2014), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/620 (60%), Positives = 465/620 (75%), Gaps = 13/620 (2%)

Query: 3   SNIPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARMEA 62
           + +P++LK+ ++LWL  D+N +T  E+  L + ++W ELH RL+ R+ FGTAGLR+RMEA
Sbjct: 6   TTVPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRMEA 65

Query: 63  GFSRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFEVH 122
           GFSRMNTL V+QA+QGLA YIK QFP++L  +VGHDHR++S +FA+ T T  L+ GF+V+
Sbjct: 66  GFSRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQLGFKVY 125

Query: 123 YLN-----QGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPPH 177
           YLN       +++VHTPMVPFT++++ AS G+MITASHNPK+DNGYKVYY+NGCQIIPPH
Sbjct: 126 YLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQIIPPH 185

Query: 178 DSAIARSIESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFVTELDSL 237
           D  I+ +I+ NL P N  WD D+ ++ A + G L   ++K+  +YI  V D  V  +  L
Sbjct: 186 DRLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELV-RVPML 244

Query: 238 PKGKPWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEEK 297
              KPWFVYTPMHGVG+++F+QIA   L L+  + ++ V EQ  PDP FPTV FPNPEEK
Sbjct: 245 DCDKPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEEK 304

Query: 298 GALDLAIKLAENHGIKLVIASDPDADRFSVAFKGPHGWQQLSGNDIGFLFAYYELQKYRG 357
           GALDL+I LAE   I+LVIA+DPDADRFSVA K    W QL+GN+IGFLFAYY+ Q Y+ 
Sbjct: 305 GALDLSIALAEEQDIRLVIANDPDADRFSVAVKNGDRWSQLTGNEIGFLFAYYQWQDYQK 364

Query: 358 FDAEYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYVPF 417
               ++K HPLAM+NSTVSSQMI S+A  E FH+EDTLTGFKW+GNRA ELE +GYYVPF
Sbjct: 365 LGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGYYVPF 424

Query: 418 GFEEAIGYMFPATEHDKDGISAAVVFLQAYHSWISQGK-SPLDILDEASAKYGVFREYNG 476
            +EEAIGYMFP  EHDKDGISAAVVFLQ Y  W+S+ + +PL +LDE   KYGVF+EYNG
Sbjct: 425 AYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGVFKEYNG 484

Query: 477 YYLVDEPSLTNKTFAYIREDYTPKGENYPRTIG-DLQVKTFRDLTTGYQSDTPNNIPNLH 535
           YY+V   SLT + F YIREDYTP G  YP  IG +  V +FRDLTTGYQSDT +N+PNL 
Sbjct: 485 YYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNVPNLP 544

Query: 536 VDPSSQMITIVAQPKGGG---SGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQT 592
           VD SSQMIT   +P  G    SGE VRFT+RGSGTEPKLKVYIEA +  + RA+ LAR+T
Sbjct: 545 VDASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQHLARET 604

Query: 593 WDILREEWFN--RPGLTTKF 610
           W +LR EWF   R GL TKF
Sbjct: 605 WQVLRREWFRPERTGLETKF 624

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  778 bits (2008), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/618 (60%), Positives = 471/618 (76%), Gaps = 11/618 (1%)

Query: 3   SNIPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARMEA 62
           SN PENL++PI+LWL  D+NE+T KE+ +LC+ +NW ELH+R ++R+ FGTAGLR+RMEA
Sbjct: 9   SNCPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRSRMEA 68

Query: 63  GFSRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFEVH 122
           GFSRMN+L+++Q+TQGLA YIK+QFP++L AVVGHDHRF+S +FA  TA++ L+AGF+V 
Sbjct: 69  GFSRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAGFKVF 128

Query: 123 YLNQGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDSAIA 182
           YL   D +VHTP+VPF+V  +KASVGVMITASHNPK+DNGYKVYY N CQIIPPHD  IA
Sbjct: 129 YLTPDDQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQIIPPHDKNIA 188

Query: 183 RSIESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFV--TELDSLPKG 240
             I+ NLEP +  WDWD T ++  +  KL++ +D M E+Y+  +K   +  + L      
Sbjct: 189 EMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSSHLSLKDVK 248

Query: 241 KPWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEEKGAL 300
            P+FVYTPMHGVG ++F +++S++L L  N D+LVVSEQ  PDP FPTV FPNPEEKGAL
Sbjct: 249 TPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPNPEEKGAL 308

Query: 301 DLAIKLAENHGIKLVIASDPDADRFSVAF--KGPHGWQQLSGNDIGFLFAYYELQKYRGF 358
            LAIKLA+ +G+ LVIA+DPDADRFS A   K    W+QL+GN+IGFL  YYE Q Y   
Sbjct: 309 SLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYYEFQLYEQQ 368

Query: 359 DAEYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYVPFG 418
           D  ++K+HPLAM+NSTVSSQMI  MA + GFH+EDTLTGFKWIGN+A++L   GYYVPFG
Sbjct: 369 DVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQEGYYVPFG 428

Query: 419 FEEAIGYMFPATEHDKDGISAAVVFLQAYHSWISQGK-SPLDILDEASAKYGVFREYNGY 477
           FEEAIGYMFP  E DKDGISAA VFLQAY  W++Q + SP DI++E   K+GVF+EYNGY
Sbjct: 429 FEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGVFKEYNGY 488

Query: 478 YLVDEPSLTNKTFAYIREDYTPKGENYPRTIG-DLQVKTFRDLTTGYQSDTPNNIPNLHV 536
           Y++ + S+T   F +IR +Y    + YP  IG +L V  FRDLT GYQS+T +NIPNL V
Sbjct: 489 YILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKDNIPNLPV 548

Query: 537 DPSSQMITIVAQPKGGGSGE-HVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQTWDI 595
           DP+SQMIT+ A+P    + E  VR T+RGSGTEPKLKVYIEA ++S+  A  LAR TWDI
Sbjct: 549 DPTSQMITVEAKPSEFSNLEGTVRLTMRGSGTEPKLKVYIEACSKSEESATNLARSTWDI 608

Query: 596 LREEWFNRP---GLTTKF 610
           L+ EWF RP   GLTT F
Sbjct: 609 LKREWF-RPEVTGLTTSF 625

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/617 (61%), Positives = 467/617 (75%), Gaps = 10/617 (1%)

Query: 3   SNIPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARMEA 62
           +++P +L Q ++ WL+QD N++T  EI  LC A++W ELH+RL++R+ FGTAGLR+RMEA
Sbjct: 15  NSVPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLRSRMEA 74

Query: 63  GFSRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFEVH 122
           GFSRMNTLVV+QATQGLAQ+IKKQFPD L AVVGHDHRFNS +FA AT    L+AGF+V 
Sbjct: 75  GFSRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQAGFKVI 134

Query: 123 YLNQGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDSAIA 182
           +LN GD +VHTP+VPFTV+ V ASVGVMITASHNPK+DNGYKVYY+NGCQIIPPHDS IA
Sbjct: 135 FLNDGDKFVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDSEIA 194

Query: 183 RSIESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFV--TELDSLPKG 240
           +SIE NL      W WD+ +++  D   L+Y  ++M+E+Y   +  S V  T + +  +G
Sbjct: 195 QSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDRTTISAEKEG 254

Query: 241 KPWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEEKGAL 300
           KPWFVYTP+HGVGY +F QIA + + L   RD+L V EQ  PDP FPTV FPNPEEKGAL
Sbjct: 255 KPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPFPNPEEKGAL 314

Query: 301 DLAIKLAENHGIKLVIASDPDADRFSVAFKGPH--GWQQLSGNDIGFLFAYYELQKYRGF 358
           D+AI +A+ +GI LV+A+DPDADRFS A K      W+QL+GN+IG LFA+YE QKY+  
Sbjct: 315 DMAISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGALFAFYEFQKYQKK 374

Query: 359 DAEYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYVPFG 418
           + EY++ HPLAMLNSTVSSQ+I  MA +E FH+ DTLTGFKWIGNR L+LEA  YYVPFG
Sbjct: 375 NEEYKEKHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLDLEAMNYYVPFG 434

Query: 419 FEEAIGYMFPATEHDKDGISAAVVFLQAYHSW-ISQGKSPLDILDEASAKYGVFREYNGY 477
           FEEAIGYMFP  EHDKDGISAA VFLQ Y  W +   K+ L +L++   KYGVF+EYNGY
Sbjct: 435 FEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDIFEKYGVFKEYNGY 494

Query: 478 YLVDEPSLTNKTFAYIREDYTPKGENYPRTIG-DLQVKTFRDLTTGYQSDTPNNIPNLHV 536
           Y V++P +  + F +IR DY+   + YP  IG +L+V  FRDLT GYQSDT N  P+L V
Sbjct: 495 YSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQSDTVNQRPDLPV 554

Query: 537 DPSSQMITIVAQPKGGGSGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQTWDIL 596
           DP+SQMIT   +  G    E VRFT+RGSGTEPKLKVYIEA ++S+ RA ELA+ TW +L
Sbjct: 555 DPNSQMITAWTKVNGAKPYESVRFTIRGSGTEPKLKVYIEACSKSEERASELAQLTWRVL 614

Query: 597 REEWFNRP---GLTTKF 610
           + EWF RP   GLTT F
Sbjct: 615 KREWF-RPDVTGLTTTF 630

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  774 bits (1998), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/614 (60%), Positives = 471/614 (76%), Gaps = 8/614 (1%)

Query: 5   IPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARMEAGF 64
           IP +LK PISLW  QDR+ +T +E+  LC   +W ELH+R ++R+QFGTAGLR++M+AGF
Sbjct: 9   IPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGLRSQMQAGF 68

Query: 65  SRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFEVHYL 124
           SRMN LV+IQA+QGLA YI++QFP++LVAVVGHDHRF+S  FA+ATAT  L  GF+VHYL
Sbjct: 69  SRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLLKGFKVHYL 128

Query: 125 NQGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDSAIARS 184
           N G  +VHTP+VPF VD + ASVGVMITASHNPK+DNGYKVYY+NGCQIIPPHD AI+ +
Sbjct: 129 NPGQEFVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDQAISNA 188

Query: 185 IESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFV--TELDSLPKGKP 242
           I+ NLEP    W++D  + +   +GKL+Y R++ML+ Y+  + D+ V  T L    + KP
Sbjct: 189 IDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPLKLEVRSKP 248

Query: 243 WFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEEKGALDL 302
           WFVYTPMHGVG+ +F  I  K + L   +D+L V EQ NPDP FPTV FPNPEEKGAL++
Sbjct: 249 WFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNI 308

Query: 303 AIKLAENHGIKLVIASDPDADRFSVAFKGPHG--WQQLSGNDIGFLFAYYELQKYRGFDA 360
            ++LAE H I L+IA+DPDADRFSVA K      WQQL+GN+IGFLFA++E +K++  D 
Sbjct: 309 GMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGFLFAFFEFEKFKSMDE 368

Query: 361 EYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYVPFGFE 420
           ++Q++HPLAML+STVSSQMI  MA +EGFH+EDTLTGFKWIGNRA+ LE  GYYVPFGFE
Sbjct: 369 QFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEGYYVPFGFE 428

Query: 421 EAIGYMFPATEHDKDGISAAVVFLQAYHSW-ISQGKSPLDILDEASAKYGVFREYNGYYL 479
           EAIGYMFPA EHDKDGISA+VVFLQAY  W ++    P+++L+    KYGVF+EYNGYY+
Sbjct: 429 EAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVFKEYNGYYI 488

Query: 480 VDEPSLTNKTFAYIREDYTPKGENYPRTIG-DLQVKTFRDLTTGYQSDTPNNIPNLHVDP 538
           V  P +T + F YIR+ YTP+   YP  IG +++V  +RDLTTGYQSDT ++ P L VDP
Sbjct: 489 VPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDHKPTLPVDP 548

Query: 539 SSQMITIVAQPKGGGSGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQTWDILRE 598
           +SQMIT+ A+P      EH+RFT+RGSGTEPKLKVYIE  A  + RA  LA+ TWD+LR 
Sbjct: 549 TSQMITVFARPNDSNGNEHIRFTIRGSGTEPKLKVYIETRANEERRASFLAKLTWDVLRR 608

Query: 599 EWFN--RPGLTTKF 610
           EWF   +  +TT F
Sbjct: 609 EWFRPEKTNITTNF 622

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score =  768 bits (1984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/620 (60%), Positives = 467/620 (75%), Gaps = 11/620 (1%)

Query: 1   MSSNIPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARM 60
           +  + P NL++ I LWL QD+ E+T  E+ +LC   NW ELH+R +SR+ FGTAGLR+RM
Sbjct: 8   ICDDCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRM 67

Query: 61  EAGFSRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFE 120
           EAGFSRMN LV++QA+QGLA+YIK QFP +L AVVGHDHRF+S  FA  TA+V L+ GF+
Sbjct: 68  EAGFSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVGFK 127

Query: 121 VHYLNQGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDSA 180
           V+YLN  DS+VHTP+VPF+V+ + AS+GVMITASHNPK+DNGYKVYY+NGCQIIPPHD  
Sbjct: 128 VYYLNPEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQIIPPHDKN 187

Query: 181 IARSIESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFVTELDSLPKG 240
           IA +I+ NLEP +  W+WD T ++   E KL+Y R++M  +Y+  +KD  V+   S P  
Sbjct: 188 IAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISRPNN 247

Query: 241 ---KPWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEEK 297
              KPWFVYTPMHGVGY +F +I+  IL  E N D+ VV EQ+ PDP FPTV FPNPEEK
Sbjct: 248 NGKKPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEK 307

Query: 298 GALDLAIKLAENHGIKLVIASDPDADRFSVAFKGPHG--WQQLSGNDIGFLFAYYELQKY 355
           GAL LA KLAE + I LVIA+DPDADRFSVA K      WQQLSGN+IGFLFA +EL+KY
Sbjct: 308 GALSLATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFASFELEKY 367

Query: 356 RGFDAEYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYV 415
              D E++++HPLAM+NSTVSSQMI  MA +E FH+EDTLTGFKWIGNRAL+L+ +GYYV
Sbjct: 368 MSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDLQGQGYYV 427

Query: 416 PFGFEEAIGYMFPATEHDKDGISAAVVFLQAYHSWISQ-GKSPLDILDEASAKYGVFREY 474
           PFGFEEAIGYMFP    DKDG+SAAVVFL AY  W++  G  P DIL++   K+G F+EY
Sbjct: 428 PFGFEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEKGFKKFGFFKEY 487

Query: 475 NGYYLVDEPSLTNKTFAYIREDYTPKGENYPRTIG-DLQVKTFRDLTTGYQSDTPNNIPN 533
           NGYY+ D+P  T + F ++R  Y   G  YP+ IG + +++ FRDLTTGYQS+T +N+PN
Sbjct: 488 NGYYIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSNTIDNLPN 547

Query: 534 LHVDPSSQMITIVAQPKGGGSGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQTW 593
           L VDP S+MITI A PK       VRFT+RGSGTEPKLK+YIEA A ++  A +LA + W
Sbjct: 548 LPVDPHSEMITIEAVPKQDIGKSKVRFTMRGSGTEPKLKLYIEAVADNEKCAIDLAYEMW 607

