Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0G14168g8.839ON76476435860.0
TDEL0B005808.839ON71363526030.0
KAFR0B039108.839ON72464323900.0
CAGL0M02959g8.839ON75863923870.0
NCAS0C004208.839ON72564023170.0
TBLA0D032608.839ON76867523090.0
Kpol_1068.98.839ON74563923080.0
TPHA0I002408.839ON73264522390.0
NDAI0K004208.839ON77869122330.0
YMR277W (FCP1)8.839ON73265321770.0
Smik_13.4908.839ON73265221680.0
Skud_13.4498.839ON73465521470.0
Suva_13.4658.839ON73265221200.0
KNAG0J002808.839ON74265820860.0
SAKL0D01496g8.839ON68864020500.0
Kwal_27.102638.839ON74364220130.0
KLTH0C03894g8.839ON74563619850.0
Ecym_46108.839ON75164919820.0
ABL127W8.839ON72864419550.0
KLLA0D01595g8.839ON71963518670.0
TPHA0H010705.94ON10151181030.001
Kpol_1010.615.94ON93297990.003
TPHA0E030705.202ON494177980.004
Ecym_20665.94ON880115970.006
NDAI0C032305.94ON1034108940.015
Smik_12.825.202ON39245930.015
SAKL0G12870g5.202ON39961910.027
YLR019W (PSR2)5.202ON39745910.028
TBLA0I014602.530ON393103880.050
Suva_8.4007.46ON98588880.068
Skud_12.875.202ON39245860.086
Ecym_44607.111ON731143850.14
NCAS0A068005.202ON47351840.19
Skud_8.492.530ON447134840.20
KNAG0M017405.202ON481113820.29
Suva_10.995.202ON38545810.38
NDAI0E039307.46ON102899820.39
NDAI0D018605.202ON514125810.39
TPHA0N006705.202ON45241810.41
TBLA0C060905.202ON484121810.46
NDAI0I021705.202ON39145800.53
KAFR0E021405.94ON95182800.70
YPL063W (TIM50)8.527ON476110790.83
NDAI0G016203.196ON73949790.92
KLLA0F15620g5.202ON41446781.0
ZYRO0B15026g5.94ON1162105771.4
NCAS0D027405.202ON39845761.5
Skud_16.2188.527ON480100752.0
SAKL0A09416g2.530ON385239752.1
YLL010C (PSR1)5.202ON42742752.4
Smik_12.535.202ON41442742.4
ZYRO0D12914g5.543ON603110752.4
KAFR0E010208.527ON448164752.4
Suva_16.2498.527ON480100742.7
Suva_10.655.202ON41543742.8
YOR346W (REV1)7.46ON98583742.9
Ecym_50527.46ON873111743.7
CAGL0L06644g5.94ON82873725.4
AFR095C1.276ON67039709.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0G14168g
         (764 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} simi...  1385   0.0  
TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {O...  1007   0.0  
KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.8...   925   0.0  
CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} simil...   924   0.0  
NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}...   897   0.0  
TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.8...   894   0.0  
Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON...   893   0.0  
TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839...   867   0.0  
NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON...   864   0.0  
YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}  FCP1Carbo...   843   0.0  
Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277...   839   0.0  
Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277...   831   0.0  
Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277...   821   0.0  
KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON...   808   0.0  
SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {...   794   0.0  
Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {...   780   0.0  
KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {...   769   0.0  
Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar...   768   0.0  
ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic ho...   757   0.0  
KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {...   723   0.0  
TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5....    44   0.001
Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932...    43   0.003
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...    42   0.004
Ecym_2066 Chr2 complement(110523..113165) [2643 bp, 880 aa] {ON}...    42   0.006
NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5....    41   0.015
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...    40   0.015
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...    40   0.027
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...    40   0.028
TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {O...    39   0.050
Suva_8.400 Chr8 (717697..720654) [2958 bp, 985 aa] {ON} YOR346W ...    39   0.068
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...    38   0.086
Ecym_4460 Chr4 (939029..941224) [2196 bp, 731 aa] {ON} similar t...    37   0.14 
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    37   0.19 
Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON} Y...    37   0.20 
KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5....    36   0.29 
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...    36   0.38 
NDAI0E03930 Chr5 (868403..871489) [3087 bp, 1028 aa] {ON} Anc_7....    36   0.39 
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     36   0.39 
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    36   0.41 
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...    36   0.46 
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202     35   0.53 
KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.9...    35   0.70 
YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}  TIM50Esse...    35   0.83 
NDAI0G01620 Chr7 (357000..359219) [2220 bp, 739 aa] {ON} Anc_3.1...    35   0.92 
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...    35   1.0  
ZYRO0B15026g Chr2 complement(1222480..1225968) [3489 bp, 1162 aa...    34   1.4  
NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {O...    34   1.5  
Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063...    33   2.0  
SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {...    33   2.1  
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    33   2.4  
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    33   2.4  
ZYRO0D12914g Chr4 complement(1089169..1090980) [1812 bp, 603 aa]...    33   2.4  
KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.5...    33   2.4  
Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063...    33   2.7  
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    33   2.8  
YOR346W Chr15 (981828..984785) [2958 bp, 985 aa] {ON}  REV1Deoxy...    33   2.9  
Ecym_5052 Chr5 (112351..114972) [2622 bp, 873 aa] {ON} similar t...    33   3.7  
CAGL0L06644g Chr12 (750307..752793) [2487 bp, 828 aa] {ON} some ...    32   5.4  
AFR095C Chr6 complement(604687..606699) [2013 bp, 670 aa] {ON} S...    32   9.1  

>ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277W FCP1
           Carboxy-terminal domain (CTD) phosphatase
          Length = 764

 Score = 1385 bits (3586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 678/764 (88%), Positives = 678/764 (88%)

Query: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDENDGNGGAQH 60
           MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDENDGNGGAQH
Sbjct: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDENDGNGGAQH 60

Query: 61  SKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTMCGK 120
           SKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTMCGK
Sbjct: 61  SKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTMCGK 120

Query: 121 EVDENDQMEANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDLDQTVIHCGV 180
           EVDENDQMEANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDLDQTVIHCGV
Sbjct: 121 EVDENDQMEANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDLDQTVIHCGV 180

Query: 181 DPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRLPERKCWYFVKVRPGLREF 240
           DPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRLPERKCWYFVKVRPGLREF
Sbjct: 181 DPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRLPERKCWYFVKVRPGLREF 240

Query: 241 FAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQKSLERLFPTD 300
           FAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQKSLERLFPTD
Sbjct: 241 FAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQKSLERLFPTD 300

Query: 301 QSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQLGRRTHKKPQE 360
           QSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQLGRRTHKKPQE
Sbjct: 301 QSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQLGRRTHKKPQE 360

Query: 361 SDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEPVQGESKEQLTKKLEYSASLE 420
           SDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEPVQGESKEQLTKKLEYSASLE
Sbjct: 361 SDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEPVQGESKEQLTKKLEYSASLE 420

Query: 421 VQQQNRPLATLQKHMHNQRXXXXXXXXXXXXXXXXAKIHRKYYKLLDEGNENSADIQSLV 480
           VQQQNRPLATLQKHMHNQR                AKIHRKYYKLLDEGNENSADIQSLV
Sbjct: 421 VQQQNRPLATLQKHMHNQRLLVDDDDELYYLKDTLAKIHRKYYKLLDEGNENSADIQSLV 480

Query: 481 PTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHVITKTPGTY 540
           PTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHVITKTPGTY
Sbjct: 481 PTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHVITKTPGTY 540

Query: 541 KARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEIQDFKRKIEQRHL 600
           KARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEIQDFKRKIEQRHL
Sbjct: 541 KARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEIQDFKRKIEQRHL 600

Query: 601 IEEQRREQFESEALMKTAQDSTLNLFAGGTSWLNXXXXXXXXXXXXXXXXXXXXXXXXVA 660
           IEEQRREQFESEALMKTAQDSTLNLFAGGTSWLN                        VA
Sbjct: 601 IEEQRREQFESEALMKTAQDSTLNLFAGGTSWLNDEDEEISEDEEDDNDDEEEEEEEDVA 660

Query: 661 DGGYGANDIPDGGNEDNRNKENDSDRAPTNXXXXXXXXXXXXXXXXXXXTKDPESLKRAL 720
           DGGYGANDIPDGGNEDNRNKENDSDRAPTN                   TKDPESLKRAL
Sbjct: 661 DGGYGANDIPDGGNEDNRNKENDSDRAPTNQQDQQDQKQDQGGEKPQEQTKDPESLKRAL 720

Query: 721 XXXXXXXXXXXXXXKKVHLENSKGNRXXXXXXXXXXXXXNALDA 764
                         KKVHLENSKGNR             NALDA
Sbjct: 721 QNSDSQSSEDQPSQKKVHLENSKGNREDDSESDLEEELLNALDA 764

>TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {ON}
           Anc_8.839 YMR277W
          Length = 713

 Score = 1007 bits (2603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/635 (75%), Positives = 544/635 (85%), Gaps = 10/635 (1%)

Query: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDENDGNGGAQH 60
           M TPV +PE LPYPITIDQLIAPIGS V+KGQRLFA+KFWYMVEIASSPDEN+G     H
Sbjct: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSPDENEGG----H 56

Query: 61  SKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTMCGK 120
            KKTVRESIEFFE+PFEGDL+SW VD GDEV +  Q ICEI RPCNHD+VYGGLCT+CGK
Sbjct: 57  RKKTVRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTLCGK 116

Query: 121 EVDENDQMEANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDLDQTVIHCGV 180
           EVDE++Q   NLAISHTD NLKVSRKEA D+E+ LK RLR+SKKLVLVVDLDQTVIHCGV
Sbjct: 117 EVDESEQFNGNLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDLDQTVIHCGV 176

Query: 181 DPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRLPERKCWYFVKVRPGLREF 240
           DPTIGEWK+D SNPNYE LKDVQ F+L+EEPI+P +YMGP+ P RKCWY+VKVRPGL+EF
Sbjct: 177 DPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPKPPVRKCWYYVKVRPGLKEF 236

Query: 241 FAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQKSLERLFPTD 300
           F ++APL+EMHIYTMATR YALEIAKIIDPDGSLFGDRILSRDENGS+TQKSLERLFPTD
Sbjct: 237 FDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQKSLERLFPTD 296

Query: 301 QSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQLGRRTHKKPQE 360
           QSMV+VIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQ+ +LQLGR   KK QE
Sbjct: 297 QSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQLGRGARKKTQE 356

Query: 361 SDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEPVQGESKEQLTKKLEYSASLE 420
           SDEL+TDIMDTEK+LQEKIDEEVKRQEEKL+HQ+ + +E    ESK+QL KKLEYSASLE
Sbjct: 357 SDELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMASGEEVPAPESKDQLAKKLEYSASLE 416

Query: 421 VQQQNRPLATLQKHMHNQRXXXXXXXXXXXXXXXXAKIHRKYYKLLDEGNENSADIQSLV 480
           VQQQNRPLATLQKHMHNQR                AK+H +YYK L + +E  ADI++L+
Sbjct: 417 VQQQNRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYYKTLGQDSEKKADIKTLL 476

Query: 481 PTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHVITKTPGTY 540
           P MK +VF+DC+FVFSGLIPLGTNI RADIVLWT MFGA +S EID++TTHVIT+TPGTY
Sbjct: 477 PLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTHVITRTPGTY 536

Query: 541 KARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEIQDFKRKIEQR-H 599
           KARIAK FNEN+KVVHPDWVFECLV+W HVDEKPYELI++  AT+EE+ D+K+K+ +R  
Sbjct: 537 KARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDYKQKLARRSS 596

Query: 600 LIEEQRREQFESEALMKTAQDSTLNLFAGGTSWLN 634
            + EQ     E E  M++A++ T+NLFAGGTSWLN
Sbjct: 597 ALAEQ-----EMELAMESAKNGTINLFAGGTSWLN 626

>KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.839
           YMR277W
          Length = 724

 Score =  925 bits (2390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/643 (67%), Positives = 527/643 (81%), Gaps = 10/643 (1%)

