Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0G14146g8.838ON50750722130.0
TDEL0B005908.838ON5413539231e-118
Kpol_1068.108.838ON6173457395e-90
TPHA0I002308.838ON6143666514e-77
SAKL0D01518g8.838ON5743726242e-73
Kwal_27.102728.838ON5513575776e-67
NCAS0B003108.838ON5643445761e-66
KLTH0C03916g8.838ON5703745421e-61
Smik_13.208.838ON5103645353e-61
ABL128W8.838ON4743565315e-61
YML114C (TAF8)8.838ON5103645292e-60
Suva_13.298.838ON5093615214e-59
Ecym_46098.838ON5203635172e-58
Skud_13.278.838ON5143655012e-56
TBLA0D032508.838ON6834254981e-54
NDAI0E003008.838ON6644444733e-51
KAFR0A028208.838ON4533384553e-50
KLLA0D01617g8.838ON5623813383e-33
CAGL0B02299g8.838ON6432112782e-25
KNAG0G034108.838ON5263612586e-23
ZYRO0G17204g7.449ON36898780.52
Kwal_47.181517.222ON41486770.82
Kpol_1070.207.220ON62983714.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0G14146g
         (507 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weak...   857   0.0  
TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {O...   360   e-118
Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {O...   289   5e-90
TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838...   255   4e-77
SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {...   244   2e-73
Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {...   226   6e-67
NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}...   226   1e-66
KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {...   213   1e-61
Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}...   210   3e-61
ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic ho...   209   5e-61
YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}  T...   208   2e-60
Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}...   205   4e-59
Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar...   203   2e-58
Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}...   197   2e-56
TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.8...   196   1e-54
NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}...   186   3e-51
KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.8...   179   3e-50
KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {...   134   3e-33
CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some s...   111   2e-25
KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.8...   103   6e-23
ZYRO0G17204g Chr7 (1419895..1421001) [1107 bp, 368 aa] {ON} high...    35   0.52 
Kwal_47.18151 s47 (709368..710612) [1245 bp, 414 aa] {ON} YIL042...    34   0.82 
Kpol_1070.20 s1070 complement(46652..48541) [1890 bp, 629 aa] {O...    32   4.2  

>ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weakly
           similar to uniprot|Q03750 Saccharomyces cerevisiae
           YML114C TAF8 TFIID subunit (65 kDa) involved in RNA
           polymerase II transcription initiation
          Length = 507

 Score =  857 bits (2213), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/507 (85%), Positives = 436/507 (85%)

Query: 1   MDNYIQITKLPTLQELQHEDREPNVVKVLAKSVALQLKPMNAQITQFAFDRLLQLVDGQL 60
           MDNYIQITKLPTLQELQHEDREPNVVKVLAKSVALQLKPMNAQITQFAFDRLLQLVDGQL
Sbjct: 1   MDNYIQITKLPTLQELQHEDREPNVVKVLAKSVALQLKPMNAQITQFAFDRLLQLVDGQL 60

Query: 61  NDMISQLHRMSNLQRRETIAKGDISMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHLH 120
           NDMISQLHRMSNLQRRETIAKGDISMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHLH
Sbjct: 61  NDMISQLHRMSNLQRRETIAKGDISMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHLH 120

Query: 121 SLRDLQSSLAHEMVPFEDQEAVRQNVSTVLVPPTNPLQDFLPKWLPDFPPDHTYKFTPQY 180
           SLRDLQSSLAHEMVPFEDQEAVRQNVSTVLVPPTNPLQDFLPKWLPDFPPDHTYKFTPQY
Sbjct: 121 SLRDLQSSLAHEMVPFEDQEAVRQNVSTVLVPPTNPLQDFLPKWLPDFPPDHTYKFTPQY 180

Query: 181 SHPITDETTIRRQIVEEAKQSELALSHLSQKKNPTDDIVNRSQYDSELAEQETLAIYGSQ 240
           SHPITDETTIRRQIVEEAKQSELALSHLSQKKNPTDDIVNRSQYDSELAEQETLAIYGSQ
Sbjct: 181 SHPITDETTIRRQIVEEAKQSELALSHLSQKKNPTDDIVNRSQYDSELAEQETLAIYGSQ 240