Query: 594 DILREEWFNRP---GLTTKF 610
           ++L++EW  RP   GLTT F
Sbjct: 608 NVLKKEWI-RPDVTGLTTTF 626

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  751 bits (1939), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/617 (59%), Positives = 459/617 (74%), Gaps = 12/617 (1%)

Query: 4   NIPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARMEAG 63
           N PE L+  I  WL  D+NE+T +E+ +LC  ++WSEL+ R + R+ FGTAGLR+RMEAG
Sbjct: 11  NAPEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSRMEAG 70

Query: 64  FSRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFEVHY 123
            +R+N+LV++QATQGLA+YI  QFP + VAVVGHDHRF+S +FA  TA V L+AGF+V Y
Sbjct: 71  TNRLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRAGFKVLY 130

Query: 124 LNQGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDSAIAR 183
           LN GD+ VHTP+VPFTVD + ASVGVMITASHNPK+DNGYKVY+ANGCQIIPPHD  IAR
Sbjct: 131 LNPGDTLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQIIPPHDLNIAR 190

Query: 184 SIESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFVTELDSL--PKGK 241
           SI+ NLEP    WDW   +Q A  E +++Y +D+M + Y    +   +     L  P   
Sbjct: 191 SIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGRKVLRNPGSG 250

Query: 242 PWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEEKGALD 301
           PWFVYTPMHGVG ++F +I+  +L ++ N D+L V EQ +PDP FPTV FPNPEEKGALD
Sbjct: 251 PWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFPNPEEKGALD 310

Query: 302 LAIKLAENHGIKLVIASDPDADRFSVAF--KGPHGWQQLSGNDIGFLFAYYELQKYRGFD 359
            AI+LA  +GI LVIA+DPDADRFS+A        W+QL+GN+IGFLFAY + + Y+  D
Sbjct: 311 KAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAYQQFEMYKAMD 370

Query: 360 AEYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYVPFGF 419
             +QK HPL +LNSTVSSQMI  MA +EGFH+EDTLTGFKWIGNRA +LE +G++ PFG+
Sbjct: 371 DIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEKKGFFAPFGY 430

Query: 420 EEAIGYMFPATEHDKDGISAAVVFLQAYHSWISQG-KSPLDILDEASAKYGVFREYNGYY 478
           EEAIGYMF   EHDKDGISA+++FL +Y+ W+    K PLDIL++   KYGVF+EYNGYY
Sbjct: 431 EEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYGVFKEYNGYY 490

Query: 479 LVDEPSLTNKTFAYIREDYTPKGENYPRTIG-DLQVKTFRDLTTGYQSDTPNNIPNLHVD 537
           +VD P +  +TF YIR D  P G  YP  IG + QV +FRDLT G+QSDT ++IP L VD
Sbjct: 491 IVDNPKIMKETFDYIRNDRKP-GTQYPEAIGSEFQVVSFRDLTLGFQSDTSDHIPTLPVD 549

Query: 538 PSSQMITIVAQPKGGG-SGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQTWDIL 596
           P+SQMIT+ A+P       +HVRFT+RGSGTEPKLKVYIEA + S+  A++LA+Q WD L
Sbjct: 550 PNSQMITVCAKPTHDNVERDHVRFTIRGSGTEPKLKVYIEACSGSETGAQQLAKQMWDTL 609

Query: 597 REEWFNRP---GLTTKF 610
           +E WF RP   GL T F
Sbjct: 610 QEVWF-RPQTTGLVTDF 625

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/620 (58%), Positives = 454/620 (73%), Gaps = 11/620 (1%)

Query: 1   MSSNIPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARM 60
           + S+IPE+LK+ I +W   D N++T  E+ ELC  ++  ELH+R + R+ FGTAGLR+RM
Sbjct: 11  LLSSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTAGLRSRM 70

Query: 61  EAGFSRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFE 120
           EAGF+RMN L V+Q+TQGLA YIK QFP +L AVVGHDHR++S +FA+ TA V L AGF+
Sbjct: 71  EAGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFLNAGFK 130

Query: 121 VHYLNQGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDSA 180
           V+YLN  D +VHTPMVPF ++   AS+GVMITASHNP++DNGYKVYY NGCQIIPPHD  
Sbjct: 131 VYYLNPNDEFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNGCQIIPPHDKN 190

Query: 181 IARSIESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFV---TELDSL 237
           IA  IE NLEP +  W+ +  + +A +  KLIY ++ +L+QY+  +    +     L + 
Sbjct: 191 IAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYIIPKNISLGTT 250

Query: 238 PKG-KPWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEE 296
            KG KPWFVYTPMHGVGYQ+F +I+S  L L  + D++ V EQ+ PDP FPTV FPNPEE
Sbjct: 251 IKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSFPTVSFPNPEE 310

Query: 297 KGALDLAIKLAENHGIKLVIASDPDADRFSVAFKGP--HGWQQLSGNDIGFLFAYYELQK 354
           KGALDL IK A+ H I LV+A+DPDADRFSVA + P    +QQL+GN+IGFLFAY+  ++
Sbjct: 311 KGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIGFLFAYFLWEQ 370

Query: 355 YRGFDAEYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYY 414
           Y    A+++   PLAM+NSTVSSQMI  MA +EGF++EDTLTGFKWIGN+A ELE  GYY
Sbjct: 371 YSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNKARELEKEGYY 430

Query: 415 VPFGFEEAIGYMFPATEHDKDGISAAVVFLQAYHSWISQGKSPL-DILDEASAKYGVFRE 473
           VPFGFEEAIGYMFP  E DKDGI+A VVFLQAY+ W    K  L DI++    KYGVF+E
Sbjct: 431 VPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDIIETGFKKYGVFKE 490

Query: 474 YNGYYLVDEPSLTNKTFAYIREDYTPKGENYPRTIG-DLQVKTFRDLTTGYQSDTPNNIP 532
           YNGYY+V++ SLT   F  IRE+   K E Y   IG + +V TFRDLT GYQSDT  N+P
Sbjct: 491 YNGYYIVNDLSLTKIIFDNIRENKNDK-EKYVSHIGTEFKVITFRDLTLGYQSDTIGNVP 549

Query: 533 NLHVDPSSQMITIVAQPKGGGSGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQT 592
            L VDPSSQMIT+   P        VRFT+RGSGTEPKLKVYIEA A+++  A  LA+ T
Sbjct: 550 TLPVDPSSQMITMTIIPTSLPENGSVRFTIRGSGTEPKLKVYIEANAKTEAEANRLAKLT 609

Query: 593 WDILREEWFN--RPGLTTKF 610
           WD+L+ EWF+  + GLTT F
Sbjct: 610 WDVLKREWFSSEKTGLTTNF 629

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/615 (57%), Positives = 458/615 (74%), Gaps = 6/615 (0%)

Query: 2   SSNIPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARME 61
           +++IP  L+  I  WL  D+NE+T  E+ +LC+ +NW ELH+R +SR+ FGTAGLRARME
Sbjct: 3   TTDIPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARME 62

Query: 62  AGFSRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFEV 121
           AG +R+N LV++QA+QGLA YIK +FP +L AVVGHDHR++S +FA+ TA   ++AGF+V
Sbjct: 63  AGTNRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGFKV 122

Query: 122 HYLNQGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDSAI 181
           +YLN  D +VHTPMVP++VD + ASVGVMITASHNPK+DNGYKVYY NGCQIIPPHD  I
Sbjct: 123 YYLNPHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGI 182

Query: 182 ARSIESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFVTELDSLPKGK 241
           A +I +NLEP +  W++ + +  A  +GK+ Y R +ML  Y++ V +  +    + P  K
Sbjct: 183 AETINNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRDFAAPDEK 242

Query: 242 PWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEEKGALD 301
           PWFVYTPMHGVG+Q+F  I ++ L L+ N D++ V EQ +PDP F TV FPNPEEKGAL+
Sbjct: 243 PWFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPEEKGALN 302

Query: 302 LAIKLAENHGIKLVIASDPDADRFSVAFK--GPHGWQQLSGNDIGFLFAYYELQKYRGFD 359
           LAI LAE +GIKLV+A+DP+ADRFSVA +    + W+QL+GN+IG LFA+YE + Y+   
Sbjct: 303 LAITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFKMYQKAA 362

Query: 360 AEYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYVPFGF 419
            +  K+ PLAMLNSTVS+Q+I  MA  EGF ++DTLTGFKWIGN A +LE +GY+VPFG+
Sbjct: 363 DKGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKGYFVPFGY 422

Query: 420 EEAIGYMFPATEHDKDGISAAVVFLQAYHSWISQGKSPLDILDEASAKYGVFREYNGYYL 479
           EEAIGYMFPA EHDKDG+SAA+VFLQAY +W+    +P+DI+ E   KYGV  EYNGYY+
Sbjct: 423 EEAIGYMFPAMEHDKDGVSAAIVFLQAYANWLQSSSNPIDIIHECYDKYGVSAEYNGYYI 482

Query: 480 VDEPSLTNKTFAYIREDYTPKGENYPRTIGD-LQVKTFRDLTTGYQSDTPNNIPNLHVDP 538
           V +PS T+K F  IR  YT  G ++P +IG+  +V  FRDLT G+ S T +  P L VD 
Sbjct: 483 VSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKKPLLPVDK 542

Query: 539 SSQMITIVAQPKGGG-SGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQTWDILR 597
           +SQMITI A P G   +GE VRFT+RGSGTEPKLKVYIE  + ++ RAR LA+  W+ L+
Sbjct: 543 NSQMITITAVPSGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARILAKSLWETLK 602

Query: 598 EEWF--NRPGLTTKF 610
            EWF  +  GL+T F
Sbjct: 603 HEWFKPSSNGLSTDF 617

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/621 (57%), Positives = 459/621 (73%), Gaps = 18/621 (2%)

Query: 5   IPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARMEAGF 64
           +P +L+  +  WLAQD+N +T  E+  LC A + +ELH+R ++R+ FGTAGLR++MEAGF
Sbjct: 15  LPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILFGTAGLRSKMEAGF 74

Query: 65  SRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFEVHYL 124
           SRMNTLVV+QATQGLA YIK+QFP +L AV+GHDHR++S +FA+   +V L AGF V+ L
Sbjct: 75  SRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIATSVFLSAGFTVYNL 134

Query: 125 NQGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDSAIARS 184
           N   ++VHTP+VPFTVD++ ASVGVMITASHNPK+DNGYKVYY+NGCQIIPP D++IA+ 
Sbjct: 135 NPPGTFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPVDASIAKC 194

Query: 185 IESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSF-----VTELDSLPK 239
           I+ NLEP +  WD  + ++      KLIY R++ML  Y   V ++      + E D    
Sbjct: 195 IDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNIIDKKTIREFDE--H 252

Query: 240 GKPWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEEKGA 299
            KPWFVYTPMHGVGY++F  +  + + L+ NRD+L V EQ+ PDP FPT+ FPNPEEKGA
Sbjct: 253 RKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTISFPNPEEKGA 312

Query: 300 LDLAIKLAENHGIKLVIASDPDADRFSVAFKGPHG--WQQLSGNDIGFLFAYYELQKYRG 357
           LD+AI LA+ + I LVIA+DPDADRFS A    H   WQQL+GN+IGFLF YY   KY  
Sbjct: 313 LDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGFLFGYYLFNKYTN 372

Query: 358 FDAEYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYVPF 417
            D E++K+HPLAMLNSTVSS+M+ SMA  E F   DTLTGFKWIGN+A++L+  GY+V F
Sbjct: 373 MDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDLKKEGYHVVF 432

Query: 418 GFEEAIGYMFPATEHDKDGISAAVVFLQAYHSWISQGK-SPLDILDEASAKYGVFREYNG 476
           G+EEAIGYMFPA EHDKDGI+A+VVFLQAY  W +  K + +DIL++   KYG F+EYNG
Sbjct: 433 GYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQGIEKYGAFKEYNG 492

Query: 477 YYLVDEPSLTNKTFAYIREDYTPKGENYPRTIGD-LQVKTFRDLTTGYQSDTPNNIPNLH 535
           YY+V  P +TN  F YIR +Y   G  YP+ IG  L+V +FRDLTTG+QSDT +NIP+L 
Sbjct: 493 YYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSDTVDNIPSLP 552

Query: 536 VDPSSQMITIVAQ---PKGGGSGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQT 592
           VDPSSQMITI A+    +   S   VRFT+RGSGTEPKLK+YIE  ++    A ++A+ T
Sbjct: 553 VDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSKDPIAASKIAKLT 612

Query: 593 WDILREEWFNRP---GLTTKF 610
           WD+L++EW  RP   G+TT +
Sbjct: 613 WDVLKKEWI-RPEVTGVTTSY 632

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score =  714 bits (1843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/618 (56%), Positives = 446/618 (72%), Gaps = 17/618 (2%)

Query: 5   IPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARMEAGF 64
           IP +LK  +  W   D+NE+T  EI +L   +NW+ELH+RL+ R+ FGTAGLR++MEAGF
Sbjct: 8   IPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLRSKMEAGF 67

Query: 65  SRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFEVHYL 124
           SRMNTL V+QA+QGLA+YI ++FP++    VGHDHRFNS DFA+ T+   L+  F+V+ L
Sbjct: 68  SRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQLRFKVYSL 127

Query: 125 N-----QGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDS 179
                 + D++VHTPMVPF +DR+ AS GVMITASHNPK+DNGYKVYY+NGCQIIPPHD 
Sbjct: 128 GFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQIIPPHDR 187

Query: 180 AIARSIESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFVTELDSLPK 239
            IA+SI  NL P    WD    + +A ++G  +  +  M++ Y+  + D  V+  D   +
Sbjct: 188 LIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVSS-DIGDR 246

Query: 240 GKPWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEEKGA 299
            KPWFVYTP+HGVG+++F++IAS++L L   RD+  VSE   PDP FPTV FPNPEE GA
Sbjct: 247 SKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEAGA 306

Query: 300 LDLAIKLAENHGIKLVIASDPDADRFSVAFKGPHGWQQLSGNDIGFLFAYYELQKYRGFD 359
           LDLAI LA+ +GI  V+ +DPDADRFS A K    W+QL+GN+IGFLFA +  +KY+   
Sbjct: 307 LDLAIALADKNGISFVLGNDPDADRFSAAVKHQGKWRQLTGNEIGFLFAQFVWEKYQKES 366

Query: 360 AEYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYVPFGF 419
           +E++  +PLA++NSTVSSQMI  +A +E FH+EDTLTGFKW+GNRA +LE+ GYYVPF +
Sbjct: 367 SEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGYYVPFAY 426

Query: 420 EEAIGYMFPATEHDKDGISAAVVFLQAYHSWISQGKSPLDILDEASAKYGVFREYNGYYL 479
           EEAIG+MF    HDKDG+SAAVVFLQ   SW  Q  SP+D+L  A  KYGVF+EYNGYY 
Sbjct: 427 EEAIGFMFSDIVHDKDGVSAAVVFLQMLWSWKKQALSPIDVLQSAFGKYGVFKEYNGYYT 486