Query: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDEND---GNGG 57
           M TPV+APE LPYPITID+LI PIG+ ++KG RLFAYKFWYMVEIASSPD+ND    +  
Sbjct: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDNDPANTDTQ 60

Query: 58  AQHSKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTM 117
           A H KK +RESIEFF++PFEG L+SW +D GDE++SA QVICEI RPCNHD+VYGGLCT 
Sbjct: 61  ASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQ 120

Query: 118 CGKEVDENDQME--ANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDLDQTV 175
           CGKEVDE++Q +  +N  +SHTDTNLK+SRKEA D+    K+RLR  KKLVLVVDLDQTV
Sbjct: 121 CGKEVDESEQSQFGSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVVDLDQTV 180

Query: 176 IHCGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRLPERKCWYFVKVRP 235
           IHCGVDPTIGEWK DP+NPNY+TLKDVQMF+LEEEP++P MYMGP+   RKCWY+VKVRP
Sbjct: 181 IHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGPKPTPRKCWYYVKVRP 240

Query: 236 GLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQKSLER 295
           GL+EFF ++APL+EMHIYTMATR YALEI KIIDP G LFG+RILSRDENGSLT KSLER
Sbjct: 241 GLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSRDENGSLTSKSLER 300

Query: 296 LFPTDQSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQLGRRTH 355
           LFPTDQSMVI+IDDRGDVWNW PNLIKVVPY+FFVGVGDINSNFLP+QQ+ +LQLGRR+ 
Sbjct: 301 LFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQLGRRSR 360

Query: 356 KKPQESDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEPVQGESKEQLTKKLEY 415
           +K +E+DELLTDIMDTEK+LQEKIDEEVKRQE+ LSHQ+   +E V  E+KE+ TKKLE+
Sbjct: 361 EKAKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSHQVVPTEESVSNETKEEWTKKLEH 420

Query: 416 SASLEVQQQNRPLATLQKHMHNQRXXXXXXXXXXXXXXXXAKIHRKYYKLLDEG--NENS 473
           SAS+EVQQQNRPLA LQ+H+HNQR                AK+H +YY +L+    +E+ 
Sbjct: 421 SASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNEYYSILENKSLDESG 480

Query: 474 ADIQSLVPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHVI 533
           ADI+ ++P +K  VF+ C+FVFSGLIPL T+IRRADIV+WT MFGA +SSEI+E TTHVI
Sbjct: 481 ADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGAESSSEINEVTTHVI 540

Query: 534 TKTPGTYKARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEIQDFKR 593
           TKTPGT+KAR+AK FN ++K+VHPDWVFECL+ WTHVDEKPY LI+++P ++ E++ F+ 
Sbjct: 541 TKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIVEEPISDRELKKFRE 600

Query: 594 KIEQRHLIEEQRREQFESEALMKTAQ--DSTLNLFAGGTSWLN 634
            +  R L  E+  EQ   +      +  D+T++LFA GTSWLN
Sbjct: 601 DLNNRKLT-ERNNEQNSGDITGTIVENFDNTVDLFATGTSWLN 642

>CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277w FCP1
          Length = 758

 Score =  924 bits (2387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/639 (69%), Positives = 530/639 (82%), Gaps = 5/639 (0%)

Query: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDENDGNGGA-- 58
           M+TPV+ P  LPYPIT+D+L+ PIGS V+KGQRLFAYKFWYMVEIA+SPD+ND +     
Sbjct: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYEGPE 60

Query: 59  -QHSKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTM 117
            + SK+ VRESIEF+E+PFEGDL+SW VD  DE+A     +CEI RPCNHD+VYGGLCTM
Sbjct: 61  IEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTM 120

Query: 118 CGKEVDENDQMEANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDLDQTVIH 177
           CGKEVDE DQ++ANL ISHTDTNL+VSRKEA D++  +  RL+  KKLVLVVDLDQTVIH
Sbjct: 121 CGKEVDEYDQVDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVDLDQTVIH 180

Query: 178 CGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRLPERKCWYFVKVRPGL 237
           CGVDPTIGEWK DPSNPNYETLKDV+ FSLEEEPI+P +YMGP+ P R CWY+VK+RPGL
Sbjct: 181 CGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTCWYYVKIRPGL 240

Query: 238 REFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQKSLERLF 297
           +EFF ++APLYEMHIYTMATR YALEIAKIIDPD SLFGDRILSRDENGSLTQKSL RLF
Sbjct: 241 KEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTQKSLTRLF 300

Query: 298 PTDQSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQLGRRTHKK 357
           PTDQSMV+VIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP+QQ+ +LQLGRRT +K
Sbjct: 301 PTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQLGRRTRQK 360

Query: 358 PQESDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEPVQGESKEQLTKKLEYSA 417
            +ES+ELLTDIMDTEK+LQEKIDEEVKRQEEKL+HQ+ T +E    ESKE++ KKLE+SA
Sbjct: 361 IKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATAEESTDQESKEKIAKKLEFSA 420

Query: 418 SLEVQQQNRPLATLQKHMHNQRXXXXXXXXXXXXXXXXAKIHRKYYKLL-DEGNENSADI 476
           SLEVQQQNRPLA LQKH+H+QR                A IH+++Y LL D  ++N ADI
Sbjct: 421 SLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKEFYHLLEDASDQNEADI 480

Query: 477 QSLVPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHVITKT 536
             L+P +K +VFK+C+FVFSGLIPLGT+I+RADIV+WT +FGA ++S+IDE+TTHV+TKT
Sbjct: 481 TMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDIDEHTTHVVTKT 540

Query: 537 PGTYKARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEIQDFKRKIE 596
           PGTYKAR+AK FN ++KVVHPDW+FECL +W  +DEKPY LI++ P +E+E+ +FK+K+E
Sbjct: 541 PGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVEQPVSEDELIEFKKKLE 600

Query: 597 QRHLIEEQRREQFESEALMKTAQ-DSTLNLFAGGTSWLN 634
           Q+    E+   + E E   +  Q + T+ LF G TSWLN
Sbjct: 601 QKKKKLEELEIEEEEELNERANQMEPTMPLFGGDTSWLN 639

>NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}
           Anc_8.839 YMR277W
          Length = 725

 Score =  897 bits (2317), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/640 (65%), Positives = 514/640 (80%), Gaps = 10/640 (1%)

Query: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDENDGNGGAQH 60
           M+T ++AP  LPYPITIDQLI  +G  V+KG RL AYKFW++V++ASSPD+ND +     
Sbjct: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFVVDVASSPDDNDVSSPPTA 60

Query: 61  SKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTMCGK 120
            KK++RESIEFFESP++G L+SW VD GDE+AS  QV+ EI+RPCNHDVVYGGLCT+CG+
Sbjct: 61  GKKSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTLCGE 120

Query: 121 EVDENDQ----MEANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDLDQTVI 176
           EVDE+D       ANL ISHTDTNLK+S +EA D+   ++ RLR+ KKLVLVVDLDQTVI
Sbjct: 121 EVDEDDNDASGSGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDLDQTVI 180

Query: 177 HCGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRLPERKCWYFVKVRPG 236
           HCGVDPTIGEWK DP NPN+ETLKDV+ FSLEEEPI+P +YMGP+ P RKCWY+VKVRPG
Sbjct: 181 HCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPKPPLRKCWYYVKVRPG 240

Query: 237 LREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQKSLERL 296
           L+EF  ++APL+EMHIYTMATR YA EIAKIIDP+G LFGDRILSRDENGS+T KSLERL
Sbjct: 241 LKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMTTKSLERL 300

Query: 297 FPTDQSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQLGRRTHK 356
           FPTDQSMVIVIDDRGDVWNW PNLIKVVPYNFFVGVGDINSNFLP+QQ+ +LQLGRR+ +
Sbjct: 301 FPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQLGRRSRE 360

Query: 357 KPQESDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEP--VQGESKEQLTKKLE 414
           K +++++LL DIMD+EK+L+EKID+EVKRQEE+LSHQ  T +EP    GE+KE+++KK+E
Sbjct: 361 KSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTEEPPTSAGENKEEISKKIE 420

Query: 415 YSASLEVQQQNRPLATLQKHMHNQRXXXXXXXXXXXXXXXXAKIHRKYYKLLDEGNENSA 474
           YSASLEVQQQNRPLA LQKH H+QR                 +IH KYY +L +  E  A
Sbjct: 421 YSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVRIHDKYYNVLKKDGELKA 480

Query: 475 DIQSLVPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHVIT 534
           DI+ ++P MK  V  +C FVFSGLIPLGT+I+RADIV+WT  FGAI++S+IDE TTHVIT
Sbjct: 481 DIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDEKTTHVIT 540

Query: 535 KTPGTYKARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEIQDFKRK 594
           KTPGTYKAR+AK FN  +K++HPDWVFECL +W HVDEKPYELI++ P +E E+++FK+K
Sbjct: 541 KTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELIVEQPVSETELEEFKKK 600

Query: 595 IEQRHLIEEQRREQFESEALMKTAQDSTLNLFAGGTSWLN 634
           + +R L+        E+ +       + L LF+GG SWL+
Sbjct: 601 LAKRQLLATAN----ENLSPANGTNSAELELFSGGMSWLD 636

>TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.839
           YMR277W
          Length = 768

 Score =  894 bits (2309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/675 (64%), Positives = 522/675 (77%), Gaps = 41/675 (6%)

Query: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDEND------- 53
           M+TPV++P  LP+PITIDQLI PIGS V+KGQRLFAYKFWYMVEIA SPD ND       
Sbjct: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTSENSS 60

Query: 54  ---GNGG--------AQHSKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIM 102
              GN          A H KK++RESIEFFESPFEGDL+ W VD+GDE+ S  Q++C+I 
Sbjct: 61  DLSGNNSDSNENGNNASHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120

Query: 103 RPCNHDVVYGGLCTMCGKEVDENDQMEANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQS 162
           RPCNHD+VY G+CT CGKEVD++D M+A+L+ISHTDTNLK+SRKEA D++     RL++ 
Sbjct: 121 RPCNHDIVYAGICTQCGKEVDDSDIMDASLSISHTDTNLKISRKEARDIDQSSMSRLKKI 180

Query: 163 KKLVLVVDLDQTVIHCGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRL 222
           KKL+LVVDLDQTVIHCGVDPTIGEWK DP NPNYETLKDV+ FSL+EEPI+PP YMGPR 
Sbjct: 181 KKLILVVDLDQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPSYMGPRP 240

Query: 223 PERKCWYFVKVRPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSR 282
           P RKCWY+VKVRPGL+EFFA++APLYEMHIYTMATR YALEIAKIIDPDGSLFG RILSR
Sbjct: 241 PVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFGSRILSR 300

Query: 283 DENGSLTQKSLERLFPTDQSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPR 342
           DENGSLTQKSLERLFPTDQSMVI+IDDRGDVWNWC NLIKV+PYNFFVG+GDINSNFLPR
Sbjct: 301 DENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDINSNFLPR 360

Query: 343 QQSGLLQLGRRTHKKPQ----------------------ESDELLTDIMDTEKRLQEKID 380
           QQS +LQLG R+HKK                        +++ELLTDIMDTEK+LQ+KID
Sbjct: 361 QQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEKKLQKKID 420

Query: 381 EEVKRQEEKLSHQLTTNDEPVQGESK-EQLTKKLEYSASLEVQQQNRPLATLQKHMHNQR 439
           EEV+RQE+KL        + +  ES   +L+KK+E+SASLEVQQQNRPLATLQ+H  NQR
Sbjct: 421 EEVRRQEKKLIKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLATLQRHRQNQR 480

Query: 440 XXXXXXXXXXXXXXXXAKIHRKYYKLLDEGNENSADIQSLVPTMKGQVFKDCYFVFSGLI 499
                            ++H  +Y+ LDE    S  IQ+L+P +K  VF    FVFSGLI
Sbjct: 481 LLIDDDDELFYLKDILTEVHDTFYEQLDEDKNESVSIQTLMPRLKFSVFSGYNFVFSGLI 540