Query: 241 LKKRKTQHPQANSADLLSKLPQTNFSVEEYAHNRIEVARKKVLEFEERQLQSQQDPFLKL 300
           LKKRKTQHPQANSADLLSKLPQTNFSVEEYAHNRIEVARKKVLEFEERQLQSQQDPFLKL
Sbjct: 241 LKKRKTQHPQANSADLLSKLPQTNFSVEEYAHNRIEVARKKVLEFEERQLQSQQDPFLKL 300

Query: 301 SRIAFTQCNDKFTKKQVHREFQLALQRSFIHLVKSIPELERNKLETEEKAKEERSXXXXX 360
           SRIAFTQCNDKFTKKQVHREFQLALQRSFIHLVKSIPELERNKLETEEKAKEERS     
Sbjct: 301 SRIAFTQCNDKFTKKQVHREFQLALQRSFIHLVKSIPELERNKLETEEKAKEERSKRLQE 360

Query: 361 XXXXXXXXXXXGERXXXXXXXXXXXXXXFFAMESSDEEVMEPTVDKPPLEQPQQTETAQN 420
                      GER              FFAMESSDEEVMEPTVDKPPLEQPQQTETAQN
Sbjct: 361 LRAQREEQEKKGERDVLDLDELDQNQEDFFAMESSDEEVMEPTVDKPPLEQPQQTETAQN 420

Query: 421 EPQQPELIXXXXXXXXXXXXXXXXXXXXXXXRIGEEIQPATQEIADXXXXXXXXXXXXXX 480
           EPQQPELI                       RIGEEIQPATQEIAD              
Sbjct: 421 EPQQPELIQEHVQEKSQHEQEQEQEQVQEPERIGEEIQPATQEIADLPPQEPQGEPLQGR 480

Query: 481 XXXXDISIELSSNPSEDEDLNNSTYPV 507
               DISIELSSNPSEDEDLNNSTYPV
Sbjct: 481 PQEEDISIELSSNPSEDEDLNNSTYPV 507

>TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {ON}
           Anc_8.838 YML114C
          Length = 541

 Score =  360 bits (923), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 185/353 (52%), Positives = 259/353 (73%), Gaps = 10/353 (2%)

Query: 4   YIQITKLPTLQELQHEDREPNVVKVLAKSVALQLKPMNAQITQFAFDRLLQLVDGQLNDM 63
           +IQ+T LPTL E+ H   E  VVK+L+K+VALQLKPM A I++FAF+ L+ L+D QLNDM
Sbjct: 9   HIQLTHLPTLDEIDHGKTEAAVVKILSKAVALQLKPMKADISKFAFEHLMILIDDQLNDM 68

Query: 64  ISQLHRMSNLQRRETIAKGDISMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHLHSLR 123
           I QLHR SN+QRRE+IAKGD+ + ++G+N++P+ ++ Q + S++YS+ Y KEF+ LHSL+
Sbjct: 69  IGQLHRFSNVQRRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKEFDSLHSLK 128

Query: 124 DLQSSLAHEMVPFEDQEAVRQNVSTVLVPPTNPLQDFLPKWLPDFPPDHTYKFTPQYSHP 183
           +   +    +V   D++   ++V   LV P NPL  ++PKW+P FPPDHTYKFTPQY+ P
Sbjct: 129 E---TFTDAVV---DEDNGSEDVINELVRPNNPLIRYIPKWMPAFPPDHTYKFTPQYNQP 182

Query: 184 ITDETTIRRQIVEEAKQSELALSHLSQKKNP--TDDIVNRSQYDSELAEQETLAIYGSQL 241
           ITDET IRR+IV+E KQSE+AL HL +  NP       + + YD  L  +ET AIYG++ 
Sbjct: 183 ITDETIIRRRIVDEGKQSEVALLHLLKNMNPPTPSSDADGASYDEALVREETAAIYGNEQ 242