Query: 480 VDEPSLTNKTFAYIREDYTPKGENYPRTIGD-LQVKTFRDLTTGYQSDTPNNIPNLHVDP 538
           V + SLT++ F+ IR  Y    ++YP+ IG+   V +F DLT G+QSDT +N P L VDP
Sbjct: 487 VPDLSLTDRIFSDIRSSY----DSYPKHIGNQFDVVSFTDLTKGFQSDTADNTPRLPVDP 542

Query: 539 SSQMITIVAQPK-GGGSG---EHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQTWD 594
           SSQMI     P   GGSG   E VRFT RGSGTEPKLKVYIEA +  + RA +LAR TW+
Sbjct: 543 SSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEETRASDLARTTWN 602

Query: 595 ILREEWF--NRPGLTTKF 610
           +LR+EWF     GL+TKF
Sbjct: 603 VLRDEWFKPKETGLSTKF 620

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score =  707 bits (1824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/635 (56%), Positives = 456/635 (71%), Gaps = 36/635 (5%)

Query: 6   PENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARMEAGFS 65
           PE+L++ + LWL QD+++ T KEI +LC + N  ELHER +SR+ FGTAGLR+ MEAGFS
Sbjct: 15  PEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFGTAGLRSTMEAGFS 74

Query: 66  RMNTLVVIQATQGLAQYIK---KQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFEVH 122
           RMNTL V+QA+QGLA Y+K   K     L+AV+GHDHR++S +FAK  ATV L AGF+V+
Sbjct: 75  RMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKIAATVFLIAGFKVY 134

Query: 123 YLN-------QGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIP 175
           YLN       + + +VHTPMVPFTV  +KASVGVM+TASHNPK+DNGYKVYY+NGCQIIP
Sbjct: 135 YLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIP 194

Query: 176 PHDSAIARSIESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFVTE-- 233
           PHDS I++ I++NLEP    W++ + M  A  +G LIY RD ML  YI+ +++   ++  
Sbjct: 195 PHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDYITQLEEKLTSKDI 254

Query: 234 ------LDSLPKGKPWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFP 287
                 +D   K KPWFVYTPMHGVGY++F +I+++IL ++   DF+VV EQ +PDP FP
Sbjct: 255 IHLSKKIDV--KSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPDPGFP 312

Query: 288 TVQFPNPEEKGALDLAIKLAENHGIKLVIASDPDADRFSVAF--KGPHG-WQQLSGNDIG 344
           TV FPNPEEKGA+D+ IKLAE++GI LVIA+DPDADRFS+A   KG  G W Q +GN+IG
Sbjct: 313 TVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTGNEIG 372

Query: 345 FLFAYYELQKYRGFDAEYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNR 404
           +LFAY+E QKY+      Q  H L M+NSTVSSQMI  MA +EGF++E+TLTGFKWIGNR
Sbjct: 373 YLFAYFEFQKYK---ISKQDLHRLYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWIGNR 429

Query: 405 ALELEARGYYVPFGFEEAIGYMFPATEHDKDGISAAVVFLQAYHSWISQGK-SPLDILDE 463
           A++L  +G  VPFG+EEAIGYMFP  E DKDGI+A V+F+QA+  W    K  P +I+  
Sbjct: 430 AIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDKMDPYEIIQL 489

Query: 464 ASAKYGVFREYNGYYLVDEPSLTNKTFAYIREDY----TPKGENYPRTIG-DLQVKTFRD 518
              KYGVF EYNGYY   +  +T K F Y+R DY    +   + YP  IG + ++  +RD
Sbjct: 490 GFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHIGEEFKIIKYRD 549

Query: 519 LTTGYQSDTPNNIPNLHVDPSSQMITIVAQPKGGGSGEHVRFTLRGSGTEPKLKVYIEAG 578
           LTTGYQSDTP+N P L VDPSSQMIT+   P    S   +R T+RGSGTEPKLKVYIEA 
Sbjct: 550 LTTGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNESDGSIRLTIRGSGTEPKLKVYIEAC 609

Query: 579 AQSDPRARELARQTWDILREEWFNRP---GLTTKF 610
           ++S   A  LA+Q W++L+ EW  RP   G+TT F
Sbjct: 610 SRSATEASFLAKQAWNVLKREWM-RPEQTGITTAF 643

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/614 (56%), Positives = 434/614 (70%), Gaps = 12/614 (1%)

Query: 5   IPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARMEAGF 64
           +PE LK     WL  D+NE+T  EI  +   ++W EL  RL  R+ FGTAGLR RMEAGF
Sbjct: 15  VPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTAGLRGRMEAGF 74

Query: 65  SRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFEVHYL 124
           +RMN+LV++Q +QGLAQYI ++FP +L  VVGHDHR++S +FA  T    L AGF+V YL
Sbjct: 75  TRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATFLNAGFKVFYL 134

Query: 125 NQGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDSAIARS 184
           N  + +VHTP+VP++VD+++++ GVMITASHNPK DNGYKVYY+NGCQIIPPHD  IA +
Sbjct: 135 NTENEFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQIIPPHDKNIALT 194

Query: 185 IESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCV-KDSFVTELDSLPKGKPW 243
           IE NL P +  W+W          G L +  +KM   Y+  + +  F      L  GKPW
Sbjct: 195 IEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITRYVFTNGSPMLKTGKPW 254

Query: 244 FVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEEKGALDLA 303
           FVYTPMHGVG+++F QIA ++L L  N D+  V EQ+ PDP FPTV FPNPEEKGALD+A
Sbjct: 255 FVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTVSFPNPEEKGALDMA 314

Query: 304 IKLAENHGIKLVIASDPDADRFSVAFKG--PHGWQQLSGNDIGFLFAYYELQKYRGFDAE 361
           I+LAE  G+ L+IA+DPDADRFS A K    H W+QLSGN+IG LFA ++LQ+++   A 
Sbjct: 315 IQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSLFAIFKLQEHKEKAAS 374

Query: 362 YQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYVPFGFEE 421
            +   PLAMLNSTVSSQM+  MA +EGFH+E+TLTGFKWIGNRAL+LE +GY V FG+EE
Sbjct: 375 RK---PLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLEQQGYDVCFGYEE 431

Query: 422 AIGYMFPATEHDKDGISAAVVFLQAYHSWIS-QGKSPLDILDEASAKYGVFREYNGYYLV 480
           AIGYMFP  EHDKDGI A+VVFL  Y  W+  +G  PLD+LD    KYGVF EYNGYY V
Sbjct: 432 AIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKYGVFSEYNGYYTV 491

Query: 481 DEPSLTNKTFAYIREDYTPKGENYPRTIG-DLQVKTFRDLTTGYQSDTPNNIPNLHVDPS 539
           +EP+L    F+YIR++Y PK   YP  +G +  + +FRDLT GYQSDT +  P L VD S
Sbjct: 492 EEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDTIDFKPTLPVDAS 551

Query: 540 SQMITIVAQPKGGGSGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQTWDILREE 599
           SQMIT   +P+     E +RFT+RGSGTEPKLKVYIE+ A +   A  LA  TW++LR E
Sbjct: 552 SQMITATLKPERTVGHEEIRFTIRGSGTEPKLKVYIESHAANKEAAANLAHLTWNVLRRE 611

Query: 600 WFNRP---GLTTKF 610
           WF RP   GL T F
Sbjct: 612 WF-RPEITGLKTSF 624

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score =  703 bits (1814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/621 (56%), Positives = 443/621 (71%), Gaps = 17/621 (2%)

Query: 2   SSNIPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARME 61
           ++ +PE+LK  +  WL  D+NE+T  +I +L + ++W+EL  RLN R+ FGTAGLR+RME
Sbjct: 6   NAEVPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLRSRME 65

Query: 62  AGFSRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFEV 121
           AGF+RMNTL V+QA+QGLA+YI   FPD+L  VVGHDHRFNS DFA+ T    L+ GF+V
Sbjct: 66  AGFNRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQLGFKV 125

Query: 122 HYLN-----QGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPP 176
           + L        D  VHTPMVPF +D ++AS G+MITASHNPK+DNGYKVYY+NGCQIIPP
Sbjct: 126 YDLGFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGCQIIPP 185

Query: 177 HDSAIARSIESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFVTELDS 236
           HD  I++SI +NLEP +  WD      +A     LI  +  +++QY+  V+ S V    +
Sbjct: 186 HDQRISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLVITNVN 245

Query: 237 LPKGKPWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEE 296
             K  PWFVYTP+HGVG+++F++I S   +L   RD+L V EQ  PDP FPTV FPNPEE
Sbjct: 246 HTKA-PWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPNPEE 304

Query: 297 KGALDLAIKLAENHGIKLVIASDPDADRFSVAFKGPHGWQQLSGNDIGFLFAYYELQKYR 356
           KGALD AI+LAE H I  V+ +DPDADRFSVA K    W+QL+GN+IGFLFA Y+ + YR
Sbjct: 305 KGALDKAIELAEKHDITFVLGNDPDADRFSVAAKHNGQWRQLTGNEIGFLFAQYKWETYR 364

Query: 357 GFDAEYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYVP 416
               +++ ++PLAM+NSTVSSQMI  MA +EGFH+EDTLTGFKW+GNRA ELE  GY+VP
Sbjct: 365 LESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARELENAGYFVP 424

Query: 417 FGFEEAIGYMFPATEHDKDGISAAVVFLQAYHSWISQGKSPLDILDEASAKYGVFREYNG 476
           F +EEAIGYMF    HDKDGISAAVVFLQ   SW +Q  +P D+L  A  KYGVF+EYNG
Sbjct: 425 FAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSWKAQALTPFDVLQRAYQKYGVFKEYNG 484

Query: 477 YYLVDEPSLTNKTFAYIREDYTPKGENYPRTIG-DLQVKTFRDLTTGYQSDTPNNIPNLH 535
           YY+V + SLT+K F+ IR  ++ +    P  IG + +V+++ DLTTGYQS+TP++ P L 
Sbjct: 485 YYIVPDLSLTDKVFSGIRSGFSLQ----PTHIGQEFRVESYTDLTTGYQSNTPDSEPRLP 540

Query: 536 VDPSSQMITIVAQPKGG----GSGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQ 591
           VDPSSQMIT    P       G  E VRFT RGSGTEPKLKVYIEA + S+  A  LA++
Sbjct: 541 VDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVSSSEELASALAKK 600

Query: 592 TWDILREEWFN--RPGLTTKF 610
            WD+LR EWF   + GL T F
Sbjct: 601 AWDVLRREWFKPEQTGLATNF 621

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/617 (55%), Positives = 437/617 (70%), Gaps = 38/617 (6%)

Query: 4   NIPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARMEAG 63
           ++P +L+  +  WL  D+ E+T  EI +LC   + +ELH+RL++ + FGTAGLR RMEAG
Sbjct: 9   SLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGRMEAG 68

Query: 64  FSRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFEVHY 123
           F+RMN L V QA+QGLA+YIKKQFP++L  VVGHDHR NS  F K T    L+ GF+V +
Sbjct: 69  FNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQLGFKVFH 128

Query: 124 LNQGD--SYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDSAI 181
           LN  +  S VHTP+VPFTV+   ASVG+MITASHNPK+DNGYKVYY NGCQIIPPHD  I
Sbjct: 129 LNHENEKSLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQIIPPHDKLI 188

Query: 182 ARSIESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFVTELDSLPKGK 241
           A SI  NLEP +           +   G +I  ++KM ++YI  +  + +    +    +
Sbjct: 189 AESIIHNLEPFS-----------SPQTGTIIDCKEKMTKKYIDAIGSTLIDGAVNKKTNE 237

Query: 242 PWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEEKGALD 301
           PWFVYTPMHGVG+++F+ I+ ++L LE  +D+LVV EQ  PD +FPTV FPNPEEKGALD
Sbjct: 238 PWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPNPEEKGALD 297

Query: 302 LAIKLA-ENHGIKLVIASDPDADRFSVAFKG-----PHGWQQLSGNDIGFLFAYYELQKY 355
           LA++   +N  + L+IA+DPDADRFSVA +         W+QL+GN+IGFLFAYYE ++Y
Sbjct: 298 LAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLFAYYEWERY 357

Query: 356 RGFDAEYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYV 415
           +    +     PLAMLNSTVSSQMI  MA +EGFH+EDTLTGFKW+GNRALELE  GYY 
Sbjct: 358 KHSPID----EPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALELEQEGYYT 413

Query: 416 PFGFEEAIGYMFPATEHDKDGISAAVVFLQAYHSWISQGKSPLDILDEASAKYGVFREYN 475
           PF +EEAIGYMF +  HDKDGISAA+VFLQAY  W + G++ LDIL  AS KYG F+E+N
Sbjct: 414 PFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKWRASGQTVLDILATASLKYGHFKEFN 473

Query: 476 GYYLVDEPSLTNKTFAYIREDYTPKGENYPRTIG-DLQVKTFRDLTTGYQSDTPNNIPNL 534
           GYY+V + ++T + F  IR   +P    YP+ +G   ++  FRDLT GYQSDTP++IP L
Sbjct: 474 GYYIVPDLAITKQVFDAIRSIESP----YPKKLGSSFEIIKFRDLTNGYQSDTPDHIPEL 529

Query: 535 HVDPSSQMIT----IVAQPKGGGSGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELAR 590
             DPSSQMIT    +V QP        VRFT+RGSGTEPKLKVYIEA   ++P +  LA+
Sbjct: 530 ASDPSSQMITCEMLLVEQPTS-----RVRFTIRGSGTEPKLKVYIEARTNTEPNSIALAK 584

Query: 591 QTWDILREEWFNRPGLT 607
            TWD+LR+EWF +P LT
Sbjct: 585 FTWDVLRQEWF-KPELT 600

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/626 (54%), Positives = 430/626 (68%), Gaps = 20/626 (3%)

Query: 1   MSSNIPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARM 60
           M+  IP++L+  I  W   D+N +T  EI  L D++NW+EL  RL  R+ FGTAGLRARM
Sbjct: 9   MNELIPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARM 68

Query: 61  EAGFSRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFE 120
           EAGF+RMNTL VIQA+QGLA YIK QFP++L  VVGHDHR+NS  FA+      L+ GFE
Sbjct: 69  EAGFARMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQLGFE 128

Query: 121 VHYLN------QGDSYVHTPMVPFTVDRVK--ASVGVMITASHNPKLDNGYKVYYANGCQ 172
           V+YLN        +SYVHTPMVPFTV  ++  AS G+MITASHNPK+DNGYKVYY+NGCQ
Sbjct: 129 VYYLNYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQ 188

Query: 173 IIPPHDSAIARSIESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFVT 232
           I PPHD  IA  I++NL P +  WD  + ++ A +  +L   + ++++ Y+  ++ S VT
Sbjct: 189 ITPPHDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLVT 248

Query: 233 ELDSLPKGKPWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFP 292
                  GK WFVYTPMHGVGY++F+ I +  L L+ +  +LVV  Q  PDPEF TV FP
Sbjct: 249 TNSLADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFP 308