Query: 500 PLGTNIRRADIVLWTGMFGAITSSEIDENTTHVITKTPGTYKARIAKGFNENVKVVHPDW 559
           PLGT+IRRADIVLWT MFGA ++++IDENTTHVITKT GTYKAR+AK FN  +KVVHPDW
Sbjct: 541 PLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNPEIKVVHPDW 600

Query: 560 VFECLVTWTHVDEKPYELIIQDPATEEEIQDFKRKIEQRHLIEEQRREQFESEALMKTAQ 619
           +FECLV+W  + EKPYELII+ PA+EEE+++FK+K+E ++ + E+R  + E++      +
Sbjct: 601 IFECLVSWKRMPEKPYELIIEQPASEEELEEFKKKLELKNELLEKREMETEAQFEALNTR 660

Query: 620 DSTLNLFAGGTSWLN 634
           D  ++LFA GTSWLN
Sbjct: 661 DPAIDLFASGTSWLN 675

>Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON}
           complement(15966..18203) [2238 nt, 746 aa]
          Length = 745

 Score =  893 bits (2308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/639 (66%), Positives = 510/639 (79%), Gaps = 8/639 (1%)

Query: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDENDGNGGAQH 60
           M+TPV AP  LPYPITI +LIA IGS V+KGQRLFAYKFWY+VEIA SPDEND     +H
Sbjct: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDENDDGVNDEH 60

Query: 61  SKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTMCGK 120
           SKK++RESIEFF+SPFEGDLVSW VD GDE+    Q ICEI+RPCNHD+VY G+CTMCGK
Sbjct: 61  SKKSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTMCGK 120

Query: 121 EVDENDQMEANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDLDQTVIHCGV 180
           EVDE+DQ+ ANL ISHTDTNLKVSR+EA D+   +K+RL + KKL+LVVDLDQTVIHCGV
Sbjct: 121 EVDESDQVSANLTISHTDTNLKVSRREANDIGQGIKKRLIREKKLILVVDLDQTVIHCGV 180

Query: 181 DPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRLPERKCWYFVKVRPGLREF 240
           DPTI EWK DP+NPN+ETL+DV+ F LEEEPI+PPMYMGP+ P  KCWY+VK+RPGL+EF
Sbjct: 181 DPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPKPPTHKCWYYVKIRPGLKEF 240

Query: 241 FAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQKSLERLFPTD 300
           F +++ LYEMHIYTMATR+YA EIAKIIDPDG+LF DRILSR+ENGSLT KSLERLFPTD
Sbjct: 241 FEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTHKSLERLFPTD 300

Query: 301 QSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQLGRRTHKKPQE 360
           QSMV+VIDDRGDVWNWCPNLIKV PYNFFVG+GDINSNFLPRQQ+ +LQLGRR HKK ++
Sbjct: 301 QSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQLGRRNHKKTED 360

Query: 361 SDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEPVQGE-SKEQLTKKLEYSASL 419
           +DELLTDIMDTEK+LQEKIDEEVKRQEE LSHQ     E +  +  KE +TKK+E+SASL
Sbjct: 361 TDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGEEISSQVRKEDITKKIEFSASL 420

Query: 420 EVQQQNRPLATLQKHMHNQRXXXXXXXXXXXXXXXXAKIHRKYYKLLDEGNENSADIQSL 479
           EVQQQNRPLA LQKHMHNQ+                  + +KYY+ L    E    IQ+L
Sbjct: 421 EVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQKYYEELKTDKE--IQIQTL 478

Query: 480 VPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHVITKTPGT 539
           +P +K +V + C FVFSGLIPLGTNI++ADIVLWT MFGA +S++I E+TTHVITKTP T
Sbjct: 479 MPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSADITEDTTHVITKTPHT 538

Query: 540 YKARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEIQDFKRKIEQRH 599
           YKA+IAK F  ++KV+HPDWVFECL+ W ++ E PYE  I   AT++E+ +FK  +E+R 
Sbjct: 539 YKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNIIPTATDKELNEFKEALERRK 598

Query: 600 LIEEQ-----RREQFESEALMKTAQDSTLNLFAGGTSWL 633
             E +       E  E ++   ++Q ++++LFA G SWL
Sbjct: 599 KKETKTKITVSEESLEGDSNSPSSQGASVDLFASGASWL 637

>TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839
           YMR277W
          Length = 732

 Score =  867 bits (2239), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/645 (65%), Positives = 504/645 (78%), Gaps = 12/645 (1%)

Query: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDENDGNGGAQ- 59
           MATPV  P+ +PYPITI +LIAP+GS + KG RLFAYKFWY+VEIA SPDE D NG  Q 
Sbjct: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60

Query: 60  --HSKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTM 117
              SKKT+RESI+FF++PFEG ++ W VD GDE+    +++CE+ RPC+HD+VY G+CTM
Sbjct: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120

Query: 118 CGKEVDENDQMEANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDLDQTVIH 177
           CGKEVDE DQ+ ANL ISHTDTNLKVSR+EA ++    K RL +SKKL+LVVDLDQTVIH
Sbjct: 121 CGKEVDERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDLDQTVIH 180

Query: 178 CGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRLPERKCWYFVKVRPGL 237
           CGVDPTI EWK DPSNPNYETL++V+ F LEEE I+PPMYMGP+ P  KC Y+VKVRPGL
Sbjct: 181 CGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYVKVRPGL 240

Query: 238 REFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQKSLERLF 297
           +EFF ++AP+YEMHIYTMATR YA EIAKIIDPDGSLFG+RILSRDENGSLT KSLERLF
Sbjct: 241 KEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHKSLERLF 300

Query: 298 PTDQSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQLGRRTHKK 357
           PTDQSMV++IDDRGDVWNW PNLIKV PYNFFVG+GDINSNFLPRQQ+ +LQ+GRR H  
Sbjct: 301 PTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMGRRNHNA 360

Query: 358 --PQESDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQ-LTTNDEPVQGESKEQLTKKLE 414
              +ES+ELLTDI+DTEK+LQEKID+EVKRQE  L+H+     +E V       +TKK+E
Sbjct: 361 EKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRNGDITKKIE 420

Query: 415 YSASLEVQQQNRPLATLQKHMHNQRXXXXXXXXXXXXXXXXAKIHRKYYKLLDEGNENSA 474
           +SASLEVQQQNRPLA LQKHMHNQ+                A +  ++YK L+  N NS 
Sbjct: 421 FSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKALELKNGNSD 480

Query: 475 D--IQSLVPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHV 532
           D  IQ L+P +K  VFKDC FVFSGLIPLGT+I++ADIVLWT MFGA ++S I ENTTHV
Sbjct: 481 DTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTTHV 540

Query: 533 ITKTPGTYKARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEIQDFK 592
           ITKTPGT KARIAK FN ++KVVHPDWVFECL TW HVDEK +EL +   A+E E+++FK
Sbjct: 541 ITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVASERELEEFK 600

Query: 593 RKIEQRHLIEEQRREQFESEALMKTA----QDSTLNLFAGGTSWL 633
           + +E+R+  +      F  +    TA     D+ ++LFAGG+SWL
Sbjct: 601 KNLEKRNKNKLTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWL 645

>NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON}
           Anc_8.839 YMR277W
          Length = 778

 Score =  864 bits (2233), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/691 (61%), Positives = 521/691 (75%), Gaps = 58/691 (8%)

Query: 1   MATPVI--APESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDE------- 51
           MATP +  AP  LPYPITID+L+ PIG+ + K  RL AYKFWY+VEIA+SPDE       
Sbjct: 1   MATPTVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIATSPDELEDDNDN 60

Query: 52  ------------NDGNGG-----------------------AQHSKKTVRESIEFFESPF 76
                       N  NG                         +  KKTVRESIEFF+ P+
Sbjct: 61  DNDNDPDGDVDKNTINGNNVTNLTNRPSIEPISRNTITHAHKKKKKKTVRESIEFFDCPY 120

Query: 77  EGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTMCGKEVDENDQME---ANLA 133
           +G L SW V++GD++    Q +CEI RPCNHDV+YGGLCT+CGKEVDEND  +    NL 
Sbjct: 121 DGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDIDDLSGPNLT 180

Query: 134 ISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDLDQTVIHCGVDPTIGEWKKDPSN 193
           ISHTDTNLK+S +EA D+   +K+RLR  KKL+LVVDLDQTVIHCGVDPTIGEWK+DP+N
Sbjct: 181 ISHTDTNLKISTREAVDIGQSVKKRLRDDKKLILVVDLDQTVIHCGVDPTIGEWKRDPTN 240

Query: 194 PNYETLKDVQMFSLEEEPIVPPMYMGPRLPERKCWYFVKVRPGLREFFAQLAPLYEMHIY 253
           PN+ETLKDV+ F+LEEEPI+P MYMGP+ P RKCWY+VKVRPGL++FF ++APL+EMHIY
Sbjct: 241 PNFETLKDVKEFALEEEPILPLMYMGPKPPARKCWYYVKVRPGLKDFFQKVAPLFEMHIY 300

Query: 254 TMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQKSLERLFPTDQSMVIVIDDRGDV 313
           TMATR YA EIAKIIDP G LFG+RILSRDENGSLT KSLERLFPTDQSMVI+IDDRGDV
Sbjct: 301 TMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVIIIDDRGDV 360

Query: 314 WNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQLGRRTHK-----KPQESDELLTDI 368
           WNW PNLIKV+PYNFFVGVGDINSNFLP+QQ+ +LQLGRR+ +       +E+D+LLTDI
Sbjct: 361 WNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTKENDDLLTDI 420

Query: 369 MDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEP--VQGESKEQLTKKLEYSASLEVQQQNR 426
           MDTEK LQ KI+EEVKRQEEKL+HQL T +EP    GE+KE+++KK+EYSASLEVQQ+NR
Sbjct: 421 MDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIEYSASLEVQQKNR 480

Query: 427 PLATLQKHMHNQRXXXXXXXXXXXXXXXXAKIHRKYYKLLDEGNENS----ADIQSLVPT 482
           PLATLQKH H+QR                +KIH KYY++L + NEN      DI+ ++P 
Sbjct: 481 PLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIEPDIKYIMPQ 540

Query: 483 MKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHVITKTPGTYKA 542
           MK  V +DC+FVFSGLIPLGTNI+++DIV+WT MFGA ++++IDENTTHVITKTPGTYKA
Sbjct: 541 MKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVITKTPGTYKA 600

Query: 543 RIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEIQDFKRKIEQRHLIE 602
           R+AK ++ ++K+VHPDWVFECL+ W HV+EKPYEL+++   +++E+ DF RK+E+R  + 
Sbjct: 601 RLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELADFNRKLERRIQLS 660

Query: 603 EQRREQFESEALMKTAQDSTLNLFAGGTSWL 633
           E + E   ++        + +NLFAGGTSWL
Sbjct: 661 ELKDEGLYNKLPDGNIDINEVNLFAGGTSWL 691

>YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}
           FCP1Carboxy-terminal domain (CTD) phosphatase, essential
           for dephosphorylation of the repeated C-terminal domain
           of the RNA polymerase II large subunit (Rpo21p)
          Length = 732

 Score =  843 bits (2177), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/653 (62%), Positives = 501/653 (76%), Gaps = 27/653 (4%)

Query: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIAS-----------SP 49
           M T + +P+ LPYPI ID+LI  +GS + +G RL  YKFWY+VE AS           SP
Sbjct: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSP 60

Query: 50  DENDGNGGAQHSKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDV 109
             + G+ G     K +RESIEFFESP+EGDL+SW VD GDEVA+A QVICEI RPCNHD+
Sbjct: 61  GGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120

Query: 110 VYGGLCTMCGKEV--DENDQMEANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVL 167
           VYGGLCT CGKEV  D  D +  ++     D +L++S  EA      LK+ LR+ KKL+L
Sbjct: 121 VYGGLCTQCGKEVSADAFDGVPLDVV---GDVDLQISETEAIRTGKALKEHLRRDKKLIL 177

Query: 168 VVDLDQTVIHCGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYM---GPRL-- 222
           VVDLDQT+IHCGVDPTI EWK DP+NPN+ETL+DV+ F+L+EE ++P MYM   G  L  
Sbjct: 178 VVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGSMLRP 237