Query: 242 KKRKTQHPQANSADLLSKLPQTNFSVEEYAHNRIEVARKKVLEFEERQLQSQQDPFLKLS 301
           KKRK     ++S+DLLSKLPQTNFS+EEYA +R+E+ARKKV+E+EERQ++ Q++PF+K S
Sbjct: 243 KKRKKN--ASSSSDLLSKLPQTNFSIEEYARSRVEIARKKVVEYEERQMKLQRNPFIKYS 300

Query: 302 RIAFTQCNDKFTKKQVHREFQLALQRSFIHLVKSIPELERNKLETEEKAKEER 354
           +IA +  +DK  ++Q  RE    LQRS  HL+KSIPEL+  K +   KA+++R
Sbjct: 301 KIALSNSSDKSGRRQATREIHSMLQRSLQHLIKSIPELQMTKQDARRKAEQKR 353

>Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {ON}
           complement(18964..20817) [1854 nt, 618 aa]
          Length = 617

 Score =  289 bits (739), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 156/345 (45%), Positives = 229/345 (66%), Gaps = 22/345 (6%)

Query: 4   YIQITKLPTLQELQHEDREPNVVKVLAKSVALQLKPMNA--QITQFAFDRLLQLVDGQLN 61
           YIQ+T+LPTL E ++E+ EP + K+LAK+VALQLK MN    IT+FAF+ L+ LV GQ++
Sbjct: 8   YIQLTELPTLTEYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSLVVGQID 67

Query: 62  DMISQLHRMSNLQRRETIAKGDISMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHLHS 121
           DM+ +LHR+S+LQRR T+AK DIS+ + GFN++P  +E Q++ S++ S+ Y K++    S
Sbjct: 68  DMVLELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLSKLYDKDY---ES 124

Query: 122 LRDLQSSLAHEMVPFEDQEAVRQNVSTV----LVPPTNPLQDFLPKWLPDFPPDHTYKFT 177
           L  + ++    +  ++  +   ++ ST     LVP +NPLQ  +P WLPDFPPD+TYKFT
Sbjct: 125 LTKIATTTTRTLSTYQKLDLTHKDTSTAQTSKLVPISNPLQKLIPSWLPDFPPDYTYKFT 184

Query: 178 PQYSHPITDETTIRRQIVEEAKQSELALSHLSQKKNPTDDIVNR----SQYDSELAEQET 233
           PQY+ PITDET IRR++VEE KQSE AL +L   +   +D ++R    S  + ELA +ET
Sbjct: 185 PQYNTPITDETIIRRKVVEEGKQSEKALLNL--LRGGQEDRISRDLKFSSSEMELATEET 242

Query: 234 LAIYGSQLKKRKTQHPQANSADLLSKLP-QTNFSVEEYAHNRIEVARKKVLEFEERQLQS 292
           LA Y +   + K      +      K P Q + +VEEYA  R+E+ RKKVL +EERQLQ 
Sbjct: 243 LATYSAITLRNK------HLTSFFEKEPIQNSLNVEEYARTRVEIERKKVLGYEERQLQI 296

Query: 293 QQDPFLKLSRIAFTQCNDKFTKKQVHREFQLALQRSFIHLVKSIP 337
           Q++PFLK+SR+     ++K +K   + E +  L+RS ++ + SIP
Sbjct: 297 QRNPFLKISRLISANNDNKVSKSVANTEIRKYLKRSLLNFIHSIP 341

>TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838
           YML114C
          Length = 614

 Score =  255 bits (651), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 142/366 (38%), Positives = 225/366 (61%), Gaps = 18/366 (4%)

Query: 4   YIQITKLPTLQELQHEDREPNVVKVLAKSVALQLKPMN--AQITQFAFDRLLQLVDGQLN 61
           Y+Q+TKLPTL E ++ED +  +  +LAK++ALQLK MN    IT+FAF  L  LVD QL+
Sbjct: 45  YVQLTKLPTLTEFKYEDTKGPMEVILAKAIALQLKLMNRDTTITKFAFTHLTSLVDEQLS 104

Query: 62  DMISQLHRMSNLQRRETIAKGDISMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHLHS 121
           DM++Q+ +++ LQRR+ +AK DI + + GFN+ PS + +  + SE+  +KY  E   L+ 
Sbjct: 105 DMVNQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEKYGGEVTLLNR 164