Query: 293 NPEEKGALDLAIKLAENHGIKLVIASDPDADRFSVAFKGPHGWQQLSGNDIGFLFAYYEL 352
           NPEE+GAL+LAI+LA   G +LV+A+DPDADRFS A K  + W+QL+GN +G+LFA  +L
Sbjct: 309 NPEEEGALNLAIELAARSGAELVLANDPDADRFSAAVKDGNKWKQLTGNQLGYLFAVGQL 368

Query: 353 QKYRGFDAEYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARG 412
           +K   F  + +   PLAML STVSSQMI  MA +EGF   +TLTGFKW+ NRA++LE  G
Sbjct: 369 EK---FSNQNENKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLENDG 425

Query: 413 YYVPFGFEEAIGYMFPATEHDKDGISAAVVFLQAYHSWISQGKSPLDILDEASAKYGVFR 472
           +YVPF +EEAIGYMF +  HDKDG+SAA  FLQ    W  +GK+PLD+L+    KYG F 
Sbjct: 426 FYVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKKEGKTPLDVLNAGYEKYGNFV 485

Query: 473 EYNGYYLVDEPSLTNKTFAYIREDYTPKGENYPRTIG-DLQVKTFRDLTTGYQSDTPNNI 531
           EYNGYY V + S+    F YIR         YP TIG +  V +FRDLT GYQSDT N+I
Sbjct: 486 EYNGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTGNHI 545

Query: 532 PNLHVDPSSQMITIVAQP----KGGGSGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARE 587
           PNL V P S MIT V +P        S ++VRFT+RGSGTEPKLKVYIE+ A     A +
Sbjct: 546 PNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKEYATK 605

Query: 588 LARQTWDILREEWFNRP---GLTTKF 610
           LA+ TWD+L+ EWF RP   GL TKF
Sbjct: 606 LAKLTWDVLKREWF-RPEVTGLQTKF 630

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/620 (55%), Positives = 424/620 (68%), Gaps = 17/620 (2%)

Query: 5   IPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARMEAGF 64
           +P +LK  +  WL  D+N +T  EI EL     W EL +RL  R+ FGTAGLRARMEAGF
Sbjct: 8   VPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRARMEAGF 67

Query: 65  SRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFEVHYL 124
           SRMNTL VIQA+QGLA+YIK QFPD L  V+GHDHRF+S +FA+AT    L+  ++++YL
Sbjct: 68  SRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDYDIYYL 127

Query: 125 N------QGDSYVHTPMVPFTVDRVKA---SVGVMITASHNPKLDNGYKVYYANGCQIIP 175
           N        D +VHTPMVPF ++ V+    S GVMITASHNPK+DNGYKVYYANGCQIIP
Sbjct: 128 NYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGCQIIP 187

Query: 176 PHDSAIARSIESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFVTELD 235
           PHD  I R I++NLEP    WD    +++A   GKL   R +ML++Y   ++   V + +
Sbjct: 188 PHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQTMLVKQSN 247

Query: 236 SLPKGKPWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPE 295
               G PWFVYTPMHGVGY+ F +  + +L +E ++D++VV EQ  PDPEFPTV FPNPE
Sbjct: 248 LKFAGGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSFPNPE 307

Query: 296 EKGALDLAIKLAENHGIKLVIASDPDADRFSVAFKGPHGWQQLSGNDIGFLFAYYELQKY 355
           E+GALD+A+K+A+ +GI +V+A+DPDADRFSVA K    W QL+GN IG LFA  E+Q Y
Sbjct: 308 ERGALDMAMKVADANGITVVLANDPDADRFSVAVKYHGEWNQLTGNQIGILFAQAEMQSY 367

Query: 356 RGFDAEYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYV 415
             F         LAML S VSSQ++  MA  EGF   +TLTGFKW+GNRA ELE  GYYV
Sbjct: 368 --FKEPKLDRKQLAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRARELELEGYYV 425

Query: 416 PFGFEEAIGYMFPATEHDKDGISAAVVFLQAYHSWISQGKSPLDILDEASAKYGVFREYN 475
           PF +EEAIGYMF    HDKDGI+AA VFLQ  + W    KS  ++L E   KYG F +YN
Sbjct: 426 PFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVAKSSQEVLQECYEKYGYFVDYN 485

Query: 476 GYYLVDEPSLTNKTFAYIREDYTPKGENYPRTIG-DLQVKTFRDLTTGYQSDTPNNIPNL 534
           GYY+   P++T + F Y R +YTP G+ YP  IG + +V+  RDLT GYQSDT  NIP+L
Sbjct: 486 GYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSDTATNIPDL 545

Query: 535 HVDPSSQMITIVAQP-KGGGSGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQTW 593
            VD +SQMIT V +P K     E VRFT RGSGTEPKLKVYIE+ A +  RA  L+   W
Sbjct: 546 PVDHNSQMITCVLKPVKMETDCESVRFTARGSGTEPKLKVYIESCAANHQRASHLSHLAW 605

Query: 594 DILREEWFNRP---GLTTKF 610
           D+L+ EWF RP   GL T F
Sbjct: 606 DVLKREWF-RPTETGLQTNF 624

>CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105c PGM2 phosphoglucomutase
          Length = 567

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 85/375 (22%), Positives = 146/375 (38%), Gaps = 56/375 (14%)

Query: 52  GTAGLRARMEAGFSRMNTLVVIQATQGLAQYIKKQFPD---HLVAVVGHDHRFNSMDFAK 108
           GT+GLR + +      N       T+   Q I    P+     V VVG D RF +    +
Sbjct: 17  GTSGLRKKTKVFMEEPNY------TENFIQAIMDAIPEGAKDAVLVVGGDGRFYNDVIMQ 70

Query: 109 ATATVLLKAGFEVHYLNQGDSYVHTPMVPFTVDRV--KASVGVMITASHN---PKLDNGY 163
             A +    G     + Q +  + TP     +     K + G+++TASHN   P+ D G 
Sbjct: 71  KIAAIGAANGVRKLIIGQ-NGLLSTPAASHVIRSYAEKCTGGIILTASHNPGGPENDLGI 129

Query: 164 KVYYANGCQIIPPHDSAIARSIESNLEPGNGVWDWDQT----MQQAADEGKLIYGRDKML 219
           K   ANG     P  + +   +   L     + D+ Q     + +    G L+       
Sbjct: 130 KYNLANGGPAPEPVTNKMWE-VSKQLTHYKIIKDFPQVDFSKIGKDQQYGPLLVDIIDTT 188

Query: 220 EQYISCVKDSFVTEL-----DSLPKGKPW-FVYTPMHGV----GYQV----FDQIASKIL 265
           E Y+  +K+ F  +L         + K W  ++  ++G+    G  +    FD  A ++L
Sbjct: 189 EDYVKFMKEIFDFKLIKEFIHKQREAKNWKLLFDSLNGITGPYGKAIFVDEFDLPADEVL 248

Query: 266 QLEVNRDFLVVSEQLNPDPEFPTVQFPNPEEKGALDLAIKLAENHGIKLVIASDPDADRF 325
           Q              +P P+F  +  P+P    A  L ++  +   I+   ASD D DR 
Sbjct: 249 Q------------NWHPQPDFGGLH-PDPNLTYAHTL-VERVDREKIEFGAASDGDGDRN 294

Query: 326 SVAFKGPHGWQQLSGNDIGFLFAYYELQKYRGFDAEYQKSHPLAMLNSTVSSQMINSMAA 385
            +   GP       G+ +  +  Y +   Y      +QK     +  S  +S  I+ +A 
Sbjct: 295 MIYGAGPAFVS--PGDSVAIIAEYAKEIPY------FQKQGIYGLARSFPTSGAIDRVAK 346

Query: 386 LEGFHHEDTLTGFKW 400
            +G +  +  TG+K+
Sbjct: 347 AQGLNCYEVPTGWKF 361

>TBLA0I01380 Chr9 complement(297671..299386) [1716 bp, 571 aa] {ON}
           Anc_2.445 YKL127W
          Length = 571

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 115/486 (23%), Positives = 190/486 (39%), Gaps = 66/486 (13%)

Query: 52  GTAGLRARMEAGFSRMNTLVVIQATQGLAQYIKKQFPDHL---VAVVGHDHRFNSMDFAK 108
           GT+GLR +  A F +         T+   Q I +  P+       VVG D R+ +     
Sbjct: 20  GTSGLRKKT-AIFEKEPNY-----TENFIQAIMEAIPEGCKGATLVVGGDGRYYNDAILH 73

Query: 109 ATATVLLKAGFEVHYLNQGDSYVHTPMVPFTVDRV---KASVGVMITASHN---PKLDNG 162
             A +    G +   + Q +  + TP     +      + + G+++TASHN   PK D G
Sbjct: 74  NIAAIGAANGVKKLIVGQ-NGLLSTPAASHIIRTYAPGEITGGIILTASHNPGGPKNDMG 132

Query: 163 YKVYYANGCQIIPPHDSAIARSIESNLEPGNGVWDWDQ----TMQQAADEGKLIYGRDKM 218
            K    NG     P   AI  +    L+    + D+ +    T+ +    G L+      
Sbjct: 133 IKYNIQNGAPAPEPVTEAIWEA-SKKLQNYKIIKDFPELELKTLGKNKQYGPLLVDVIDT 191

Query: 219 LEQYISCVKDSFVTEL-----DSLPKGKPW-FVYTPMHGVGYQVFDQIASKILQLEVNRD 272
            E Y+  +K+ F   L     D+  K K W  ++  M+GV       I    L L  +  
Sbjct: 192 CEAYVQFIKEIFDFPLIKKFVDTQRKTKNWKLLFDGMNGVTGPYGKAIFVDELGLPADE- 250

Query: 273 FLVVSEQLNPDPEFPTVQFPNPEEKGALDLAIKLAENHGIKLVIASDPDADRFSVAFKGP 332
              V +  +P P+F     P+P    A  L  ++ +   I+   ASD D DR  +   GP
Sbjct: 251 ---VLKDWHPSPDFGG-HHPDPNLTYAKSLVDRV-DKEKIEFGAASDGDGDRNMIYGYGP 305

Query: 333 HGWQQLSGNDIGFLFAYYELQKYRGFDAEYQKSHPLAMLNSTVSSQMINSMAALEGFHHE 392
                  G+ +  +  Y     Y      ++K+    +  S  ++  I+ +A   G    
Sbjct: 306 AFVS--PGDSVAIIAEYASDIPY------FKKNGIYGLARSFPTASSIDRVAKAHGLKAY 357

Query: 393 DTLTGFKWIGNRALELEARGYYVPFGFEEAIGYMFPATEH--DKDGISAAVVFLQAYHSW 450
           +  TG+K+        +++   V    EE+ G     + H  +KDG+ A + +L      
Sbjct: 358 EVPTGWKFFCKL---FDSKK--VSICGEESFG---TGSNHVREKDGVWAIIAWLNILA-- 407

Query: 451 ISQGKSP------LDILDEASAKYG--VFREYNGYYLVDEPSLTNKTFAYIRE---DYTP 499
           I   K+P        I DE   KYG   F  Y+  Y   E    N+  A +R+   D + 
Sbjct: 408 IYNQKNPEKEASIKTIQDEFWLKYGRTFFTRYD--YEKVESQKANQIVAKLRKFVLDPSN 465

Query: 500 KGENYP 505
           KG+ +P
Sbjct: 466 KGKPFP 471

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 46/97 (47%), Gaps = 9/97 (9%)

Query: 147 VGVMITASHNPKLDNGYKVYYANGCQIIPPHDSAIARSIESNLEPGNGVWDWDQTMQQ-- 204
           VGVMITASHNP  DNG KV   +G  +I   +S       +NL     + D    + Q  
Sbjct: 57  VGVMITASHNPSGDNGVKVVEPDGSMLIQSWESTATEL--ANLLANRPLEDIKAKVGQLT 114

Query: 205 ---AADEGKLIYGRDKMLE--QYISCVKDSFVTELDS 236
              ++   +LI GRD  +     +SC+  S  +  D+
Sbjct: 115 SGESSVRPQLIVGRDSRVSGPHLLSCLVASATSLFDA 151

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%)

Query: 147 VGVMITASHNPKLDNGYKVYYANGCQII 174
           VGVM+TASHNP LDNG KV    G  +I
Sbjct: 60  VGVMVTASHNPPLDNGVKVVEPTGAMLI 87

>SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105C PGM2 Phosphoglucomutase catalyzes the
           conversion from glucose-1-phosphate to
           glucose-6-phosphate which is a key step in hexose
           metabolism functions as the acceptor for a
           Glc-phosphotransferase and to YKL127W uniprot|P33401
           Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 571

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 92/373 (24%), Positives = 147/373 (39%), Gaps = 51/373 (13%)

Query: 52  GTAGLRARMEAGFSRMNTLVVIQATQGLAQYIKKQFPD---HLVAVVGHDHRFNSMDFAK 108
           GT+GLR + +      N       T+   Q +    P+       VVG D RF +    +
Sbjct: 19  GTSGLRKKTKVFMEEPNY------TENFIQAVMDAIPEGSQDATLVVGGDGRFYNDVVVQ 72

Query: 109 ATATVLLKAGFEVHYLNQG-DSYVHTPM---VPFTVDRVKASVGVMITASHNP---KLDN 161
             A +    G  VH L  G +  + TP    +  T    K + G+++TASHNP   K D 
Sbjct: 73  KIAAIGAANG--VHKLVIGQNGILSTPAASHIIRTYPHAKITGGIILTASHNPGGAKNDF 130

Query: 162 GYKVYYANGCQIIPPHDSAIARSIESN--LEPGNGVWDWDQ--TMQQAADE--GKLIYGR 215
           G K   +NG    P  +S   +  E +  L     V ++ Q    ++  D+  G L+   
Sbjct: 131 GIKYNLSNGG---PAPESVTNKIFEKSKQLTSYKIVANFPQLDLSKKGTDQRYGPLLVDI 187

Query: 216 DKMLEQYISCVKDSFVTELDSLPKGKPWFVYTPMHGVGYQ-VFDQIASKI----LQLEVN 270
               E Y+  +K  F  + D + K    F+ T    VG++ +FD +          L V+
Sbjct: 188 IDSTEAYVKLMKSIF--DFDLIKK----FIKTQKETVGFKLLFDSLNGVTGPYGKALFVD 241

Query: 271 RDFLVVSEQLN---PDPEFPTVQFPNPEEKGALDLAIKLAENHGIKLVIASDPDADRFSV 327
              L   E L    P P+F  +  P+P    A  L ++  +   I    ASD D DR  +
Sbjct: 242 ELGLSAEESLQNYVPKPDFGGLH-PDPNLTYAHTL-VERVDKDKIAFGAASDGDGDRNMI 299

Query: 328 AFKGPHGWQQLSGNDIGFLFAYYELQKYRGFDAEYQKSHPLAMLNSTVSSQMINSMAALE 387
              GP       G+ +  +  Y     Y      + K     +  S  +S  I+ +A   
Sbjct: 300 YGYGPAFVS--PGDSVAIIAEYASEIPY------FAKQGIYGLARSFPTSAAIDRVAKAH 351