Query: 223 -PERKCWYFVKVRPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILS 281
            P RKCWY+VKVRPGL+EFFA++APL+EMHIYTMATR YAL+IAKI+DP G LFGDRILS
Sbjct: 238 PPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILS 297

Query: 282 RDENGSLTQKSLERLFPTDQSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP 341
           RDENGSLT KSL +LFPTDQSMV+VIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP
Sbjct: 298 RDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP 357

Query: 342 RQQSGLLQLGRRTHKKPQESDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEPV 401
           +Q +G+LQLGR+T +K QES ELLTDIMD EK+LQEKID+EVKRQEEKL+HQL T +EP 
Sbjct: 358 KQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPP 417

Query: 402 QGESKEQLTKKLEYSASLEVQQQNRPLATLQKHMHNQRXXXXXXXXXXXXXXXXAKIHRK 461
             ESKE+LTKKLEYSASLEVQQQNRPLA LQKH+H+Q+                + IH+ 
Sbjct: 418 ANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSNIHKT 477

Query: 462 YYKLLDEGNENSADIQSLVPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAIT 521
           YY +L + NE   ++  ++P++K +VF++CYFVFSGLIPLGT+I+R+DIV+WT  FGA +
Sbjct: 478 YYDMLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATS 537

Query: 522 SSEIDENTTHVITKTPGTYKARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQD 581
           + +ID  TTH+ITK P TYKAR+AK FN  +K+VHPDW+FECLV W  VDEKPY LI+  
Sbjct: 538 TPDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYTLIVDS 597

Query: 582 PATEEEIQDFKRKIEQRHLIEEQRREQFESEALMKTAQDSTLNLFAGGTSWLN 634
           P ++EE+Q+F+ ++++R    E+ +EQ      M T+Q++ LNLFA GTSWLN
Sbjct: 598 PISDEELQNFQTQLQKRQEYLEETQEQ----QHMLTSQEN-LNLFAAGTSWLN 645

>Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  839 bits (2168), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/652 (62%), Positives = 500/652 (76%), Gaps = 27/652 (4%)

Query: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIAS-----------SP 49
           M T + +PE LPYPI ID+LI  +GS + +G RL  YKFWY+VE AS           SP
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASETGVDDNEHDASP 60

Query: 50  DENDGNGGAQHSKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDV 109
               G+ G     K +RESIEFFESP+EGDL+SW VD GDEVA+A QVICEI RPCNHD+
Sbjct: 61  GGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120

Query: 110 VYGGLCTMCGKEV--DENDQMEANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVL 167
           VYGGLCT CGKEV  D  D +  ++     D +L++S  EA      LK+ LR+ KKL+L
Sbjct: 121 VYGGLCTQCGKEVSADAFDGVPLDVV---GDMDLQISETEAIRTGKALKEHLRRDKKLIL 177

Query: 168 VVDLDQTVIHCGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYM---GPRL-- 222
           VVDLDQT+IHCGVDPTI EWK DP+NPN+ETL+DV+ F+L+EE ++P MYM   G  L  
Sbjct: 178 VVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLRP 237

Query: 223 -PERKCWYFVKVRPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILS 281
            P RKCWY+VKVRPGL+EFFA++APL+EMHIYTMATR YAL+IAKI+DP G LFGDRILS
Sbjct: 238 PPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGDRILS 297

Query: 282 RDENGSLTQKSLERLFPTDQSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP 341
           RDENGSLT KSL +LFPTDQSMV+VIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP
Sbjct: 298 RDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP 357

Query: 342 RQQSGLLQLGRRTHKKPQESDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEPV 401
           +Q +G+LQLGR+T +K QES ELLTDIMD EK+LQEKID+EVKRQEEKL+HQL T +EP 
Sbjct: 358 KQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPP 417

Query: 402 QGESKEQLTKKLEYSASLEVQQQNRPLATLQKHMHNQRXXXXXXXXXXXXXXXXAKIHRK 461
             ESKE+LTKKLEYSASLEVQQQNRPLA LQKH+H+Q+                + IH  
Sbjct: 418 ANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSNIHMT 477

Query: 462 YYKLLDEGNENSADIQSLVPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAIT 521
           YY++L + NE   ++  ++P++K +VF++C+FVFSGLIPLGT+I+R+DIV+WT  FGA +
Sbjct: 478 YYQMLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTSTFGATS 537

Query: 522 SSEIDENTTHVITKTPGTYKARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQD 581
           +S+ID  TTH+ITK P TYKAR+AK FN  +K+VHPDW+FECLV W  VDEKPY LI+  
Sbjct: 538 TSDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPYTLIVDS 597

Query: 582 PATEEEIQDFKRKIEQRHLIEEQRREQFESEALMKTAQDSTLNLFAGGTSWL 633
           P ++EE+Q+F+ ++++R    E+ +EQ      M T+Q++ LNLFA GTSWL
Sbjct: 598 PISDEELQNFQSQLQKRQEYLEENQEQ----QHMLTSQEN-LNLFATGTSWL 644

>Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277W
           (REAL)
          Length = 734

 Score =  831 bits (2147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/655 (61%), Positives = 501/655 (76%), Gaps = 30/655 (4%)

Query: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDENDGN----- 55
           M T + +PE LPYPI ID+L+  +GS + +G RL  YKFWY+VE AS    +D N     
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASDTTGDDDNEHDAT 60

Query: 56  -------GGAQHSKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHD 108
                  G      K +RESIEFFESP+EGDL+SW VD GDE+A+A QVICEI RPCNHD
Sbjct: 61  PGGGAGSGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHD 120

Query: 109 VVYGGLCTMCGKEV--DENDQMEANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLV 166
           +VYGGLCT CGKEV  D  D +  ++     D +L++S  EA      LK+ LR+ KKL+
Sbjct: 121 IVYGGLCTQCGKEVSADAFDGVPLDVV---GDMDLQISETEAIRSGEALKEHLRRDKKLI 177

Query: 167 LVVDLDQTVIHCGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYM---GPRL- 222
           LVVDLDQT+IHCGVDPTI EWK DP+NPN+ETL+DV+ F+L+EE ++P MYM   G  L 
Sbjct: 178 LVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLK 237

Query: 223 --PERKCWYFVKVRPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRIL 280
             P RKCWY+VKVRPGL+EFF ++APL+EMHIYTMATR YA++IAKI+DP G LFGDRIL
Sbjct: 238 PPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGDRIL 297

Query: 281 SRDENGSLTQKSLERLFPTDQSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFL 340
           SRDENGSLT KSL +LFPTDQSMV+VIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFL
Sbjct: 298 SRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFL 357

Query: 341 PRQQSGLLQLGRRTHKKPQESDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEP 400
           P+Q +G+LQLGR+T +K QES ELLTDIMD EK+LQEKID+EVKRQEEKL+HQL T +EP
Sbjct: 358 PKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEP 417

Query: 401 VQGESKEQLTKKLEYSASLEVQQQNRPLATLQKHMHNQRXXXXXXXXXXXXXXXXAKIHR 460
              ESKE+LTKKLEYSASLEVQQQNRPLA LQKH+H+Q+                + IH 
Sbjct: 418 SANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSNIHN 477

Query: 461 KYYKLLDEGNENSADIQSLVPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAI 520
            YY+++ + NE   ++  ++P++K +VF++C+FVFSGLIPLGT+I+R+DIV+WT  FGA 
Sbjct: 478 TYYQMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTSTFGAT 537

Query: 521 TSSEIDENTTHVITKTPGTYKARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQ 580
           ++S+ID  TTH+ITK P TYKAR+AK FN  +K++HPDW+FECLV W  VDEKPY LI+ 
Sbjct: 538 STSDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPYTLIVD 597

Query: 581 DPATEEEIQDFKRKIEQRH-LIEEQRREQFESEALMKTAQDSTLNLFAGGTSWLN 634
            P ++EE+Q+F++++++R   +EE +++Q      M T Q++ LNLFA GTSWLN
Sbjct: 598 SPISDEELQNFQKQLQKRQEYLEENQQQQH-----MLTPQEN-LNLFAAGTSWLN 646

>Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  821 bits (2120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/652 (60%), Positives = 498/652 (76%), Gaps = 26/652 (3%)

Query: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDENDGNGGAQH 60
           M T + +PE LPYPI ID+LI  +GS +++G RL  YKFWY+VE  S   ++D +  +  
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERPSDAGDDDNDHDSSP 60

Query: 61  SK----------KTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVV 110
                       K +RESIEFFESP+EGDL+SW VD GDE+A+A QVICEI RPCNHD+V
Sbjct: 61  GGGGGGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIV 120

Query: 111 YGGLCTMCGKEV--DENDQMEANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLV 168
           YGGLCT CGKEV  D  D +  ++     D +L++S  EA      LK+ LR+ KKL+LV
Sbjct: 121 YGGLCTQCGKEVSADAFDGVPLDVV---GDMDLQISETEAIRTGRALKEHLRRDKKLILV 177

Query: 169 VDLDQTVIHCGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMG-----PRLP 223
           VDLDQT+IHCGVDPTI EWK DP+NPN+ETL+DV+ F+L+EE ++P MYM      P+ P
Sbjct: 178 VDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVPKPP 237

Query: 224 E-RKCWYFVKVRPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSR 282
             RKCWY+VKVRPGL+EFFA++APL+EMHIYTMATR YAL+IAKI+DP G LFGDRILSR
Sbjct: 238 PVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSR 297

Query: 283 DENGSLTQKSLERLFPTDQSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPR 342
           DENGSLT KSL +LFPTDQSMV+VIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP+
Sbjct: 298 DENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPK 357

Query: 343 QQSGLLQLGRRTHKKPQESDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEPVQ 402
           Q +G+LQLGR+T +K QES EL+TDIMD EK+LQEKID EVKRQEE+L+HQL T +EP  
Sbjct: 358 QSTGMLQLGRKTRQKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLATAEEPSA 417

Query: 403 GESKEQLTKKLEYSASLEVQQQNRPLATLQKHMHNQRXXXXXXXXXXXXXXXXAKIHRKY 462
            ESKE+LTKKLEYSASLEVQQQNRPLA LQKH+H+Q+                  IH+ Y
Sbjct: 418 NESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELHYLMSTLLNIHKTY 477

Query: 463 YKLLDEGNENSADIQSLVPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITS 522
           Y++L +  E   ++  ++P++K +VF++CYFVFSGLIPLGT+I+R+DIV+WT  FGA ++
Sbjct: 478 YQMLSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATST 537

Query: 523 SEIDENTTHVITKTPGTYKARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDP 582
           S+I+  TTH+ITK PGTYKAR+AK FN  +KVVHPDW+FECLV W  VDEKPY LI+  P
Sbjct: 538 SDINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTLIVDSP 597

Query: 583 ATEEEIQDFKRKIEQRHLIEEQRREQFESEALMKTAQDSTLNLFAGGTSWLN 634
            +++E+Q F+++++++   +E   E  E + ++   ++  +NLFA GTSWLN
Sbjct: 598 ISDDELQSFQKQLQKK---QEYLDEHHEQQHMLMPQEN--INLFAAGTSWLN 644

>KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON}
           Anc_8.839 YMR277W
          Length = 742

 Score =  808 bits (2086), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/658 (60%), Positives = 501/658 (76%), Gaps = 30/658 (4%)

Query: 3   TPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIAS--SPDENDGNGGAQH 60
           TPV++   LPYP+T+D+LI  +G  V +G RLFAYKFWY+VE+A   +  E D +G    
Sbjct: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGVDAAAEGDSDGTGTT 66

Query: 61  SKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTMCGK 120
           +KK+VRES+EFFESPFEG +VSW+VD GDE+      +C + RPCNHDVVY GLCT+CG+
Sbjct: 67  AKKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGLCTLCGR 126

Query: 121 EVDE---------NDQMEANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDL 171
           EVDE         +  +  NL +SH DTNL++SR EA+ ++  L+QRLR ++KLVLVVDL
Sbjct: 127 EVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEAQQLDLQLQQRLRAAQKLVLVVDL 186