Query: 122 LRDLQSSLAHEMVPFEDQEAVRQNVSTV----LVPPTNPLQDFLPKWLPDFPPDHTYKFT 177
           L    +     +  F+  +   ++ ST+    LVP TN L++ +P WLP FPPD+TYKFT
Sbjct: 165 L---ATDTNEVLTVFKKTDKTLKDDSTLETLKLVPITNTLENIIPDWLPSFPPDYTYKFT 221

Query: 178 PQYSHPITDETTIRRQIVEEAKQSELALSH-LSQKKNPTDDIVNRSQYDS---ELAEQET 233
           PQ++  ITD T IR+++  E K+SE AL H L  +K  T  ++N  ++DS   + A+ E 
Sbjct: 222 PQFNKHITDATVIRKKVAAEGKKSEKALLHLLESEKITTSKLLNLDKFDSDDMDTAKLEM 281

Query: 234 LAIY--GSQLKKRKT---QHPQANSADLLSKLPQTNFSVEEYAHNRIEVARKKVLEFEER 288
            A+Y  GS  +K++T   +  +    D         F +E+Y H RI + R KV ++E++
Sbjct: 282 DALYSGGSCDRKKRTAFFEDEEDRMVDEHGNSTSNKFDIEKYVHKRINIVRNKVKQYEDK 341

Query: 289 QLQSQQDPFLKLSRIAFTQCNDKFTKKQVHREFQLALQRSFIHLVKSIPELERNKLETEE 348
           QL+ Q DPFLK++ +   Q + K +++ ++   +  L+RSF+ L+ SIP L +NK +T E
Sbjct: 342 QLRLQNDPFLKMTALLSEQTDKKVSREVINTNIENVLKRSFLQLINSIPTLNQNKKDTRE 401

Query: 349 KAKEER 354
           +A  E+
Sbjct: 402 RAMVEK 407

>SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 574

 Score =  244 bits (624), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 146/372 (39%), Positives = 227/372 (61%), Gaps = 33/372 (8%)

Query: 5   IQITKLPTLQELQHEDREPNVVKVLAKSVALQLKPMNAQI--TQFAFDRLLQLVDGQLND 62
           I++ KLPTL    H+  E  + K+L+++VA++LKPMN  +  +QFAF+ L+QLV   L+ 
Sbjct: 19  IRLKKLPTLHAAPHDSLEQPMHKILSQAVAIRLKPMNKDVAMSQFAFENLVQLVSENLSF 78

Query: 63  MISQLHRMSNLQRRETIAKGDISMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHL-HS 121
           M++ LHR  ++QRR  I+K D+ +L++G+++S S +  +   S++    + ++ N +   
Sbjct: 79  MLTTLHRFVDIQRRREISKKDLLLLLKGYDLSNSELMRELESSQYIVSNHPEKVNKIAQK 138

Query: 122 LRDLQSSL------------AHEMVPFEDQEAVRQNVSTVLVPPTNPLQDFLPKWLPDFP 169
            ++L+S L            AH    F+D + +       LVPPTN    ++PKWLP+FP
Sbjct: 139 SKELKSKLLKPMTEKELLNSAHSEFFFKDMDILD------LVPPTNKNNQYIPKWLPEFP 192

Query: 170 PDHTYKFTPQYSHPITDETTIRRQIVEEAKQSELALSHLSQKKNPTD-DIVN------RS 222
           PDHTY+FT QY+ P+ DE  +RR++VEE KQSE AL +L +  + T+ D+ N      RS
Sbjct: 193 PDHTYRFTSQYNKPVVDERQLRRKLVEEGKQSERALVNLLKHHDSTNQDLGNNERVEKRS 252

Query: 223 QYDSELAEQETLAIYGSQLKKRKTQHPQANSADLLSKLPQTNFSVEEYAHNRIEVARKKV 282
            Y  E  ++ET  I+G +   RK  H   NS +LL  LP  NFSVEEYA NR+E+AR+KV
Sbjct: 253 LY--EETQEETFLIFGPE---RKKSHTTENSHELLRTLPLKNFSVEEYARNRVEIARRKV 307