Query: 388 GFHHEDTLTGFKW 400
           G +  +  TG+K+
Sbjct: 352 GLNCYEVPTGWKF 364

>TDEL0E00210 Chr5 (28244..29956) [1713 bp, 570 aa] {ON} Anc_2.445
           YKL127W
          Length = 570

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 70/305 (22%), Positives = 121/305 (39%), Gaps = 41/305 (13%)

Query: 52  GTAGLRARMEAGFSRMNTLVVIQATQGLAQYIKKQFPDH---LVAVVGHDHRFNSMDFAK 108
           GT+GLR +       MN    +  T+   Q I    P+     + VVG D R+ +    +
Sbjct: 17  GTSGLRKKTAV---FMNN---VHYTENFIQSILDAIPESSKDAILVVGGDGRYYNDKILQ 70

Query: 109 ATATVLLKAGFEVHYLNQGDSYVHTPMVPFTV------DRVKASVGVMITASHN---PKL 159
             A +    G     + Q    + TP     +      D  K + G+++TASHN   P+ 
Sbjct: 71  IIAAISAANGVRKLVIGQ-HGLLSTPAASHIIRSYQDKDGKKVTGGIILTASHNPGGPEN 129

Query: 160 DNGYKVYYANGCQIIPPHDSAIARSI------ESNLEPGNGVWDWDQTMQQAADEGKLIY 213
           D G K   +NG     P   ++  +I       ++ +   G  + + +++     G L+ 
Sbjct: 130 DIGIKYNLSNGG----PAPESVTNAIWDISKKLTHYKIVKGFPEINLSVKGEKSYGSLVI 185

Query: 214 GRDKMLEQYISCVKDSFVTEL-----DSLPKGKPW-FVYTPMHGVGYQVFDQIASKILQL 267
                 ++Y+  +K  F  +L     D+    K W  ++  ++GV       I    L L
Sbjct: 186 DVVDTTQEYVDFLKGIFDFDLIKKFVDTQRSTKNWKLLFDGLNGVTGPYGRAIFVDELGL 245

Query: 268 EVNRDFLVVSEQLNPDPEFPTVQFPNPEEKGALDLAIKLAENHGIKLVIASDPDADRFSV 327
             N     V +  +P P+F  +  P+P    A  L  ++ +   I+   ASD D DR  +
Sbjct: 246 PENE----VLQNCHPKPDFGGIH-PDPNLTYARTLVDRV-DKEKIEFGAASDGDGDRNMI 299

Query: 328 AFKGP 332
              GP
Sbjct: 300 YGYGP 304

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 22/30 (73%)

Query: 145 ASVGVMITASHNPKLDNGYKVYYANGCQII 174
           A VGVMITASHNP  DNG K+  ++G  ++
Sbjct: 52  APVGVMITASHNPPRDNGVKIVESDGSMLL 81

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 21/28 (75%)

Query: 146 SVGVMITASHNPKLDNGYKVYYANGCQI 173
           +VGVM+TASHNP +DNG K+   NG  +
Sbjct: 61  AVGVMVTASHNPPVDNGVKIVEPNGSML 88

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 52/117 (44%), Gaps = 19/117 (16%)

Query: 145 ASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDSAIARSIESNLEPGNGVWD-WDQTMQ 203
           A VGVM+TASHNP  DNG KV    G  ++P     +A  + +NL   NG +D W +   
Sbjct: 56  AQVGVMVTASHNPPEDNGVKVVDPEG-GMLPEQWEPLATRL-ANL-AANGTFDQWWEYWT 112

Query: 204 QAADEG------KLIYGRD------KMLEQYISCVKDSFVTELDSLPKGKPWFVYTP 248
              +EG      +L  G D      ++L+  +     +      S+   KPW    P
Sbjct: 113 SLVEEGNYTGGARLCVGHDTRESSPRLLKNLMDA---ALAVSGGSITISKPWITNHP 166

>CAGL0K03421g Chr11 complement(314680..316386) [1707 bp, 568 aa]
           {ON} highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105c Phosphoglucomutase 2
          Length = 568

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 84/367 (22%), Positives = 143/367 (38%), Gaps = 40/367 (10%)

Query: 52  GTAGLRARMEAGFSRMNTLVVIQATQGLAQYIKKQFPDHL---VAVVGHDHRFNSMDFAK 108
           GT+GLR + +    + N +      +   Q + +  P+     V VVG D R+ +    +
Sbjct: 18  GTSGLRKKTKVFEDQPNYV------ENFIQSVMEAIPEGAKGAVLVVGGDGRYYNDVILQ 71

Query: 109 ATATVLLKAGFEVHYLNQGDSYVHTPMVPFTVD--RVKASVGVMITASHN---PKLDNGY 163
             A +    G +   + Q +  + TP     +   + K + G+++TASHN   P+ D G 
Sbjct: 72  KIAAIGAANGVKKLVIGQ-NGLLSTPAASHIMRTYKEKCTGGIILTASHNPGGPENDMGI 130

Query: 164 KVYYANGCQIIPPHDSAIARSIESNLEPGNGVWDWDQ----TMQQAADEGKLIYGRDKML 219
           K   +NG     P  + I   I   L     V D+ +     + +    G L+       
Sbjct: 131 KYNLSNGGPAPEPVTNKIWE-ISKKLTHYKIVKDFPELDLTKLVENKKYGPLLVDVIDTT 189

Query: 220 EQYISCVKDSFVTEL-----DSLPKGKPW-FVYTPMHGVGYQVFDQIASKILQLEVNRDF 273
           + YI  +K+ F  EL         K K W  +   M+GV        A  I   E   D 
Sbjct: 190 DAYIQLLKEIFDFELIHKFIAKQRKEKGWKLLVDSMNGVT----GPYAKAIFVDEFGLDS 245

Query: 274 LVVSEQLNPDPEFPTVQFPNPEEKGALDLAIKLAENHGIKLVIASDPDADRFSVAFKGPH 333
             V +  +P P+F  +  P+P    A  L ++      I+   ASD D DR  +   GP 
Sbjct: 246 KEVLQNWHPQPDFGGLH-PDPNLTYAHTL-VERVNKEKIEFGAASDGDGDRNMIYGYGPA 303

Query: 334 GWQQLSGNDIGFLFAYYELQKYRGFDAEYQKSHPLAMLNSTVSSQMINSMAALEGFHHED 393
                 G+ +  +  Y     Y      ++K     +  S  ++  I+ +A   G +  +
Sbjct: 304 FVS--PGDSVAIIAEYANEIPY------FKKQGIYGLARSFPTASAIDRVAKKHGLNCYE 355

Query: 394 TLTGFKW 400
             TG+K+
Sbjct: 356 VPTGWKF 362

>Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 38.9 bits (89), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 82/367 (22%), Positives = 142/367 (38%), Gaps = 40/367 (10%)

Query: 52  GTAGLRARMEAGFSRMNTLVVIQATQGLAQYIKKQFPDH---LVAVVGHDHRFNSMDFAK 108
           GT+GLR + +    + N       T+   Q I +  P+       VVG D R+ +     
Sbjct: 19  GTSGLRKKTKVFKDQPNY------TENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 109 ATATVLLKAGFEVHYLNQGDSYVHTPMVPFTVDRV--KASVGVMITASHN---PKLDNGY 163
             A +    G +   + Q    + TP     +     K + G+++TASHN   P+ D G 
Sbjct: 73  KIAAIGAANGVKKLVIGQ-HGLLSTPAASHIMRTYEEKCTGGIILTASHNPGGPENDMGI 131

Query: 164 KVYYANGCQIIPPHDSAIARSIESNLEPGNGVWDWDQ----TMQQAADEGKLIYGRDKML 219
           K   +NG    P   + +   I   L     + D+ +    T+ +    G L+     + 
Sbjct: 132 KYNLSNGGP-APESVTNVIWDISKKLTSYKIIKDFPELDLATIGKNKKYGPLLVDIIDIT 190

Query: 220 EQYISCVKDSFVTEL-----DSLPKGKPW-FVYTPMHGVGYQVFDQIASKILQLEVNRDF 273
           + Y+  +K+ F  +L     D+    K W  ++  M+GV       I      L  +   
Sbjct: 191 KDYVDFLKEIFDFKLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDEFGLPADE-- 248

Query: 274 LVVSEQLNPDPEFPTVQFPNPEEKGALDLAIKLAENHGIKLVIASDPDADRFSVAFKGPH 333
             V +  +P P+F  +  P+P    A  L +K  +   I+   ASD D DR  +   GP 
Sbjct: 249 --VLQNWHPSPDFGGMH-PDPNLTYASTL-VKRVDREKIEFGAASDGDGDRNMIYGYGPS 304

Query: 334 GWQQLSGNDIGFLFAYYELQKYRGFDAEYQKSHPLAMLNSTVSSQMINSMAALEGFHHED 393
                 G+ +  +  Y     Y      + K     +  S  +S  I+ +A   G +  +
Sbjct: 305 FVS--PGDSVAIIAEYAAEIPY------FAKQGIYGLARSFPTSAAIDRVAKAHGLNCYE 356

Query: 394 TLTGFKW 400
             TG+K+
Sbjct: 357 VPTGWKF 363

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score = 38.5 bits (88), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 22/30 (73%)

Query: 145 ASVGVMITASHNPKLDNGYKVYYANGCQII 174
           +++GVM+TASHNP  DNG K+   NG  ++
Sbjct: 66  SAIGVMVTASHNPPEDNGVKIIEPNGSMLL 95

>YMR105C Chr13 complement(475897..477606) [1710 bp, 569 aa] {ON}
           PGM2Phosphoglucomutase, catalyzes the conversion from
           glucose-1-phosphate to glucose-6-phosphate, which is a
           key step in hexose metabolism; functions as the acceptor
           for a Glc-phosphotransferase
          Length = 569

 Score = 38.5 bits (88), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 83/367 (22%), Positives = 142/367 (38%), Gaps = 40/367 (10%)

Query: 52  GTAGLRARMEAGFSRMNTLVVIQATQGLAQYIKKQFPDH---LVAVVGHDHRFNSMDFAK 108
           GT+GLR + +      N       T+   Q I +  P+       VVG D R+ +     
Sbjct: 19  GTSGLRKKTKVFKDEPNY------TENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 109 ATATVLLKAGFEVHYLNQGDSYVHTPMVPFTVDRV--KASVGVMITASHN---PKLDNGY 163
             A +    G +   + Q    + TP     +     K + G+++TASHN   P+ D G 
Sbjct: 73  KIAAIGAANGIKKLVIGQ-HGLLSTPAASHIMRTYEEKCTGGIILTASHNPGGPENDMGI 131

Query: 164 KVYYANGCQIIPPHDSAIARSIESNLEPGNGVWDWDQ----TMQQAADEGKLIYGRDKML 219
           K   +NG        +AI   I   L     + D+ +    T+ +    G L+     + 
Sbjct: 132 KYNLSNGGPAPESVTNAIWE-ISKKLTSYKIIKDFPELDLGTIGKNKKYGPLLVDIIDIT 190

Query: 220 EQYISCVKDSFVTEL-----DSLPKGKPW-FVYTPMHGVGYQVFDQIASKILQLEVNRDF 273
           + Y++ +K+ F  +L     D+    K W  ++  M+GV       I      L  +   
Sbjct: 191 KDYVNFLKEIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDEFGLPADE-- 248

Query: 274 LVVSEQLNPDPEFPTVQFPNPEEKGALDLAIKLAENHGIKLVIASDPDADRFSVAFKGPH 333
             V +  +P P+F  +  P+P    A  L +K  +   I+   ASD D DR  +   GP 
Sbjct: 249 --VLQNWHPSPDFGGMH-PDPNLTYASSL-VKRVDREKIEFGAASDGDGDRNMIYGYGPS 304

Query: 334 GWQQLSGNDIGFLFAYYELQKYRGFDAEYQKSHPLAMLNSTVSSQMINSMAALEGFHHED 393
                 G+ +  +  Y     Y      + K     +  S  +S  I+ +A   G +  +
Sbjct: 305 FVS--PGDSVAIIAEYAAEIPY------FAKQGIYGLARSFPTSGAIDRVAKAHGLNCYE 356

Query: 394 TLTGFKW 400
             TG+K+
Sbjct: 357 VPTGWKF 363

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score = 38.1 bits (87), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 20/28 (71%)

Query: 146 SVGVMITASHNPKLDNGYKVYYANGCQI 173
           +VGVMITASHNP  DNG K+   NG  +
Sbjct: 53  AVGVMITASHNPPEDNGVKIVEPNGAML 80

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score = 38.1 bits (87), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 51/108 (47%), Gaps = 25/108 (23%)

Query: 147 VGVMITASHNPKLDNGYKVYYANGCQIIP----PHDSAIARSIE---SNLEPGNGVWDW- 198
           +GVM+TASHNP +DNG KV   +G  ++P    P  + +A ++    S+ E       W 
Sbjct: 59  IGVMVTASHNPPVDNGVKVVEPDG-SMMPESWEPLATELANTLAIKGSSHERAQATHSWL 117

Query: 199 -------DQTMQQAADEG---KLIYGRD------KMLEQYISCVKDSF 230
                   Q+   + +EG    L+ GRD      K+L   ++  K+ F
Sbjct: 118 QRELKGQLQSANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELF 165

>KLTH0D04796g Chr4 (437416..439128) [1713 bp, 570 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 570

 Score = 38.1 bits (87), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 100/449 (22%), Positives = 178/449 (39%), Gaps = 68/449 (15%)

Query: 52  GTAGLRARMEAGFSRMNTLVVIQATQGLAQYIKKQFPD---HLVAVVGHDHRFNSMDFAK 108
           GT+GLR + +   +  +       T+   Q I +  P+     V VVG D R+ + +  +
Sbjct: 19  GTSGLRKKTKVFMNEPHY------TENFIQAIMEAIPEGSQDAVLVVGGDGRYYNNEVLQ 72

Query: 109 ATATVLLKAGFEVHYLNQGDSYVHTPMVPFTVDRV--KASVGVMITASHN---PKLDNGY 163
               +    G +   + Q +  + TP     +     K++ G+++TASHN   P+ D G 
Sbjct: 73  KIGEIGAANGVKKLIVGQ-NGLLSTPAASHIIRSYPEKSTGGIILTASHNPGGPENDFGI 131

Query: 164 KVYYANGCQIIPPHDSAIARSI---ESNLEPGNGVWDWDQT----MQQAADEGKLIYGRD 216
           K   +NG     P   ++  SI      L     V ++ +     + +  + G L+    
Sbjct: 132 KYNLSNGG----PAPESVTNSIFEKSKQLASYKTVKNFPKINLSKIGKNQEYGSLLVDVI 187

Query: 217 KMLEQYISCVKDSFVTELDSLPKGKPWFVYTPMHGVGYQV-FDQI-------ASKILQLE 268
            +  +Y+  +K+ F  + D + K    F+       G+++ FD +          I   E
Sbjct: 188 DVTAEYVKLMKEIF--DFDLIKK----FIDHQRSTKGFKILFDALNGITGPYGKAIFADE 241