Query: 172 DQTVIHCGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRLPE-RKCWYF 230
           DQTV+HCGVDPTIGEWK+DP NPNYE L+DVQ F+LEEEPI+P +Y+G + P  RKCWY+
Sbjct: 187 DQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGKRPAPRKCWYY 246

Query: 231 VKVRPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQ 290
           VKVRPGL++FF +LAPL+EMHIYTMATR YALEIAKIIDPD SLFGDRILSRDENGSLT 
Sbjct: 247 VKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTH 306

Query: 291 KSLERLFPTDQSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQL 350
           KSLERLFPTDQSMV VIDDRGDVWNWC NLIKVVPYNFFVGVGDINSNFLP+QQ  +LQ+
Sbjct: 307 KSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQPTMLQM 366

Query: 351 GRRT------HKKPQESDE-----LLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDE 399
           GRR+      H+  Q+ D+     LLTDIM+TEK+LQEKID+EVKRQE KL+      DE
Sbjct: 367 GRRSKLNERGHESKQQQDDVKDDLLLTDIMNTEKQLQEKIDQEVKRQEHKLNKGNAAGDE 426

Query: 400 -PVQGESKEQLTKKLEYSASLEVQQQNRPLATLQKHMHNQRXXXXXXXXXXXXXXXXAKI 458
               G+SKE+ TKKLE+SAS+EVQQ+NRPLATLQKH+HNQ+                A +
Sbjct: 427 QQTPGQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDNDDELFYLKDRLADL 486

Query: 459 HRKYYKLLDEGNENSADIQSLVPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFG 518
           H++YY  L E N    +IQS++  +K +VF+DC+FVFSGLIPL TN++ ADIV+WT  FG
Sbjct: 487 HKRYYSTLKE-NPQDTNIQSIMTQLKTRVFQDCHFVFSGLIPLNTNVQAADIVIWTNKFG 545

Query: 519 AITSSEIDENTTHVITKTPGTYKARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELI 578
           A T++++DE TTH+ITKTPGT KAR+AK FN ++K+VHPDW+FECL+ W  VD KPY LI
Sbjct: 546 ATTTNDLDETTTHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDVKPYLLI 605

Query: 579 IQDPATEEEIQDFKRKIEQRHLIEEQRREQFESEALMKTAQ--DSTLNLFAGGTSWLN 634
           ++DP +E ++++FK K+ ++   +E+   Q    AL+   +  +  ++LFAGG SWLN
Sbjct: 606 VEDPVSEAQVREFKEKLTRQ---KERAERQTSRTALLPANKPAEPDIDLFAGGISWLN 660

>SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 688

 Score =  794 bits (2050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/640 (59%), Positives = 479/640 (74%), Gaps = 21/640 (3%)

Query: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDENDGNGGAQH 60
           M T +  P++LPYPITI QL A  G  +KKGQRLFAYK+W   ++ +SP     N  +  
Sbjct: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSP-----NDTSTK 55

Query: 61  SKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTMCGK 120
            KK   + I  F+SP EG LVS+ +  GDE  ++  V+ EI + C HDV YGGLC +CGK
Sbjct: 56  PKKQRVDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVICGK 115

Query: 121 EVDE------NDQMEANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDLDQT 174
            V+E      +D  +  L +SHT+TN+K+S ++A  +E   +++LR+ KKLVLVVDLDQT
Sbjct: 116 SVEEYSSNSASDPSQNKLTMSHTNTNIKISERQAAAIEETAQKQLRKLKKLVLVVDLDQT 175

Query: 175 VIHCGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRLPERKCWYFVKVR 234
           VIHCGVDPTIGEW +DP NPNYE LKD++ F+L EEPI+PP YMGP+ P RKCWY+VK+R
Sbjct: 176 VIHCGVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPKPPARKCWYYVKLR 235

Query: 235 PGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQKSLE 294
           PGL+EFF ++AP +E+HIYTMATR YALEIAKIIDPDG LFGDRILSRDENGS+T KSLE
Sbjct: 236 PGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSITHKSLE 295

Query: 295 RLFPTDQSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQLGRRT 354
           RLFP DQSMV++IDDRGDVWNWC NLIKVVPY+FFVGVGDINSNFLPRQQ+ +L LGRR 
Sbjct: 296 RLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLHLGRR- 354

Query: 355 HKKPQESDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEPVQGESKEQLTKKLE 414
           H+K  E +ELLTDI+DTEK+LQEKIDEEVKRQEEKLS ++T   +P    SKE L KKLE
Sbjct: 355 HRKKAEEEELLTDILDTEKKLQEKIDEEVKRQEEKLS-KMTEEKQPEDTNSKEDLAKKLE 413

Query: 415 YSASLEVQQQNRPLATLQKHMHNQRXXXXXXXXXXXXXXXXAKIHRKYYKLLDEGNENSA 474
           +SASLEVQQQNRPLA LQKH+HNQ+                 ++H KYY+ L + + +  
Sbjct: 414 HSASLEVQQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQVHGKYYEDLSK-HSSPP 472

Query: 475 DIQSLVPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHVIT 534
           +I++L+P +K +VF  C FVFSGLIPLGT++R+ADI LWT MFGA T+++IDE TTH+IT
Sbjct: 473 NIKNLMPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTADIDEATTHIIT 532

Query: 535 KTPGTYKARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEIQDFKRK 594
           KTPGT+KAR+AK FN  +KVVHPDW+FECLV W  VDEK YEL+I+ P +EEE+ DFK+K
Sbjct: 533 KTPGTFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELLIEQPVSEEELDDFKKK 592

Query: 595 IEQRHLIEEQRREQFESEALMKTAQDSTLNLFAGGTSWLN 634
           +E      E++  Q + E  +       +NL AG  SWL+
Sbjct: 593 LEN-----EKKDAQIQEE--VDRVSSDEINLLAGNDSWLD 625

>Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {ON}
           YMR277W (FCP1) - TFIIF interacting component of CTD
           phosphatase [contig 37] FULL
          Length = 743

 Score =  780 bits (2013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/642 (58%), Positives = 477/642 (74%), Gaps = 24/642 (3%)

Query: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDENDGNGGAQH 60
           M TP+  P +LP+PITI +L    G +V KGQRLF YK+W + ++ ++P+E       + 
Sbjct: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVITAPNE-------EA 53

Query: 61  SKKTVR-ESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTMCG 119
           SKK  R + I  F+SP EG LVS +V  GDE  +   +I E+ +PC+H+V YG LC +CG
Sbjct: 54  SKKKRRVDLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCVVCG 113

Query: 120 KEVDENDQ-------MEANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDLD 172
           K VDE+D            L ++H +TN+KVS ++A  +E   ++ LR+ KKLVLVVDLD
Sbjct: 114 KAVDEDDSNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVVDLD 173

Query: 173 QTVIHCGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRLPERKCWYFVK 232
           QTVIHCGVDPTI EW  DPSNPNY+ LK+V+ FSL+E+PI+PP YMGPR P R+C Y+VK
Sbjct: 174 QTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGPRPPPRRCQYYVK 233

Query: 233 VRPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQKS 292
           +RPGL+EFF ++AP +E+HIYTMATR YALEIAKIIDP  +LFGDRILSRDENGSLT KS
Sbjct: 234 LRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLTHKS 293

Query: 293 LERLFPTDQSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQLGR 352
           LERLFP DQSMV++IDDRGDVW+WC NLIKVVPYNFFVGVGDINSNFLPRQQ+ +L +GR
Sbjct: 294 LERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHMGR 353

Query: 353 RTHKKPQESDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEPVQGESKEQLTKK 412
           R H+K  E +ELLTDIMDTEK+LQEKID+EVK+QEEK  ++++  ++P +  SKE LTKK
Sbjct: 354 R-HRKKAEEEELLTDIMDTEKKLQEKIDQEVKKQEEKF-NKISEENQPDRSMSKEDLTKK 411

Query: 413 LEYSASLEVQQQNRPLATLQKHMHNQRXXXXXXXXXXXXXXXXAKIHRKYYKLLDEGNEN 472
           LE++ASLEVQQQNRPLA LQKHM+NQ+                  +HR YY+ L +  E 
Sbjct: 412 LEHNASLEVQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLNVHRTYYEELAK-TEV 470

Query: 473 SADIQSLVPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHV 532
             DI+ L+P MK +VF  C+FVFSGLIPLGTNIR ADIVLWT MFGA TSS+IDENTTHV
Sbjct: 471 FPDIKLLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMFGAQTSSDIDENTTHV 530

Query: 533 ITKTPGTYKARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEIQDFK 592
           ITKTPGT+KAR+AK +N ++K+VHPDW+FECLV W   DEKPYELII+   + +E+++F+
Sbjct: 531 ITKTPGTFKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYELIIEQEVSSDELEEFQ 590

Query: 593 RKIEQRHLIEEQRREQFESEALMKTAQDSTLNLFAGGTSWLN 634
           R +++R + E+  RE  + E          LNL AG   WL+
Sbjct: 591 RNLKKRQMAEKAARESLQQET------GEELNLLAGNDMWLD 626

>KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 745

 Score =  769 bits (1985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/636 (58%), Positives = 475/636 (74%), Gaps = 24/636 (3%)

Query: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDENDGNGGAQH 60
           M TP+  P +LP+P+TI +L    G +VKKGQRLF YK+W + +I ++P+E      A  
Sbjct: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIITAPNEE-----APK 55

Query: 61  SKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTMCGK 120
            K+ V + I  F+SP EG LVS  +  GDE  +   VI E+ + C+H+V YGGLC +CGK
Sbjct: 56  KKRRV-DLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCVVCGK 114

Query: 121 EVDENDQ-------MEANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDLDQ 173
            V+E+DQ         + L ++H +TN+KVS ++A  +E   ++ LR+ KKLVLVVDLDQ
Sbjct: 115 TVEEDDQNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVVDLDQ 174

Query: 174 TVIHCGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRLPERKCWYFVKV 233
           TVIHCGVDPTI EW  DPSNPNY+ LK+V+ FSL+E+PI+PP YMGPR P RKC Y+VK+
Sbjct: 175 TVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGPRPPPRKCQYYVKL 234

Query: 234 RPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQKSL 293
           RPGL+EFF ++AP +E+HIYTMATR YALEIAKIIDP G LFGDRILSRDENGSLT KSL
Sbjct: 235 RPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLTHKSL 294

Query: 294 ERLFPTDQSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQLGRR 353
           ERLFP DQSMV++IDDRGDVW+WC NLIKVVPYNFFVGVGDINSNFLPRQQ+ +L LGRR
Sbjct: 295 ERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHLGRR 354

Query: 354 THKKPQESDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEPVQGESKEQLTKKL 413
             KK +E +ELLTDIMDTEK+LQEKID+EVK+QEEK + ++   ++P +  SKE LTKKL
Sbjct: 355 NRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFN-KINEENQPERPISKEDLTKKL 412

Query: 414 EYSASLEVQQQNRPLATLQKHMHNQRXXXXXXXXXXXXXXXXAKIHRKYY-KLLDEGNEN 472
           E++ASLEVQQQNRPLA LQKHM+NQ+                  +H+ YY KL ++G   
Sbjct: 413 EHNASLEVQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILLNVHKTYYDKLAEQG--Q 470

Query: 473 SADIQSLVPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHV 532
             DI++L+P MK QVFK C+FVFSGLIPLGTN+R+ADIVLWT MFGA TS ++DE TTHV
Sbjct: 471 PPDIKTLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMFGATTSVDVDEATTHV 530

Query: 533 ITKTPGTYKARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEIQDFK 592
           ITKTPGT+KAR+AK +N N+KV+HPDW+FECLV W  V+EKPYEL  +   + EE+++FK
Sbjct: 531 ITKTPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQDVSPEELEEFK 590

Query: 593 RKIEQRHLIEEQRREQFESEALMKTAQDSTLNLFAG 628
           ++++++   E+   E  + EA  +      LNL  G
Sbjct: 591 KRLDKKKQSEKALSESIQQEATQE------LNLLTG 620

>Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar to
           Ashbya gossypii ABL127W
          Length = 751

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/649 (56%), Positives = 476/649 (73%), Gaps = 26/649 (4%)

Query: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDENDGNGGAQH 60
           M+TP+  P++LPYPIT+ QL    G  V++GQRLFAYK+W   +I +SP +    G    
Sbjct: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSPGDESAGGK--- 57

Query: 61  SKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTMCGK 120
           SK+   + +  F+SP  G +VS  +  GDE  +++  + EI +PC HDV YGGLC  CG+
Sbjct: 58  SKRQRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQCGQ 117

Query: 121 EVDENDQM-------EANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDLDQ 173
            V E++Q        +A L +SHT+ N+++S K+A  +E   +++LR+++KLVLVVDLDQ
Sbjct: 118 TV-EDEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLVVDLDQ 176

Query: 174 TVIHCGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRLPERKCWYFVKV 233
           TVIHCGVDPTIGEW KDP NPNYE+LKDV+ FSL EEP++PP YMGP+ P RKCWY+VK+
Sbjct: 177 TVIHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGPKPPTRKCWYYVKL 236

Query: 234 RPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQKSL 293
           RPGL++FF+ +AP +E+HIYTMATRTYALEIAKIIDPDG+LFGDRILSRDENGSLTQKSL
Sbjct: 237 RPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGSLTQKSL 296

Query: 294 ERLFPTDQSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQLGRR 353
           ERLFP DQSMV++IDDRGDVWNWC NLIKVVPY+FFVG+GDINSNFLPRQQ+ +L LGRR
Sbjct: 297 ERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSMLHLGRR 356

Query: 354 THKKPQESDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEPVQGESKEQLTKKL 413
             KK ++ +ELLTDI+DTEK+L+ KI EEVKRQEE++  +L+    P    SKE + KKL
Sbjct: 357 NRKKLKQDEELLTDILDTEKKLKVKISEEVKRQEEEM-QKLSEEKIPDHTTSKEDIAKKL 415

Query: 414 EYSASLEVQQQNRPLATLQKHMHNQRXXXXXXXXXXXXXXXXAKIHRKYYKLLDE----G 469
           E++ASLEVQQQNRPLA LQKH+HN+R                 ++H  YY  L++     
Sbjct: 416 EHNASLEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDILLRVHSAYYDQLEKNKHGA 475

Query: 470 NENSADIQSLVPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENT 529
            E S DI+ L+P++K  VFK C FVFSGLIPL TNI RADIVLWT  FGA T+  ID NT
Sbjct: 476 TELSPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKTTINIDYNT 535

Query: 530 THVITKTPGTYKARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEIQ 589
           TH+ITKTPGT KAR+A  FN ++K+VHPDW+FEC+V W  VDEKPYELI+++P ++E ++
Sbjct: 536 THLITKTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEEPVSKEYLE 595

Query: 590 DFKRKIEQRHLIEEQRREQFESEALMKTAQDSTLN----LFAGGTSWLN 634
           +FK++      +EE  + +   +A + + +  T N    L  G  SWL+
Sbjct: 596 NFKKE------LEETEKSKNSVDANISSQKYETFNDAMILLGGSDSWLD 638

>ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR277W (FCP1)
          Length = 728

 Score =  757 bits (1955), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/644 (58%), Positives = 475/644 (73%), Gaps = 31/644 (4%)

Query: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDENDGNGGAQH 60
           M+TP+  P+SLPYPITI QL    G TV+KGQRL AYK+W +V++ ++P E +    A  
Sbjct: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGEEE----AGK 56

Query: 61  SKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTMCGK 120
           ++K   + +  F+SP  G +VS +V  GDE  ++++ + EI + C HDV YGGLC  CG+
Sbjct: 57  ARKQRVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGLCVQCGQ 116

Query: 121 EVDEN----DQME-ANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDLDQTV 175
            V++     D +E A L +SHT+T+++VS ++A  +    + +LR+++KLVLVVDLDQTV
Sbjct: 117 AVEDEAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVVDLDQTV 176

Query: 176 IHCGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRLPERKCWYFVKVRP 235
           IHCGVDPTIGEW KDP+NPNYE LKDVQ FSL+EEP++PP YMGP+ P RKCWY+VK+RP
Sbjct: 177 IHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPKPPTRKCWYYVKLRP 236

Query: 236 GLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQKSLER 295
           GL+EFFA++AP +E+HIYTMATR YALEIAKIIDPDG LFGDRILSRDENGSLTQKSLER
Sbjct: 237 GLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLTQKSLER 296

Query: 296 LFPTDQSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQLGRRTH 355
           LFP DQSMV+VIDDRGDVWNWC NLIKVVPY+FFVG+GDINSNFLP QQ+ +L LGRR  
Sbjct: 297 LFPMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLHLGRRNR 356

Query: 356 KKPQESDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEPVQGESKEQLTKKLEY 415
           KKP++ +ELLTDI+DTEK+L+EKI+EEVKRQE+++ H+LT    P        + KKLE+
Sbjct: 357 KKPKQEEELLTDILDTEKKLKEKINEEVKRQEDQM-HRLTDEKLP----DTRDIAKKLEH 411

Query: 416 SASLEVQQQNRPLATLQKHMHNQRXXXXXXXXXXXXXXXXAKIHRKYYKLL---DEGNEN 472
           +ASLEVQQQNRPLA LQKHM N+R                 K+H  YY  L   + G + 
Sbjct: 412 NASLEVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKVHSAYYDQLQRYNSGEDP 471

Query: 473 SADIQSLVPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHV 532
             DI+ L+P +K  VF+ C FVFSGLIPL TNI RADIVLWT MFGA T++ +D NTTH+
Sbjct: 472 IPDIKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTANLDYNTTHL 531

Query: 533 ITKTPGTYKARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEIQDFK 592
           IT+TPGT KAR+AK FN  +K+VHPDW+FECLV W  V+E PYELI+++P  EE +++FK
Sbjct: 532 ITRTPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYELIVEEPVGEEYLENFK 591

Query: 593 RKIEQRHLIEEQRREQFESEALMKTAQD--STLNLFAGGTSWLN 634
           R      L E Q++       +   AQD  S+L L  G  SWL+
Sbjct: 592 RD-----LAEAQKK-------VDPPAQDSRSSLLLLDGNGSWLD 623

>KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase ,
          Length = 719

 Score =  723 bits (1867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/635 (55%), Positives = 448/635 (70%), Gaps = 11/635 (1%)

Query: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDENDGNGGAQH 60
           + T V     LPYPIT+ QL    G  V+KGQRLFAY++W   ++    +E         
Sbjct: 3   LETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVLVKYEEK-------- 54

Query: 61  SKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTMCGK 120
           +KK   + +  F+SP  G +  W     DE ASA   +  I + CNHD+ YGGLC  CG 
Sbjct: 55  TKKQRVDRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQCGN 114

Query: 121 EVDENDQMEANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDLDQTVIHCGV 180
            VDE D  + NL ISH +TN+KVS ++AE +E     RLR+ KKLVLVVDLDQTVIHCGV
Sbjct: 115 TVDEEDNSK-NLTISHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDLDQTVIHCGV 173

Query: 181 DPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRLPERKCWYFVKVRPGLREF 240
           DPTIGEW +DP NPNY+ L+DV+ F+LE+EPI+P  Y GP+ P RK WY+VK+RPGL+EF
Sbjct: 174 DPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPKPPARKSWYYVKLRPGLKEF 233

Query: 241 FAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQKSLERLFPTD 300
           F  ++P +EMHIYTMATR+YA EIAKIIDP G LFGDRILSRDENGSLT KSLERLFP D
Sbjct: 234 FEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTTKSLERLFPMD 293

Query: 301 QSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQLGRRTHKKPQE 360
           QSMV+VIDDRGDVWNW  NLIKVVPY+FFVG+GDINSNFLPRQQ+ +L LGR  H++ QE
Sbjct: 294 QSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHLGRH-HRRKQE 352

Query: 361 SDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEPVQG-ESKEQLTKKLEYSASL 419
            ++L++DI+D EK+L+EKIDEEVKRQEE +SH    N     G  +KE ++KKLE+SASL
Sbjct: 353 EEKLISDIIDNEKKLKEKIDEEVKRQEEIISHIGDDNTRKEGGPPNKEDISKKLEHSASL 412

Query: 420 EVQQQNRPLATLQKHMHNQRXXXXXXXXXXXXXXXXAKIHRKYYKLLDEGNENSADIQSL 479
           EVQQQNRPLA LQKH+HNQ                  ++H++Y+    E  +N  DI+ L
Sbjct: 413 EVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLRVHKEYFNQYTEAPKNPPDIKYL 472

Query: 480 VPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHVITKTPGT 539
           +P MK +VF+ C+FVFSGLIPL T++R+ADIVLWT MFGA TSS+I+  TTH+IT T  T
Sbjct: 473 LPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDMFGATTSSDINYKTTHIITTTSRT 532

Query: 540 YKARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEIQDFKRKIEQRH 599
           +KAR+AK FN ++K+VHPDW+FECLV W  V E PYEL+IQDP  E+++++FK K++++ 
Sbjct: 533 FKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYELLIQDPVDEDKVKEFKEKLDKKI 592

Query: 600 LIEEQRREQFESEALMKTAQDSTLNLFAGGTSWLN 634
                    FE     +       +L AG  SWL+
Sbjct: 593 SNPSSSVNPFEDGNEDEEVLGDEFHLLAGNDSWLD 627

>TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5.94
           YHR154W
          Length = 1015

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 59/118 (50%), Gaps = 12/118 (10%)

Query: 487 VFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDEN---TTHVITKTPG--TYK 541
           +FK+ Y +F  L     +  + +++ ++ +  A+  + +D     TTH+IT  P      
Sbjct: 119 IFKN-YQIFLSL----NSFNKTEVLFYSELINALGGTTVDHISTLTTHLITNDPTDQAVI 173

Query: 542 ARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPA--TEEEIQDFKRKIEQ 597
           A IA    +N+  V+P W+ +C  + T V+E  + + IQ  A  ++  +QD    +E+
Sbjct: 174 ATIASEQKQNISFVYPTWLCQCFKSMTLVNESDHLINIQSSAEDSKNRLQDLWNMVEE 231

>Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932
           aa] {ON} (148944..151325,151327..151743) [2799 nt, 933
           aa]
          Length = 932

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 45/97 (46%), Gaps = 10/97 (10%)

Query: 486 QVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAI---TSSEIDENTTHVITKTPG--TY 540
            + KDC    S  +       R + +L++ +  A+    S  I   TTH+I+  P     
Sbjct: 121 HILKDCTIYVSRTV-----FNRTENILYSELINALGGSVSDMISNKTTHLISSDPTDPAL 175

Query: 541 KARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYEL 577
            A +A   +  +K V+P W+ +C +   +VDEK + L
Sbjct: 176 IAIVASDCHSRIKQVYPAWLCQCFLEVKYVDEKNFIL 212

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/177 (20%), Positives = 76/177 (42%), Gaps = 45/177 (25%)

Query: 121 EVDENDQMEANLAISHTDTN---------------LKVSRKEAEDMEHFL--KQRLRQSK 163
           +V++ND +  N+++++ + N               L+ ++  A   E  L  K+  R  +
Sbjct: 263 QVNQNDPVMNNMSLNYAEINENNKMIDGNLIDLSKLQANQVSATGYETLLAPKEIKRFGR 322

Query: 164 KLVLVVDLDQTVIHCGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRLP 223
           K  L++DLD+T++H         +K                  ++    V P+     + 
Sbjct: 323 KKCLILDLDETLVHSS-------FKY-----------------VDSADFVIPV----TID 354

Query: 224 ERKCWYFVKVRPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRIL 280
            +    +V  RPG+ EF  +++ LYE+ ++T +   Y   +  I+DP  ++   R+ 
Sbjct: 355 NQTHHVYVIKRPGVDEFLKRVSELYEVVVFTASVSRYGDPLLNILDPANTIIHHRLF 411

>Ecym_2066 Chr2 complement(110523..113165) [2643 bp, 880 aa] {ON}
           similar to Ashbya gossypii ADL145C
          Length = 880