Query: 269 VNRDFLVVSEQLNPDPEFPTVQFPNPEEKGALDLAIKLAENHGIKLVIASDPDADRFSVA 328
           +      V +   P P+F  +  P+P    A  L ++  +   I    ASD D DR  + 
Sbjct: 242 LGLPAEEVLQNYEPKPDFGGLH-PDPNLTYAHTL-VERVDKEQIAFGAASDGDGDRNMIY 299

Query: 329 FKGPHGWQQLSGNDIGFLFAYYELQKYRGFDAEYQKSHPLAMLNSTVSSQMINSMAALEG 388
             GP       G+ +  +  Y     Y      ++K     +  S  +S  I+ +A  +G
Sbjct: 300 GCGPAFVS--PGDSVAIIAEYASEIPY------FKKQGIYGLARSFPTSAAIDRVAKAQG 351

Query: 389 FHHEDTLTGFKWIGN--RALELEARGYYVPFGFEEAIGYMFPATEH--DKDGISAAVVFL 444
            +  +  TG+K+      A +L   G       EE+ G     + H  +KDG+ A V +L
Sbjct: 352 LNCYEVPTGWKFFCALFDAKKLSICG-------EESFG---TGSNHVREKDGVWAIVAWL 401

Query: 445 QAYHSWISQ----GKSPLDILDEASAKYG 469
                +  +      S   +LDE  AKYG
Sbjct: 402 NILAIYNREHPDSDVSIKVVLDEFWAKYG 430

>NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 37.7 bits (86), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 86/369 (23%), Positives = 139/369 (37%), Gaps = 44/369 (11%)

Query: 52  GTAGLRARMEAGFSRMNTLVVIQATQGLAQYIKKQFPDH---LVAVVGHDHRFNSMDFAK 108
           GT+GLR + +      N       T+   Q I    P+       VVG D R+ +     
Sbjct: 19  GTSGLRKKTKIFKDTPNY------TENFIQAIMDAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 109 ATATVLLKAGFEVHYLNQGDSYVHTPMVPFTVDRV--KASVGVMITASHNP---KLDNGY 163
             A +    G +   + Q    + TP     +     K   G+++TASHNP   K D G 
Sbjct: 73  KIAAIGAANGVKKLVIGQ-RGLLSTPAASHIMRTYEEKTQGGIILTASHNPGGIKNDMGI 131

Query: 164 KVYYANGCQIIPPHDSAIARSIESNLEPGNGVWDWD----QTMQQAADEGKLIYGRDKML 219
           K   +NG     P  + I   I   +     + D+     +T+ +    G L+       
Sbjct: 132 KFNLSNGGPAPEPVTNKIWE-ISKKMTSFKIIKDFPELELETLGKNKKYGPLLVDVIDTT 190

Query: 220 EQYISCVKDSFVTELDSLPK-------GKPW-FVYTPMHGVGYQVFDQIASKILQLEVNR 271
           + Y+  VK  F  + D + K        K W  ++  M+GV       I    L L  + 
Sbjct: 191 KAYVEFVKQIF--DFDLIKKFVHKQRDTKHWKLLFDGMNGVTGPYGKAIFVDELGLPADE 248

Query: 272 DFLVVSEQLNPDPEFPTVQFPNPEEKGALDLAIKLAENHGIKLVIASDPDADRFSVAFKG 331
               V +Q +P P+F  V  P+P    A  L  ++ +   I+   ASD D DR  +   G
Sbjct: 249 ----VLQQWHPSPDFGGVH-PDPNLTYAKALVDRV-DRENIEFGAASDGDGDRNMIYGAG 302

Query: 332 PHGWQQLSGNDIGFLFAYYELQKYRGFDAEYQKSHPLAMLNSTVSSQMINSMAALEGFHH 391
           P       G+ +  +  Y     Y      + K     +  S  +S  I+ +A   G + 
Sbjct: 303 PAFVS--PGDSVAIIAEYAAEIPY------FAKQGIYGLARSFPTSSAIDRVAKAHGLNC 354

Query: 392 EDTLTGFKW 400
            +  TG+K+
Sbjct: 355 YEVPTGWKF 363

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score = 37.7 bits (86), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 147 VGVMITASHNPKLDNGYKVYYANGCQII 174
           +GVMITASHNP  DNG K+   +G  +I
Sbjct: 59  IGVMITASHNPPQDNGVKIVEPSGAMLI 86

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 28/49 (57%), Gaps = 5/49 (10%)

Query: 147 VGVMITASHNPKLDNGYKVYYANGCQIIP---PHDSAIAR--SIESNLE 190
           VGVMITASHNP  DNG K+   +G  ++    P+   +A   S  SN E
Sbjct: 60  VGVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFE 108

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 147 VGVMITASHNPKLDNGYKVYYANGCQII 174
           VGVMITASHNP  DNG K+   +G  ++
Sbjct: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 147 VGVMITASHNPKLDNGYKVYYANGCQII 174
           VGVMITASHNP  DNG K+   +G  ++
Sbjct: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87

>Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON}
           (136243..137955) [1713 nt, 571 aa]
          Length = 570

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 53/128 (41%), Gaps = 16/128 (12%)

Query: 52  GTAGLRARMEAGFSRMNTLVVIQATQGLAQYIKKQFPDHL---VAVVGHDHRFNSMDFAK 108
           GT+GLR + +   S  N       T+   Q I    P+ +     VVG D RF +     
Sbjct: 19  GTSGLRKKTKIFMSEKN------YTENFIQSILNSIPNGVKNSTIVVGGDGRFYNDIILD 72

Query: 109 ATATVLLKAGFEVHYLNQGDSYVHTPMVPFTVDRVKASV---GVMITASHN---PKLDNG 162
               +    G     + Q +  + TP   + +   K S    G+++TASHN   P+ D G
Sbjct: 73  KIMQISAANGVRKLVIGQ-NGILSTPAASYIIRNYKESCNGGGIILTASHNPGGPENDIG 131

Query: 163 YKVYYANG 170
            K   +NG
Sbjct: 132 IKYNLSNG 139

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 147 VGVMITASHNPKLDNGYKVYYANGCQII 174
           VGVMITASHNP  DNG K+   +G  ++
Sbjct: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87

>TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 83/370 (22%), Positives = 141/370 (38%), Gaps = 46/370 (12%)

Query: 52  GTAGLRARMEAGFSRMNTLVVIQATQGLAQYIKKQFPD---HLVAVVGHDHRFNSMDFAK 108
           GT+GLR + +   +  N       T+   Q I    P+   +   VVG D RF +    +
Sbjct: 19  GTSGLRKKSKVFMNEPNY------TENFIQAILDAIPEGSENSTLVVGGDGRFYNDVILQ 72

Query: 109 ATATVLLKAGFEVHYLNQGDSYVHTPMVPFTVDRVKASV--GVMITASHN---PKLDNGY 163
             A +    G     + Q    + TP     +      V  G+++TASHN   P+ D G 
Sbjct: 73  LIAEIGAANGVRKLIIGQA-GILSTPAASHIIRTYHEEVTGGIILTASHNPGGPENDIGI 131

Query: 164 KVYYANGCQIIPPHDSAIARSI---ESNLEPGNGVWDWDQ----TMQQAADEGKLIYGRD 216
           K   ANG     P   ++  +I     NL     + D+ +    T+ +    G L+    
Sbjct: 132 KYNLANGG----PAPESVTNAIWEASKNLTTYKTMKDFPKIDINTISENVKYGPLLIDII 187

Query: 217 KMLEQYISCVKDSFVTEL-----DSLPKGKPW-FVYTPMHGVGYQVFDQIASKILQLEVN 270
              E Y+  +K+ F   L     ++  K   W  ++  ++GV       I      L  +
Sbjct: 188 DSTEDYVKFLKEIFDFPLIKKFIETQRKTNNWKLLFDSLNGVTGPYGKAIFVDEFGLPAD 247

Query: 271 RDFLVVSEQLNPDPEFPTVQFPNPEEKGALDLAIKLAENHGIKLVIASDPDADRFSVAFK 330
                V +  +P P+F  +  P+P    A  L  ++ +   I+   ASD D DR  +   
Sbjct: 248 E----VLQNWHPQPDFGGLH-PDPNLTYARTLVDRV-DKEKIEFGAASDGDGDRNMIYGY 301

Query: 331 GPHGWQQLSGNDIGFLFAYYELQKYRGFDAEYQKSHPLAMLNSTVSSQMINSMAALEGFH 390
           GP       G+ +  +  Y     Y      + K     +  S  +S  I+ +A  +G  
Sbjct: 302 GPAFVS--PGDSVAIIAEYANEIPY------FAKQGIYGVARSFPTSSAIDLVAKHKGLD 353

Query: 391 HEDTLTGFKW 400
             +  TG+K+
Sbjct: 354 CYEVPTGWKF 363

>KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 84/370 (22%), Positives = 139/370 (37%), Gaps = 46/370 (12%)

Query: 52  GTAGLRARMEAGFSRMNTLVVIQATQGLAQYIKKQFP---DHLVAVVGHDHRFNSMDFAK 108
           GT+GLR +        N       T+   Q I +  P   D    VVG D R+ +    +
Sbjct: 19  GTSGLRKKTVIFKDEPN------YTENFIQAIMESIPEGSDGATLVVGGDGRYYNDVILE 72

Query: 109 ATATVLLKAGFEVHYLNQGDSYVHTPMVPFTVDRV--KASVGVMITASHN---PKLDNGY 163
             A +    G +   + Q +  + TP     +     K + G+++TASHN   PK D G 
Sbjct: 73  KIAKIGAANGVKKLVVGQ-NGLLSTPAASHIIRSYHEKVTGGIILTASHNPGGPKNDMGI 131

Query: 164 KVYYANGCQIIPPHDSAIARSIESN---LEPGNGVWDWDQTMQQAADE----GKLIYGRD 216
           K   ANG     P   ++   I  N   L     + D          E    G ++    
Sbjct: 132 KYNLANGG----PAPESVTDKIWENSKKLTSYKIIKDLPTLDTSKIGENQKYGPILIDVI 187

Query: 217 KMLEQYISCVKDSFVTEL-----DSLPKGKPW-FVYTPMHGVGYQVFDQIASKILQLEVN 270
            + + Y+  +K+ F  EL      +  K K W  ++  ++G+       I     +L  N
Sbjct: 188 DVTKAYVEFLKEIFDFELIKKFIHTQRKTKNWKLLFDGLNGITGPYGKAIFVDEFELPEN 247

Query: 271 RDFLVVSEQLNPDPEFPTVQFPNPEEKGALDLAIKLAENHGIKLVIASDPDADRFSVAFK 330
                V +  +P P+F  +  P+P    A  L  ++ +   I+   ASD D DR  +   
Sbjct: 248 E----VLQNYHPQPDFGGLH-PDPNLTYARSLVDRV-DKEKIEFGAASDGDGDRNMIYGY 301

Query: 331 GPHGWQQLSGNDIGFLFAYYELQKYRGFDAEYQKSHPLAMLNSTVSSQMINSMAALEGFH 390
           GP       G+ +  +  Y     Y      + K     +  S  +S  I+ +A   G  
Sbjct: 302 GPAFVS--PGDSVAIIAEYASEIPY------FAKQGIYGLARSFPTSAAIDRVAKAHGLE 353

Query: 391 HEDTLTGFKW 400
             +  TG+K+
Sbjct: 354 CYEVPTGWKF 363

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 28/56 (50%), Gaps = 12/56 (21%)

Query: 117 AGFEVHYLNQGDSYVHTPMVPFTVDRVKAS-------VGVMITASHNPKLDNGYKV 165
           AGF  H     +S + T M    +  V  S       VGVMITASHNP  DNG KV
Sbjct: 22  AGFRAH-----NSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITASHNPPEDNGVKV 72

>TDEL0A02210 Chr1 (400375..402093) [1719 bp, 572 aa] {ON} Anc_2.445
           YKL127W
          Length = 572

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 83/373 (22%), Positives = 144/373 (38%), Gaps = 49/373 (13%)

Query: 52  GTAGLRARMEAGFSRMNTLVVIQATQGLAQYIKKQFPD---HLVAVVGHDHRFNSMDFAK 108
           GT+GLR + +    +         T+   Q I    P+       VVG D R+ +    +
Sbjct: 19  GTSGLRKKTKVFMEKP------HYTENFIQSILDAIPEGSKDATLVVGGDGRYYNDKILQ 72

Query: 109 ATATVLLKAGFEVHYLNQGDSYVHTPMVPFTVDRV------KASVGVMITASHN---PKL 159
             A++    G     + Q    + TP     +         K + G+++TASHN   P  
Sbjct: 73  IIASISAANGVGKLVIGQ-HGLLSTPAASHIIRTYQDKSGKKVTGGIILTASHNPGGPDN 131

Query: 160 DNGYKVYYANGCQIIPPHDSA------IARSIESNLEPGNGVWDWDQTMQQAADEGKLIY 213
           D G K   +NG    P  +S       I++ + S     N +   D + +     G L  
Sbjct: 132 DIGIKYNLSNGG---PAPESVTNAIWEISKKLTSYKIIKN-LPQLDLSTKGEKKLGNLEI 187

Query: 214 GRDKMLEQYISCVKDSFVTEL-----DSLPKGKPW-FVYTPMHGVGYQVFDQIASKILQL 267
               + + Y+  +K+ F  +L     D+    K W  ++  ++GV       I    L L
Sbjct: 188 DVVDVTQAYVEFLKEIFDFDLIKKFVDTQRSTKHWKLLFDGLNGVTGPYGKAIFVDELGL 247

Query: 268 EVNRDFLVVSEQLNPDPEFPTVQFPNPEEKGALDLAIKLAENHGIKLVIASDPDADRFSV 327
             N     V +  +P P+F  +  P+P    A  L ++  +   I+   ASD D DR  +
Sbjct: 248 PENE----VLQNCHPKPDFGGIH-PDPNLTYARTL-VERVDKEKIEFGAASDGDGDRNMI 301

Query: 328 AFKGPHGWQQLSGNDIGFLFAYYELQKYRGFDAEYQKSHPLAMLNSTVSSQMINSMAALE 387
              GP       G+ +  +  Y +   Y      + K     +  S  +S  I+ +AA +
Sbjct: 302 YGYGPAFVS--PGDSVAIIAEYAKEIPY------FAKQGIYGLARSFPTSSAIDRVAAEQ 353

Query: 388 GFHHEDTLTGFKW 400
           G +  +  TG+K+
Sbjct: 354 GLNCYEVPTGWKF 366

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 17/20 (85%)

Query: 146 SVGVMITASHNPKLDNGYKV 165
           +VGVMITASHNP  DNG K+
Sbjct: 57  TVGVMITASHNPPEDNGVKI 76

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score = 35.8 bits (81), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 17/20 (85%)

Query: 146 SVGVMITASHNPKLDNGYKV 165
           +VGVMITASHNP  DNG K+
Sbjct: 57  TVGVMITASHNPPEDNGVKI 76

>ZYRO0G02508g Chr7 (192411..194120) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 569

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 83/367 (22%), Positives = 139/367 (37%), Gaps = 40/367 (10%)

Query: 52  GTAGLRARMEAGFSRMNTLVVIQATQGLAQYIKKQFPDHL---VAVVGHDHRFNSMDFAK 108
           GT+GLR R +      N       T+   Q I +  P+ +   V +VG D R+ +    +
Sbjct: 19  GTSGLRKRTKVFAEEPNY------TENFIQAILEAIPEGVKDSVLLVGGDGRYYNDVVLQ 72

Query: 109 ATATVLLKAGFEVHYLNQGDSYVHTPMVPFTV---DRVKASVGVMITASHN---PKLDNG 162
             A +    G +   + Q +  + TP     +    + K + G+++TASHN   P  D G
Sbjct: 73  KIAAIGAANGVKRLVVGQ-NGILSTPAASHVIRSYSKAKVTGGIILTASHNPGGPNNDFG 131

Query: 163 YKVYYANGCQIIPPHDSAIARSIESNLEPGNGVWDWDQTMQQAADE---GKLIYGRDKML 219
            K   ANG    P + +         L     V D+      A  E   G L        
Sbjct: 132 IKYNLANGGP-APENVTNAMWEASKRLTSYKIVTDFPHVDLSALGEKQYGSLTVDVIDST 190

Query: 220 EQYISCVKDSFVTEL-----DSLPKGKPW-FVYTPMHGVGYQVFDQIASKILQLEVNRDF 273
           + Y+  +K  F   L     +   + K W  ++  ++GV       I +  L L  +   
Sbjct: 191 KAYVDFLKTIFDFPLIKSFVNHQRETKNWKLLFDGLNGVTGPYGRAIFADELGLPEDE-- 248

Query: 274 LVVSEQLNPDPEFPTVQFPNPEEKGALDLAIKLAENHGIKLVIASDPDADRFSVAFKGPH 333
             V +  +P P+F  +  P+P    A  L  ++ +   I    ASD D DR  +   GP 
Sbjct: 249 --VLQNCHPKPDFGGLH-PDPNLTYARTLVDRV-DRENIAFGAASDGDGDRNMIYGAGPA 304

Query: 334 GWQQLSGNDIGFLFAYYELQKYRGFDAEYQKSHPLAMLNSTVSSQMINSMAALEGFHHED 393
                 G+ +  +  Y     Y      +Q+     +  S  +SQ I+ +A        +
Sbjct: 305 FVS--PGDSVAIIAEYASEIPY------FQREGIYGLARSFPTSQAIDLVAKHHNLSCYE 356

Query: 394 TLTGFKW 400
             TG+K+
Sbjct: 357 VPTGWKF 363

>Kpol_1018.161 s1018 (412372..414081) [1710 bp, 569 aa] {ON}
           (412372..414081) [1710 nt, 570 aa]
          Length = 569

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 96/414 (23%), Positives = 164/414 (39%), Gaps = 50/414 (12%)

Query: 52  GTAGLRARMEAGFSRMNTLVVIQATQGLAQYIKKQFPDHL---VAVVGHDHRFNSMDFAK 108
           GT+GLR + +      N       T+   Q      P+       VVG D R+ +     
Sbjct: 19  GTSGLRKKTKVFAEEPNY------TENFIQATMDAIPEGCKGATLVVGGDGRYYNDVIMN 72

Query: 109 ATATVLLKAGFEVHYLNQGDSYVHTPMVPFTVD--RVKASVGVMITASHN---PKLDNGY 163
              ++    G     +   +  + TP     +   + K + G+++TASHN   PK D G 
Sbjct: 73  KIVSIAGANGVRKLIIGH-NGILSTPAASHVIRSYKEKCTGGIILTASHNPGGPKNDIGI 131

Query: 164 KVYYANGCQIIPPHDSAI--ARSIESNLEPGNGVWDWDQTMQQAAD--EGKLIYGRDKML 219
           K   ANG        +AI  A    +  +   G+ + D T + A D   G L+       
Sbjct: 132 KYNLANGGPAPESVTNAIWEASKKLTEYKVIEGLPELD-TSKIAVDIKYGPLLVDIIDST 190

Query: 220 EQYISCVKDSFVTEL-----DSLPKGKPW-FVYTPMHGVGYQVFDQIASKILQLEVNRDF 273
           E Y+  +K+ F  +L         + K W  ++  ++GV     + I  K L L  +   
Sbjct: 191 EAYVDYLKEIFDFKLIKEFVTKQRETKGWKLLFDSLNGVTGPYGEAIFVKELGLPADE-- 248

Query: 274 LVVSEQLNPDPEFPTVQFPNPEEKGALDLAIKLAENHGIKLVIASDPDADRFSVAFKGPH 333
             V +  +P P+F  +  P+P    A  L ++  +   I+   ASD D DR  +   GP 
Sbjct: 249 --VLQNWHPLPDFGGLH-PDPNLTYAHTL-VERVDKENIQFGAASDGDGDRNMIYGAGPA 304

Query: 334 GWQQLSGNDIGFLFAYYELQKYRGFDAEYQKSHPLAMLNSTVSSQMINSMAALEGFHHED 393
                 G+ +  +  Y +   Y      + K     +  S  +S  ++ +A  +G +  +
Sbjct: 305 FVS--PGDSVAIISEYADEIPY------FAKQGIYGVARSFPTSSALDRVAKAKGLNCYE 356

Query: 394 TLTGFKWIGNRALELEARGYYVPFGFEEAIGYMFPATEH--DKDGISAAVVFLQ 445
             TG+K+    AL  + +   V    EE+ G     + H  +KDG+ A V +L 
Sbjct: 357 VPTGWKFFC--ALFDDQK---VSICGEESFG---TGSNHIREKDGVWAIVAWLN 402

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score = 35.4 bits (80), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 15/19 (78%), Positives = 16/19 (84%)

Query: 147 VGVMITASHNPKLDNGYKV 165
           VGVMITASHNP  DNG K+
Sbjct: 58  VGVMITASHNPPQDNGVKI 76

>KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 57/130 (43%), Gaps = 21/130 (16%)

Query: 52  GTAGLRARMEAGFSRMNTLVVIQA---TQGLAQYIKKQFPDHL---VAVVGHDHRFNSMD 105
           GT+GLR +         T V ++    T+   Q I +  P+       V+G D RF +  
Sbjct: 20  GTSGLRKK---------TAVFMKEPHYTENFIQAILEAIPEGCKDATLVIGGDGRFYNDV 70

Query: 106 FAKATATVLLKAGFEVHYLNQGDSYVHTPMVPFTVD--RVKASVGVMITASHN---PKLD 160
                A +    G     + Q +  + TP   + +   + KA+ G+++TASHN   P+ D
Sbjct: 71  VINKIAAISAANGVRKLVIGQ-NGLLSTPATSYIIRSYKDKATGGIILTASHNPGGPEND 129

Query: 161 NGYKVYYANG 170
            G K   ANG
Sbjct: 130 MGIKYNLANG 139

>TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa]
           {ON} Anc_2.445 YKL127W
          Length = 569

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 73/302 (24%), Positives = 114/302 (37%), Gaps = 38/302 (12%)

Query: 52  GTAGLRARMEAGFSRMNTLVVIQATQGLAQYIKKQFPD---HLVAVVGHDHRFNSMDFAK 108
           GT+GLR + +      N       T+   Q I    P+       VVG D RF +     
Sbjct: 19  GTSGLRKKTKVFMDEPNY------TENFIQAIMDAIPEGSKDATLVVGGDGRFYNDVIMN 72

Query: 109 ATATVLLKAGFEVHYLNQGDSYVHTPMVPFTVDRVKASV--GVMITASHN---PKLDNGY 163
             A +    G +   + Q +  + TP     +   K  V  G+++TASHN   P  D G 
Sbjct: 73  KIAAIGAANGVKKLIIGQ-NGILSTPAASHIIRTYKDKVTGGIILTASHNPGGPTNDLGI 131

Query: 164 KVYYANGCQIIPPHDSAIARSI---ESNLEPGNGVWDWDQ----TMQQAADEGKLIYGRD 216
           K    NG     P   A+  +I      L     V D+ +    T+ +    G L+    
Sbjct: 132 KYNLGNGA----PAPEAVTDAIWEASKKLTDYKIVNDFPELDLATIVENKKYGNLLVDII 187

Query: 217 KMLEQYISCVKDSFVTELD-----SLPKGKPW-FVYTPMHGVGYQVFDQIASKILQLEVN 270
              E Y+  +K+ F   L      S  + K W  ++  ++GV       I +    L  +
Sbjct: 188 DSTEAYVKYMKEIFDFPLIKKFIVSQRETKNWKLLFDSLNGVTGPYGKAIFADEFGLPAD 247

Query: 271 RDFLVVSEQLNPDPEFPTVQFPNPEEKGALDLAIKLAENHGIKLVIASDPDADRFSVAFK 330
                V +   P P+F  +  P+P    A  L  ++ +   I+   ASD D DR  +   
Sbjct: 248 E----VLQNYVPKPDFGGLH-PDPNLTYAKTLVSRV-DKEKIEFGAASDGDGDRNMIYGY 301

Query: 331 GP 332
           GP
Sbjct: 302 GP 303

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score = 35.0 bits (79), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 22/38 (57%), Gaps = 8/38 (21%)

Query: 145 ASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDSAIA 182
           A VGVM+TASHNP  DNG K        ++ PH   +A
Sbjct: 56  AYVGVMLTASHNPPEDNGVK--------LVDPHGEMLA 85

>Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 34.7 bits (78), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 83/367 (22%), Positives = 140/367 (38%), Gaps = 40/367 (10%)

Query: 52  GTAGLRARMEAGFSRMNTLVVIQATQGLAQYIKKQFPDH---LVAVVGHDHRFNSMDFAK 108
           GT+GLR + +    + N       T+   Q I +  P+       VVG D R+ +     
Sbjct: 19  GTSGLRKKTKVFKDQPNY------TENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILN 72

Query: 109 ATATVLLKAGFEVHYLNQGDSYVHTPMVPFTVDRVK--ASVGVMITASHN---PKLDNGY 163
             A +    G +   + Q    + TP     +   +   + G+++TASHN   P+ D G 
Sbjct: 73  KIAAIGSANGIKKLVIGQ-YGLLSTPAASHIMRTYEEECTGGIILTASHNPGGPENDMGI 131

Query: 164 KVYYANGCQIIPPHDSAIARSIESNLEPGNGVWDWDQ----TMQQAADEGKLIYGRDKML 219
           K   +NG        +AI   I   L     V D+ +    T+ +    G L+     + 
Sbjct: 132 KYNLSNGGPAPESVTNAI-WDISKKLTNYKIVKDFPELDLKTIGKNKKYGPLLIDVIDIT 190

Query: 220 EQYISCVKDSFVTEL-----DSLPKGKPW-FVYTPMHGVGYQVFDQIASKILQLEVNRDF 273
           + Y+  +K  F  +L     D+    K W  ++  M+GV       I      L      
Sbjct: 191 KAYVDFLKKIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDEFGLPAEE-- 248

Query: 274 LVVSEQLNPDPEFPTVQFPNPEEKGALDLAIKLAENHGIKLVIASDPDADRFSVAFKGPH 333
             V +  +P P+F  +  P+P    A  L +K  +   I+   ASD D DR  +   GP 
Sbjct: 249 --VLQNWHPSPDFGGMH-PDPNLTYASSL-VKRVDREKIEFGAASDGDGDRNMIYGYGPS 304

Query: 334 GWQQLSGNDIGFLFAYYELQKYRGFDAEYQKSHPLAMLNSTVSSQMINSMAALEGFHHED 393
                 G+ +  +  Y     Y      + K     +  S  +S  I+ +A   G +  +
Sbjct: 305 FVS--PGDSVAIIAEYAAEIPY------FAKQGIYGLARSFPTSAAIDRVAKAHGLNCYE 356

Query: 394 TLTGFKW 400
             TG+K+
Sbjct: 357 VPTGWKF 363

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score = 34.3 bits (77), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 19/28 (67%)

Query: 146 SVGVMITASHNPKLDNGYKVYYANGCQI 173
           +VGVMITASHN   DNG K+   +G  +
Sbjct: 57  AVGVMITASHNQPCDNGVKIVEPDGSML 84

>NCAS0A04350 Chr1 (878688..880397) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 34.3 bits (77), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 83/371 (22%), Positives = 137/371 (36%), Gaps = 48/371 (12%)

Query: 52  GTAGLRARMEAGFSRMNTLVVIQATQGLAQYIKKQFPD---HLVAVVGHDHRFNSMDFAK 108
           GT+GLR +     +  N       T+   Q +    P+       VVG D RF +     
Sbjct: 19  GTSGLRKKTAIFMNEPNY------TENFIQAMLDAIPEGSQDATLVVGGDGRFYNDVIMN 72

Query: 109 ATATVLLKAGFEVHYLNQGDSYVHTPMVPFTVDRVKASV--GVMITASHN---PKLDNGY 163
             A +    G +   + Q +  + TP     +   +  V  G+++TASHN   P+ D G 
Sbjct: 73  KIAAISAANGVKKLIIGQ-NGLLSTPAASHIIRSYEEKVTGGIILTASHNPGGPENDLGI 131

Query: 164 KVYYANGCQIIPPHDSAIAR--------SIESNLEPGNGVWDWDQTMQQAADEGKLIYGR 215
           K   ANG        +AI           I  N  P     D  + M +    G L+   
Sbjct: 132 KYNLANGGPAPESVTNAIWEVSKKLTHYKIIKNFPP----LDLSK-MGKDQKYGPLLVDI 186

Query: 216 DKMLEQYISCVKDSFVTEL-----DSLPKGKPW-FVYTPMHGVGYQVFDQIASKILQLEV 269
             + + Y+  +K+ F  EL         + K W  ++  ++G+       I      L  
Sbjct: 187 IDVTKDYVDFLKEIFDFELIKKFIHKQRETKNWKLLFDSLNGITGPYGKAIFVDEFDLPA 246

Query: 270 NRDFLVVSEQLNPDPEFPTVQFPNPEEKGALDLAIKLAENHGIKLVIASDPDADRFSVAF 329
           N     V +  +P P+F  +  P+P    A  L ++  +   I+   ASD D DR  +  
Sbjct: 247 NE----VLQNWHPKPDFGGLH-PDPNLTYAKTL-VERVDREKIEFGAASDGDGDRNMIYG 300

Query: 330 KGPHGWQQLSGNDIGFLFAYYELQKYRGFDAEYQKSHPLAMLNSTVSSQMINSMAALEGF 389
            GP       G+ +  +  Y     Y      + K     +  S  +S  I+ +A   G 
Sbjct: 301 AGPAFVS--PGDSVAIIAEYASEIPY------FVKQGIYGLARSFPTSAAIDRVAKAHGL 352

Query: 390 HHEDTLTGFKW 400
              +  TG+K+
Sbjct: 353 SCYEVPTGWKF 363

>SAKL0A09570g Chr1 complement(838406..839041) [636 bp, 211 aa] {ON}
           similar to gnl|GLV|CAGL0K03069g Candida glabrata
           CAGL0K03069g and weakly similar to YMR073C
           uniprot|Q04772 Saccharomyces cerevisiae YMR073C
           Hypothetical ORF
          Length = 211