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 43/115 (37%), Gaps = 11/115 (9%)

Query: 484 KGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMF---GAITSSEIDENTTHVITKTPGTY 540
           K    KDCY   S           A+  L+T M    G      +    TH+IT  P   
Sbjct: 115 KTHFMKDCYVYVSS-----QQFSAAEYELYTSMLTYMGGCCMDYLSTKVTHIITSDPKDQ 169

Query: 541 KARIAKGFNE-NVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEIQDFKRK 594
              + K FN+  V  V   W+ EC V   +V E  Y  ++    + EE+     K
Sbjct: 170 AVLVLKRFNKFEVLTVSSAWLAECFVRQEYVSEAAY--LVGSEMSNEEVTALAEK 222

>NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5.94
           YHR154W
          Length = 1034

 Score = 40.8 bits (94), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 51/108 (47%), Gaps = 14/108 (12%)

Query: 488 FKDCYFVFSGLIPLGTNI---RRADIVLWTGMFGAITSSEIDENTTHVITKTPGTYKARI 544
           FK   F  S LI   TN    +R+ I   T M G I+++E+ +  TH++++ P   K   
Sbjct: 352 FKKKIFKSSELILTYTNYFGRQRSYIQRLTEMLGGISTTELSKRNTHLVSRMPVGKKFFQ 411

Query: 545 AKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEIQDFK 592
           AK + +  +V++  W+           E+ Y+  I+      E QDFK
Sbjct: 412 AKKWKDRCQVINHLWL-----------ERTYKTGIKQDPNSSEFQDFK 448

 Score = 38.1 bits (87), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 46/111 (41%), Gaps = 4/111 (3%)

Query: 517 FGAITSSEIDENTTHVITKT---PGTYKARIAKGFNENVKVVHPDWVFECLVTWTHVDEK 573
            G   +  I+  TTH+I      P     +     N  +K V+P W+ +C     ++DE 
Sbjct: 160 LGGTITHVINNKTTHLIAIAIDDPAIIAIKEKGQNNTIIKSVYPTWLVQCFKERKYIDES 219

Query: 574 PYELIIQDPATEEEIQDFKRKIEQRHLIEEQRREQFESEALMKTAQDSTLN 624
           P+ LI +D    E + D  R +    +  +  + QF        A + ++N
Sbjct: 220 PH-LITEDQNNSEHLDDIWRFVLDDVVFSDSIKYQFLKNKRFILAMNLSMN 269

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 29/45 (64%)

Query: 230 FVKVRPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSL 274
           +V  RPG+ EF +++  LYE+ ++T +   YA  +   +DP+G++
Sbjct: 260 YVIKRPGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDPNGTI 304

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score = 39.7 bits (91), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 5/61 (8%)

Query: 229 YFVKVRPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGS----LFGDRILSRDE 284
           Y +K RPG+ EF  ++  LYE+ ++T +   Y   +  I+DP G+    LF D   + D 
Sbjct: 267 YVIK-RPGVDEFLERVGKLYEVVVFTASVSRYGDPLLDILDPRGAVHHRLFRDSCYNYDG 325

Query: 285 N 285
           N
Sbjct: 326 N 326

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score = 39.7 bits (91), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 29/45 (64%)

Query: 230 FVKVRPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSL 274
           +V  RPG+ EF  +++ LYE+ ++T +   YA  +   +DP+G++
Sbjct: 265 YVIKRPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPNGTI 309

>TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {ON}
           Anc_2.530 YHR004C
          Length = 393

 Score = 38.5 bits (88), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 50/103 (48%), Gaps = 10/103 (9%)

Query: 159 LRQSKKLVLVVDLDQTVIHCGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYM 218
           L+ +K+  L++DLD+T+IH     ++       +  NY  L +V+  +    P   P   
Sbjct: 187 LKTNKRKKLILDLDETLIH-----SMSRNISSSTISNYH-LIEVKFPTPTSAPTSAP--- 237

Query: 219 GPRLPERKCWYFVKVRPGLREFFAQLAPLYEMHIYTMATRTYA 261
           GP LP    +Y  K RP    F   ++  Y++ I+T + + YA
Sbjct: 238 GPSLPLSSLYYVYK-RPYCDHFLNLVSDWYDLIIFTASMKEYA 279

>Suva_8.400 Chr8 (717697..720654) [2958 bp, 985 aa] {ON} YOR346W
           (REAL)
          Length = 985

 Score = 38.5 bits (88), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 41/88 (46%), Gaps = 6/88 (6%)

Query: 477 QSLVPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHVITKT 536
           + L+ +  G +FK+C    +G    G       IVL  G F    S++  +  TH++   
Sbjct: 156 KGLISSQNGNLFKNCVIYINGYTKPGRLQLHEMIVLHGGKFLHHLSAK--KRVTHIVASN 213

Query: 537 PGTYKARIAKGFNENVKVVHPDWVFECL 564
               K RI      N KVV+PDW+ +C+
Sbjct: 214 L-PLKKRIEFA---NYKVVNPDWITDCI 237

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 37.7 bits (86), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 29/45 (64%)

Query: 230 FVKVRPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSL 274
           +V  RPG+ EF  +++ +YE+ ++T +   YA  +   +DP+G++
Sbjct: 260 YVIKRPGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDPNGTI 304

>Ecym_4460 Chr4 (939029..941224) [2196 bp, 731 aa] {ON} similar to
           Ashbya gossypii ADR023C
          Length = 731

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 67/143 (46%), Gaps = 12/143 (8%)

Query: 232 KVRPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDP-DGSLFGDRILSRDENGSLTQ 290
           K+RP  R+F  Q+    +    T+  +   + +    DP  G L   R LS+ +   L  
Sbjct: 50  KLRPKPRQFKKQIIMAPKKKRLTIDLKK-QIRVFPFKDPFVGGLTSLRGLSKSKPNRLAH 108

Query: 291 KSLERLFPTDQSMVIVIDDRGDVWNWCP---NLIKVVPYNFFVGVGDINSNFL-PRQQSG 346
             LER      S+V + D R +++N+ P   N+IK+  +NF     D  + F+ P   S 
Sbjct: 109 -GLERCLFEPMSIVPLKDRRSNIYNFKPFLENIIKLKDFNF-----DAITGFVPPSLDSR 162

Query: 347 LLQLGRRTHKKPQESDELLTDIM 369
           LL+L R+  KK   S   +T ++
Sbjct: 163 LLELARKHSKKYVSSTSSITGML 185

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 37.0 bits (84), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 27/51 (52%)

Query: 230 FVKVRPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRIL 280
           +V  RPG+ EF  ++  L+E+ ++T +   Y   +  I+DP   L   R+ 
Sbjct: 340 YVIKRPGVEEFLKRVGELFEVVVFTASVARYGDPLLDILDPGRQLIHHRLF 390

>Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON}
           YHR004C (REAL)
          Length = 447

 Score = 37.0 bits (84), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 56/134 (41%), Gaps = 32/134 (23%)

Query: 135 SHTDTNLKVSRKEAEDMEHFL-------KQRLRQSKKLVLVVDLDQTVIHCGVDPTIGEW 187
           +H++TN     K    M  FL       K  L   KK  LV+DLD+T+IH     T    
Sbjct: 218 NHSNTNTVFGTKR---MGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIHSASRSTTH-- 272

Query: 188 KKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRLPERKCWYFVKVRPGLREFFAQLAPL 247
               SN +   L +V+ F +   P +               YF+  RP    F  +++  
Sbjct: 273 ----SNSSQGHLVEVK-FGISGIPTL---------------YFIHKRPYCDFFLTKVSRW 312

Query: 248 YEMHIYTMATRTYA 261
           Y++ I+T + + YA
Sbjct: 313 YDLIIFTASMKEYA 326

>KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5.202
           YLL010C
          Length = 481

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 50/113 (44%), Gaps = 28/113 (24%)

Query: 162 SKKLVLVVDLDQTVIHCGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPR 221
           S +  LV+DLD+T++H                  ++ LK            V P+ +  +
Sbjct: 309 SHRKCLVLDLDETLVHSS----------------FKYLKSADF--------VLPVDIDDQ 344

Query: 222 LPERKCWYFVKVRPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSL 274
           +      Y +K RPG+ EF  ++  LYE+ ++T +   Y   +  I+D D S+
Sbjct: 345 I---HNVYVIK-RPGVDEFLRRVGKLYEVVVFTASVSRYGDPLLDILDKDKSI 393

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score = 35.8 bits (81), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 28/45 (62%)

Query: 230 FVKVRPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSL 274
           +V  RPG+ EF  +++ LYE+ ++T +   YA  +   +DP+ ++
Sbjct: 253 YVIKRPGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDPNRTI 297

>NDAI0E03930 Chr5 (868403..871489) [3087 bp, 1028 aa] {ON} Anc_7.46
           YOR346W
          Length = 1028

 Score = 36.2 bits (82), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 44/99 (44%), Gaps = 17/99 (17%)

Query: 486 QVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHVITKTPGTYKARIA 545
           Q+FKDC    +G    G       IVL  G F    S++  +  TH+I     T K ++ 
Sbjct: 178 QIFKDCIIYINGYTIPGRLQLHESIVLHGGKFIHHLSAK--KKITHIIASN-LTLKKKLE 234

Query: 546 KGFNENVKVVHPDWVFEC-----LVTW------THVDEK 573
               E  KVV PDW+ +      L+ W      TH+DE+
Sbjct: 235 ---FEKYKVVKPDWIVKSIESKKLLPWQDFALLTHLDEQ 270

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score = 35.8 bits (81), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 53/125 (42%), Gaps = 28/125 (22%)

Query: 156 KQRLRQSKKLVLVVDLDQTVIHCGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPP 215
           K  ++   K  LV+DLD+T++H                PN +       F+L       P
Sbjct: 335 KDEIKFKHKKCLVLDLDETLVHSSFKYL----------PNAD-------FNL-------P 370

Query: 216 MYMGPRLPERKCWYFVKVRPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLF 275
           + +  ++      Y +K RPG+ EF  ++  L+E+ I+T +   Y   +   +DP G   
Sbjct: 371 VNIDDQI---HNVYVIK-RPGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLDPKGKSI 426

Query: 276 GDRIL 280
             R+ 
Sbjct: 427 HHRLF 431

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 35.8 bits (81), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 23/41 (56%)

Query: 230 FVKVRPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDP 270
           +V  RPG+ EF   +  LYE+ ++T +   Y   +  I+DP
Sbjct: 320 YVSKRPGVDEFLKIVGDLYEVIVFTASVSRYGNPLMDILDP 360

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score = 35.8 bits (81), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 52/121 (42%), Gaps = 27/121 (22%)

Query: 160 RQSKKLVLVVDLDQTVIHCGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMG 219
           +   K  L++DLD+T++H           K  +NP++     +    +E+  I       
Sbjct: 308 KDKHKKCLILDLDETLVHSSF--------KFINNPDF-----ILPIEIEDGQI------- 347

Query: 220 PRLPERKCWYFVKVRPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRI 279
                    Y +K RPG+  F  ++   YE+ I+T +   YA  +  ++D D +L   R+
Sbjct: 348 ------HNVYVIK-RPGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDHNLINHRL 400

Query: 280 L 280
            
Sbjct: 401 F 401

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score = 35.4 bits (80), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (57%)

Query: 230 FVKVRPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSL 274
           +V  RPG+ EF  ++A LYE+ ++T +   Y   +  I+D   S+
Sbjct: 259 YVIKRPGVDEFLRRVAQLYEVVVFTASVSRYGDPLLDILDSSNSI 303

>KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.94
           YHR154W
          Length = 951

 Score = 35.4 bits (80), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 38/82 (46%), Gaps = 4/82 (4%)

Query: 501 LGTNIRRADIVLWTGMF---GAITSSEIDENTTHVITKTPGTYKARIAK-GFNENVKVVH 556
           L  +   ++ +L+T +    G      I+  TTH+IT  P      I K     ++K ++
Sbjct: 133 LKPSFEASEYLLYTELIHSMGGTCVENINNKTTHIITTNPKESCFEILKRNGTTSIKYIY 192