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 1/60 (1%)

Query: 189 LEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFVTELDSLPKGKPWFVYTP 248
           L+PG+   DW +       EGKL+ G DK L    S    +    L  L +G P F+  P
Sbjct: 74  LKPGHSALDWSRICTTKGREGKLVTGLDKYLNSP-SVQTINHPNALIQLQRGVPTFMINP 132

>Skud_11.102 Chr11 (190406..192118) [1713 bp, 570 aa] {ON} YKL127W
           (REAL)
          Length = 570

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 54/127 (42%), Gaps = 14/127 (11%)

Query: 52  GTAGLRARMEAGFSRMN-TLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKAT 110
           GT+GLR + +   +  + T   IQA   + + I    PD    VVG D RF +       
Sbjct: 19  GTSGLRKKTKVFMNEPHYTENFIQA---MMESIPNG-PDGATLVVGGDGRFYNDVIMNKI 74

Query: 111 ATVLLKAGFEVHYLNQGDSYVHTPMVPFTV----DRVKASVGVMITASHN---PKLDNGY 163
           A V    G     + QG   + TP     +    DR     G+++TASHN   P+ D G 
Sbjct: 75  AAVGAANGIRKLIIGQG-GLLSTPAASHIIRTYEDRCNGG-GIILTASHNPGGPENDLGI 132

Query: 164 KVYYANG 170
           K    NG
Sbjct: 133 KYNLRNG 139

>KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 81/370 (21%), Positives = 140/370 (37%), Gaps = 46/370 (12%)

Query: 52  GTAGLRARMEAGFSRMNTLVVIQATQGLAQYIKKQFPDHL---VAVVGHDHRFNSMDFAK 108
           GT+GLR +  A F+          T+   Q + +  P+       VVG D R+ +     
Sbjct: 19  GTSGLRKKT-AVFTNEP-----HYTENFIQAVMEAIPEGCKGATLVVGGDGRYYNDVILH 72

Query: 109 ATATVLLKAGFEVHYLNQGDSYVHTPMVPFTVD--RVKASVGVMITASHN---PKLDNGY 163
             A +    G     + Q +  + TP     +   + K + G+++TASHN   PK D G 
Sbjct: 73  KIAAIGAANGVRKLVIGQ-NGLLSTPAASHIMRTYKEKCTGGIILTASHNPGGPKNDMGI 131

Query: 164 KVYYANGCQIIPPHDSAIARSIESNLEPGNGVWDWDQ----TMQQAADEGKLIYGRDKML 219
           K   +NG     P  + I   +   L+    + D  +    T+ +    G L+       
Sbjct: 132 KYNLSNGGPAPEPVTNKIWE-VSKQLDHYKIIPDLPELALDTLAENVQYGPLLVDVVDTT 190

Query: 220 EQYISCVKD--------SFVTELDSLPKGKPW-FVYTPMHGVGYQVFDQIASKILQLEVN 270
             Y+  +K+        SF+ +  S    K W  ++  M+GV       I     +L   
Sbjct: 191 RDYVEFLKEIFDFPLIKSFIHKQRSQ---KHWKLLFDGMNGVTGPYGKAIFVDEFELPAE 247

Query: 271 RDFLVVSEQLNPDPEFPTVQFPNPEEKGALDLAIKLAENHGIKLVIASDPDADRFSVAFK 330
                V +  +P P+F  +  P+P    A  L  ++ +   I+   ASD D DR  +   
Sbjct: 248 E----VLQNWHPQPDFGGIH-PDPNLTYARSLVDRV-DRENIEFGAASDGDGDRNMIYGA 301

Query: 331 GPHGWQQLSGNDIGFLFAYYELQKYRGFDAEYQKSHPLAMLNSTVSSQMINSMAALEGFH 390
           GP       G+ +  +  Y     Y      + K     +  S  ++  I+ +A   G  
Sbjct: 302 GPAFVS--PGDSVAIIAEYAAEIPY------FAKQGIYGLARSFPTASAIDRVAEKHGLK 353

Query: 391 HEDTLTGFKW 400
             +  TG+K+
Sbjct: 354 CYEVPTGWKF 363

>Suva_13.282 Chr13 complement(457565..459274) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 64/270 (23%), Positives = 106/270 (39%), Gaps = 28/270 (10%)

Query: 144 KASVGVMITASHN---PKLDNGYKVYYANGCQIIPPHDSAIARSIESNLEPGNGVWDWD- 199
           K + G+++TASHN   P+ D G K   +NG        +AI   I   L     V D+  
Sbjct: 109 KCTGGIILTASHNPGGPENDMGIKYNLSNGGPAPESVTNAIWE-ISKKLTSYKIVKDFPE 167

Query: 200 ---QTMQQAADEGKLIYGRDKMLEQYISCVKDSFVTEL-----DSLPKGKPW-FVYTPMH 250
              QT+ +    G L+     + + Y+  +++ F   L     D+    K W  ++  M+
Sbjct: 168 LDLQTIGKDRKYGPLLIDIIDVTKAYVELMEEIFDFNLIKKFIDNQRSTKNWKLLFDSMN 227

Query: 251 GVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEEKGALDLAIKLAENH 310
           GV       I      L        V +  +P P+F  +  P+P    A  L +K  +  
Sbjct: 228 GVTGPYGKAIFVDKFGLPAEE----VLQNWHPSPDFGGMH-PDPNLTYASSL-VKRVDRE 281

Query: 311 GIKLVIASDPDADRFSVAFKGPHGWQQLSGNDIGFLFAYYELQKYRGFDAEYQKSHPLAM 370
            I+   ASD D DR  +   GP       G+ +  +  Y     Y      + K     +
Sbjct: 282 QIEFGAASDGDGDRNMIYGYGPSFVS--PGDSVAIIAEYAAEIPY------FAKQGIYGL 333

Query: 371 LNSTVSSQMINSMAALEGFHHEDTLTGFKW 400
             S  +S  I+ +A   G +  +  TG+K+
Sbjct: 334 ARSFPTSAAIDRVAKAHGLNCYEVPTGWKF 363

>ABL029W Chr2 (343850..345556) [1707 bp, 568 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL127W (PGM1) and
           YMR105C (PGM2)
          Length = 568

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 57/128 (44%), Gaps = 15/128 (11%)

Query: 52  GTAGLRARMEAGFSRMNTLVVIQATQGLAQYIKKQFPD---HLVAVVGHDHRFNSMDFAK 108
           GT+GLR + +  F +         T+   Q I +  P+   + V V+G D R+ +    +
Sbjct: 19  GTSGLRKKTKV-FEQTE-----HYTENFIQAIMESIPEGSENAVLVIGGDGRYYNDAVMQ 72

Query: 109 ATATVLLKAGFEVHYLNQGDSYVHTPMVPFTVDRV--KASVGVMITASHNP-KLDNGYKV 165
             A V    G     + Q +  + TP     +     K + G+++TASHNP   DN + +
Sbjct: 73  KIAEVGSANGVRKLIIGQ-NGLLSTPAASHIIRTYHDKVTGGIILTASHNPGGPDNDFGI 131

Query: 166 YY--ANGC 171
            Y  ANG 
Sbjct: 132 KYNLANGA 139

>Skud_7.567 Chr7 complement(929563..933033) [3471 bp, 1156 aa] {ON}
            YGR233C (REAL)
          Length = 1156

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 26/41 (63%), Gaps = 5/41 (12%)

Query: 500  KGENYPRTIGDLQVKT-FRDLTTG-YQSDTPNNIPNLHVDP 538
            K  N+P     LQ+K+ FRDLTTG + SDTPN +  L V P
Sbjct: 1034 KQPNFPVL---LQMKSLFRDLTTGKFMSDTPNCLNELAVSP 1071

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/19 (73%), Positives = 15/19 (78%)

Query: 147 VGVMITASHNPKLDNGYKV 165
           VG MITASHNP  DNG K+
Sbjct: 58  VGAMITASHNPPQDNGVKL 76

>NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 81/367 (22%), Positives = 139/367 (37%), Gaps = 40/367 (10%)

Query: 52  GTAGLRARMEAGFSRMNTLVVIQATQGLAQYIKKQFPDHL---VAVVGHDHRFNSMDFAK 108
           GT+GLR +      +         T+   Q I    P+       VVG D R+ +     
Sbjct: 19  GTSGLRKKTRVFKDKP------HYTENFIQAIMDAIPEGAKGATLVVGGDGRYYNDVILH 72

Query: 109 ATATVLLKAGFEVHYLNQGDSYVHTPMVPFTVDRV--KASVGVMITASHNP---KLDNGY 163
             A +    G +   + Q    + TP     +     K + G+++TASHNP   + D G 
Sbjct: 73  KIAAIGAANGVKKLVVGQ-HGLLSTPAASHIMRTYEEKTTGGIILTASHNPGGLENDMGI 131

Query: 164 KVYYANGCQIIPPHDSAIARSIESNLEPGNGVWDWD----QTMQQAADEGKLIYGRDKML 219
           K   +NG     P  + I   I   +     + D+     +T+ +    G L+     + 
Sbjct: 132 KYNLSNGGPAPEPVTNKIWE-ISKKMTHYKIIKDFPELELETLGKNKKYGPLLVDVIDIT 190

Query: 220 EQYISCVKDSFVTEL-----DSLPKGKPW-FVYTPMHGVGYQVFDQIASKILQLEVNRDF 273
           + Y+  +K+ F  EL      +  + K W  ++  M+GV       I      L  +   
Sbjct: 191 KAYVDFLKEIFDFELIKKFIHNQREKKHWKLLFDGMNGVTGPYGKAIFVDEFGLPADE-- 248

Query: 274 LVVSEQLNPDPEFPTVQFPNPEEKGALDLAIKLAENHGIKLVIASDPDADRFSVAFKGPH 333
             V +Q +P P+F  V  P+P    A  L  ++     I+   ASD D DR  +   GP 
Sbjct: 249 --VLQQWHPQPDFGGVH-PDPNLTYAKALVDRVNREK-IEFGAASDGDGDRNMIYGAGPA 304

Query: 334 GWQQLSGNDIGFLFAYYELQKYRGFDAEYQKSHPLAMLNSTVSSQMINSMAALEGFHHED 393
                 G+ +  +  Y     Y      ++K     +  S  ++  I+ +A   G +   
Sbjct: 305 FVS--PGDSVAIIAEYASEIPY------FKKQGIYGLARSFPTASSIDRVAKAHGLNCYQ 356

Query: 394 TLTGFKW 400
             TG+K+
Sbjct: 357 VPTGWKF 363

>TBLA0A08380 Chr1 (2060218..2061417) [1200 bp, 399 aa] {ON}
           Anc_4.190 YLR355C
          Length = 399

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 3/56 (5%)

Query: 535 HVDPSSQMITIVAQPKGGGSGEHVRFTLR-GSGTEPKLKVYIEAGAQSDPRARELA 589
           HV+P   + TI+  PK  GSG  VR   + G G      V+ +   ++D +A+ LA
Sbjct: 186 HVEPPKDIDTILVAPK--GSGRTVRSLFKEGRGINSSYAVWNDVSGKADEKAQALA 239

>KLLA0E18459g Chr5 (1641507..1641953) [447 bp, 148 aa] {ON} similar
           to uniprot|Q59TA9 Candida albicans CaO19 Potential
           heme/steroid binding protein and some similarites with
           YMR073C uniprot|Q04772 Saccharomyces cerevisiae YMR073C
           Hypothetical ORF
          Length = 148

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 17/26 (65%)

Query: 189 LEPGNGVWDWDQTMQQAADEGKLIYG 214
           L+PG+G  DW Q  Q    +G+L+YG
Sbjct: 31  LKPGHGPLDWQQLQQDKGMKGELVYG 56

>TPHA0G02470 Chr7 (507445..509154) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 51/128 (39%), Gaps = 15/128 (11%)

Query: 52  GTAGLRARMEAGFSRMNTLVVIQATQGLAQYIKKQFPD---HLVAVVGHDHRFNSMDFAK 108
           GT+GLR + +   +  N       T+   Q I    P+       VVG D RF +    +
Sbjct: 19  GTSGLRKKTKIFMNEPNY------TENFIQAILDAIPEGSEDSTLVVGGDGRFYNDVILQ 72

Query: 109 ATATVLLKAGFEVHYLNQGDSYVHTPMVPFTVDRVKASV--GVMITASHN---PKLDNGY 163
             A +    G     + Q    + TP     +      V  G+++TASHN   P+ D G 
Sbjct: 73  LIAEIGAANGVRKLIIGQA-GILSTPATSHVIRTYHEEVTGGIILTASHNPGGPENDIGI 131

Query: 164 KVYYANGC 171
           K   ANG 
Sbjct: 132 KYNLANGA 139

>Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C
           (PGM2) - Phosphoglucomutase [contig 55] FULL
          Length = 570

 Score = 31.2 bits (69), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 54/127 (42%), Gaps = 15/127 (11%)

Query: 52  GTAGLRARMEAGFSRMNTLVVIQATQGLAQYIKKQFPD---HLVAVVGHDHRFNSMDFAK 108
           GT+GLR + +      +       T+   Q I +  P+   +   VVG D R+ + +  +
Sbjct: 19  GTSGLRKKTKVFKDEPHY------TENFIQAILEAIPEGSENATLVVGGDGRYYNNEVMQ 72

Query: 109 ATATVLLKAGFEVHYLNQGDSYVHTPMVPFTVDRV--KASVGVMITASHN---PKLDNGY 163
               +    G     L Q +  + TP     +     K + G+++TASHN   P+ D G 
Sbjct: 73  IIGAIAAANGVRKMILGQ-NGILSTPAASHIIRSYPEKCTGGIILTASHNPGGPENDFGI 131

Query: 164 KVYYANG 170
           K   +NG
Sbjct: 132 KYNLSNG 138

>TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {ON}
           Anc_4.309 YLR429W
          Length = 642

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 61/145 (42%), Gaps = 24/145 (16%)

Query: 296 EKGALDLAIKLAENHGIKLVIASDPDADRFSVAFKGPHGWQQLSGNDIGFLFAYYELQKY 355
           EKG L     + ++ GI L+   DPD     +A KG        GN       YYE Q  
Sbjct: 262 EKGDLGGFYTVDQSSGI-LMPFYDPDNKILYLAGKG-------DGN-----IRYYEFQND 308

Query: 356 RGFD-AEYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYY 414
             F+ +EYQ + P     +    +M+N           + L  FK + ++ +E     +Y
Sbjct: 309 ELFELSEYQSTEPQRGF-AVAPKRMVN-------VRDNEVLRCFKTVVDQYIE--PLSFY 358

Query: 415 VPFGFEEAIGYMFPATEHDKDGISA 439
           VP   EE    ++PA   DK  ++A
Sbjct: 359 VPRRSEEFQEDIYPAAPSDKPALTA 383

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 66,544,147
Number of extensions: 2896837
Number of successful extensions: 7015
Number of sequences better than 10.0: 76
Number of HSP's gapped: 7099
Number of HSP's successfully gapped: 76
Length of query: 610
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 494
Effective length of database: 40,180,143
Effective search space: 19848990642
Effective search space used: 19848990642
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)