Query: 557 PDWVFECLVTWTHVDEKPYELI 578
           P W+  C+     +DE  +E++
Sbjct: 193 PTWLIHCVKESQLIDESEHEIV 214

>YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}
           TIM50Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); acts as receptor
           for the TIM23 complex guiding incoming precursors from
           the TOM complex; may control the gating of the
           Tim23p-Tim17p channel
          Length = 476

 Score = 35.0 bits (79), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 53/110 (48%), Gaps = 11/110 (10%)

Query: 224 ERKCWYFVKVRPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDP-----DGSLFGDR 278
           ++  W   K RPG   F   L+  YE+ +++     Y+ +IA+ +DP       +LF + 
Sbjct: 209 QKHGWRTAK-RPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEH 267

Query: 279 ILSRDENGSLTQKSLERLFPTDQSMVIVIDDRGDVWNWCP-NLIKVVPYN 327
            + +D    +  K L +L   D S VI+ID   + +   P N I + P+N
Sbjct: 268 CVYKD---GVHIKDLSKL-NRDLSKVIIIDTDPNSYKLQPENAIPMEPWN 313

>NDAI0G01620 Chr7 (357000..359219) [2220 bp, 739 aa] {ON} Anc_3.196
           YBR007C
          Length = 739

 Score = 35.0 bits (79), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 8/49 (16%)

Query: 169 VDLDQTVIHCGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMY 217
           + +D+ V+HC VDP   E K +         +D  M+ +  EP+ P +Y
Sbjct: 607 ISIDKDVLHCHVDPMEIEKKNN--------FRDKSMYQIMREPLAPALY 647

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 229 YFVKVRPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSL 274
           Y +K RPG+ EF  ++  LYE+ ++T +   Y   +  I+D D ++
Sbjct: 282 YVIK-RPGVDEFLRRITELYEVVVFTASVSRYGDPLLDILDKDKTI 326

>ZYRO0B15026g Chr2 complement(1222480..1225968) [3489 bp, 1162 aa]
           {ON} weakly similar to uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 1162

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 42/105 (40%), Gaps = 5/105 (4%)

Query: 488 FKDCYFVFSGLIPLGTNI---RRADIVLWTGMFGAITSSEIDENTTHVITKTPGTYKARI 544
           FK      + LI   TN    +R  I       G  T+SE+    TH++ + P   K   
Sbjct: 342 FKRKLLETNQLITAYTNFFGQQRFYIQRLVNALGGFTTSELSRRNTHLLCRFPFGKKFET 401

Query: 545 AKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEIQ 589
           AK + +   + +  W+ EC    T +D  P     Q    E E+Q
Sbjct: 402 AKNWGDKCVITNYLWLEECYRQSTRLD--PLTPCFQQLPVEGELQ 444

>NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {ON}
           Anc_5.202
          Length = 398

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 25/45 (55%)

Query: 230 FVKVRPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSL 274
           +V  RPG+ EF  ++  LYE+ ++T +   Y   +  I+D   S+
Sbjct: 266 YVIKRPGVDEFLKRVGELYEVVVFTASVSRYGDPLLNILDQSNSV 310

>Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 48/100 (48%), Gaps = 10/100 (10%)

Query: 234 RPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDP-----DGSLFGDRILSRDENGSL 288
           RPG   F   L+  YE+ +++     Y+ + A+ +DP       +LF +  + +D    +
Sbjct: 221 RPGAEYFLGYLSQYYEIVLFSSNYMMYSEKTAEKLDPIHAFVSYNLFKEHCVYKD---GV 277

Query: 289 TQKSLERLFPTDQSMVIVIDDRGDVWNWCP-NLIKVVPYN 327
             K L +L   D S VI+ID   + +   P N I + P+N
Sbjct: 278 HIKDLSKL-KRDLSKVIIIDTDPNSYKLQPENAIPMDPWN 316

>SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 385

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 54/239 (22%), Positives = 83/239 (34%), Gaps = 59/239 (24%)

Query: 39  FWYMVE-----IASSP----DENDGNGGAQHSKKTVRESIEFFESPFEGDLVSWEVDRGD 89
           FWY++      I  SP    DE +G  G     +    SI       E DL       GD
Sbjct: 80  FWYIITFPLNLIEHSPADDEDERNGEEGNSTGDEEKTPSINIIVEEDEEDLA------GD 133

Query: 90  EVASARQVICEIMRPCNHDVVYGGLCTMCGKEVDENDQMEANLAISHTDTNLKVSRKEAE 149
           E+                D V G L T+   +  +  +     +I    T   +  +   
Sbjct: 134 EII------------LQTDAVKGSLSTISESQQVKTIKASTRSSIRSGSTGTALGSRR-- 179

Query: 150 DMEHFL-------KQRLRQSKKLVLVVDLDQTVIHCGVDPTIGEWKKDPSNPNYETLKDV 202
            M  FL       +  L   KK +LV+DLD+T+IH     T              +    
Sbjct: 180 -MGRFLFPKKLIPQSVLNNEKKKILVLDLDETLIHSMSRGT-------------SSSNSS 225

Query: 203 QMFSLEEEPIVPPMYMGPRLPERKCWYFVKVRPGLREFFAQLAPLYEMHIYTMATRTYA 261
           Q   +E +  V  +            YFV  RP    F +++A  Y + ++T + + YA
Sbjct: 226 QGHMVEVKFAVSGI---------SSLYFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYA 275

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 24/42 (57%)

Query: 230 FVKVRPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPD 271
           +V  RPG+ EF  ++  L+E+ ++T +   Y   +  I+D D
Sbjct: 295 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTD 336

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 24/42 (57%)

Query: 230 FVKVRPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPD 271
           +V  RPG+ EF  ++  L+E+ ++T +   Y   +  I+D D
Sbjct: 282 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDAD 323

>ZYRO0D12914g Chr4 complement(1089169..1090980) [1812 bp, 603 aa]
           {ON} similar to uniprot|Q04228 YML013W Saccharomyces
           cerevisiae SEL1 UBX (ubiquitin regulatory X) domain-
           containing protein that interacts with Cdc48p
          Length = 603

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 54/110 (49%), Gaps = 7/110 (6%)

Query: 529 TTHVITKTPGTYKARIA--KGFNENVKVVHPDWVFECLVTWTHVDEKPYELII---QDPA 583
           T + +TK     K R++  K F  ++K+V+  +  E +V+ T  DE      I   QD A
Sbjct: 323 TLNGVTKLSVLSKLRVSSPKKFYHSLKMVYERFNAELIVSRTEKDELRLAREIKQLQDSA 382

Query: 584 TEEEIQDFKRKIEQRHLIEEQRREQFESEALMKTAQDSTLNLFAGGTSWL 633
            EE ++  + K EQR L +E+ + + + E  ++ A +  L       SWL
Sbjct: 383 YEESLKKDQLKKEQRELAQEEEKARRDRE--LEVANNKKLQSTLNQLSWL 430

>KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.527
           YPL063W
          Length = 448

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 67/164 (40%), Gaps = 33/164 (20%)

Query: 234 RPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDP-----DGSLFGDRILSRDENGSL 288
           RPG+  F   L+  YE+ +++     Y+ +IA+ +DP       +LF +  + +      
Sbjct: 192 RPGVDYFLGYLSQYYEIVLFSSNYMMYSEKIAEKLDPIHAFISYNLFKEHCVYKKGKHIK 251

Query: 289 TQKSLERLFPTDQSMVIVIDDRGDVWNWCP---------------NLIKVVPYNFFVGVG 333
               L R    D + VI+ID   + +   P                LIK++P+  ++   
Sbjct: 252 DLSKLNR----DVNKVIIIDTDKNNYKLQPENAIPMKPWSGTADDELIKLIPFLEYLATQ 307

Query: 334 DINSNFLPRQQSGLLQLGRRTHKKPQESDELLTDIMDTEKRLQE 377
            +N N  P   S         H + + SDE    +++  K+ QE
Sbjct: 308 QVN-NVKPILNS--------FHDRYKLSDEFNERVVNLRKKFQE 342

>Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 49/100 (49%), Gaps = 10/100 (10%)

Query: 234 RPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDP-----DGSLFGDRILSRDENGSL 288
           RPG   F   L+  +E+ +++     Y+ +IA+ +DP       +LF +  + +D    +
Sbjct: 223 RPGADYFLGYLSQYFEIVLFSSNYMMYSEKIAEKLDPIHAFVSYNLFKEHCVYKD---GV 279

Query: 289 TQKSLERLFPTDQSMVIVIDDRGDVWNWCP-NLIKVVPYN 327
             K L +L   D S VI+ID   + +   P N I + P+N
Sbjct: 280 HIKDLSKL-NRDLSKVIIIDTDPNSYKLQPENAIPMEPWN 318

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 229 YFVKVRPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPD 271
           Y +K RPG+ EF  ++  L+E+ ++T +   Y   +  I+D D
Sbjct: 283 YVIK-RPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTD 324

>YOR346W Chr15 (981828..984785) [2958 bp, 985 aa] {ON}
           REV1Deoxycytidyl transferase; involved in repair of
           abasic sites and adducted guanines in damaged DNA by
           translesion synthesis (TLS); forms a complex with the
           subunits of DNA polymerase zeta, Rev3p and Rev7p;
          Length = 985

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 36/83 (43%), Gaps = 6/83 (7%)

Query: 480 VPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHVITKTPGT 539
           + +   ++FK+C    +G    G       IVL  G F    SS+  +  TH++      
Sbjct: 158 ISSQSSKIFKNCVIYINGYTKPGRLQLHEMIVLHGGKFLHYLSSK--KTVTHIVASNL-P 214

Query: 540 YKARIAKGFNENVKVVHPDWVFE 562
            K RI      N KVV PDW+ +
Sbjct: 215 LKKRIEFA---NYKVVSPDWIVD 234

>Ecym_5052 Chr5 (112351..114972) [2622 bp, 873 aa] {ON} similar to
           Ashbya gossypii ADR369C
          Length = 873

 Score = 33.1 bits (74), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 47/111 (42%), Gaps = 8/111 (7%)

Query: 486 QVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHVITKTPGTYKARIA 545
           +VF+ C    +G         R +IVL  G F    + + D   TH++ +     K    
Sbjct: 89  RVFEGCKVYINGRTDPDREQLRKEIVLHGGQFVQYLTKKSD--VTHIVAQNLSAAKCIEF 146

Query: 546 KGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEIQDFKRKIE 596
           + F    KVV P W+  C+     +  + Y +I++  + ++   +  R IE
Sbjct: 147 RNF----KVVQPGWIGACVRIGKMLSWREYSVIVR--SGDQPFLELPRNIE 191

>CAGL0L06644g Chr12 (750307..752793) [2487 bp, 828 aa] {ON} some
           similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154w
          Length = 828

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 33/73 (45%), Gaps = 13/73 (17%)

Query: 514 TGMFGAITSSEIDENTTHVITKTPGTYKARIAKGFNENV----------KVVHPDWVFEC 563
           T   G IT + I + TTH++ KT   +   + K  ++NV          K+V   W+ +C
Sbjct: 146 TQTLGGITQNFISDKTTHIVIKT---FDDPLVKEMDDNVILKEVLNPTMKIVSYQWLLDC 202

Query: 564 LVTWTHVDEKPYE 576
             T +  +E  Y 
Sbjct: 203 FKTVSWANEIKYS 215

>AFR095C Chr6 complement(604687..606699) [2013 bp, 670 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL090C
           (DPB11)
          Length = 670

 Score = 31.6 bits (70), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%)

Query: 550 ENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEI 588
           + V VVHP WV +C+     V+ + YEL     A  EE+
Sbjct: 176 QGVAVVHPKWVTDCVRRGAVVEMEEYELARWAGAAWEEV 214

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 77,555,446
Number of extensions: 3414551
Number of successful extensions: 18729
Number of sequences better than 10.0: 152
Number of HSP's gapped: 19154
Number of HSP's successfully gapped: 155
Length of query: 764
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 647
Effective length of database: 40,065,477
Effective search space: 25922363619
Effective search space used: 25922363619
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)