Query: 283 LEFEERQLQSQQDPFLKLSRIAFTQCNDKFTKKQVHREFQLALQRSFIHLVKSIPELERN 342
           LE+E+ QL+ Q++PF+K + +         ++K + +E +  LQRS+I L++S+P+L   
Sbjct: 308 LEYEQYQLRLQKNPFIKAANLCSPLKKSTMSRKAIDKELKSMLQRSYIGLLRSVPKLNEV 367

Query: 343 KLETEEKAKEER 354
           K    E A E R
Sbjct: 368 KARERELANERR 379

>Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {ON}
           YML114C (TAF8) - TAF65, subunit of transcription factor
           TFIID [contig 37] FULL
          Length = 551

 Score =  226 bits (577), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 140/357 (39%), Positives = 212/357 (59%), Gaps = 23/357 (6%)

Query: 5   IQITKLPTLQELQHEDREPNVVKVLAKSVALQLKPMNA--QITQFAFDRLLQLVDGQLND 62
           +Q+  LPTL E+   D +  + K+L K++A+QLK +NA   I+Q AF+ L+ LV+  L++
Sbjct: 19  VQLKNLPTLHEIPKADMDDPLKKLLEKAIAIQLKSINADASISQLAFENLIILVEEMLSN 78

Query: 63  MISQLHRMSNLQRRETIAKGDISMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHLHSL 122
           M+  LH+M+N+QRR  I+K D+ +++EG+N+S S + L+   S +   ++ ++   +   
Sbjct: 79  MLMDLHKMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQIKKVE-- 136

Query: 123 RDLQSSLAHEMVPFEDQE----------AVRQNVSTVLVPPTNPLQDFLPKWLPDFPPDH 172
            D +     E  P    E           + ++V T LVPP+      +P+WLPDFPPDH
Sbjct: 137 EDSKYVEKQEHTPLTQNELLSSTHPEFFVLDKDVLT-LVPPSVKDTKHVPRWLPDFPPDH 195

Query: 173 TYKFTPQYSHPITDETTIRRQIVEEAKQSELALSHLS---QKKNPTDDIVNRSQYDSELA 229
           TY+FT QY+ PITDE  ++R++ EEA  SE AL HLS    ++  +  I + + Y  E A
Sbjct: 196 TYRFTAQYNKPITDERLMKRKLAEEANLSEKALIHLSMLSHEEASSGPIDSDTIY--EEA 253

Query: 230 EQETLAIYGSQLKKRKTQHPQANSADLLSKLPQTNFSVEEYAHNRIEVARKKVLEFEERQ 289
           +QET  ++G   KK+     + N  DLL  LPQ NFSVEEYA NR+E+AR++V E+E  Q
Sbjct: 254 QQETQLLFGPVKKKKTAAINEVN--DLLRTLPQQNFSVEEYARNRVEIARRRVNEYERHQ 311

Query: 290 LQSQQDPFLKLSRIAFTQCNDKFTKKQVHREFQLALQRSFIHLVKSIPEL-ERNKLE 345
           LQ Q+  F+K + +       + + KQV +E +  L RS I L+KS P L ER K E
Sbjct: 312 LQLQKGAFIKAAHLLSPFSKKRTSCKQVEKEIRTLLHRSRIGLLKSAPSLKERRKRE 368

>NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}
           Anc_8.838 YML114C
          Length = 564

 Score =  226 bits (576), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 134/344 (38%), Positives = 211/344 (61%), Gaps = 23/344 (6%)

Query: 25  VVKVLAKSVALQLKPMNAQITQFAFDRLLQLVDGQLNDMISQLHRMSNLQRRETIAKGDI 84
           V K+L KS+ALQLKP+N +++Q AF+ L  LV+ QL+ +IS+LHRMS +QRR   AK DI
Sbjct: 48  VRKLLNKSIALQLKPLNLELSQLAFNELSLLVNDQLDFLISELHRMSVIQRRNAAAKTDI 107

Query: 85  SMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHL----HSLRDLQSSLAHEMVPFEDQE 140
            +L+ G N++ S +  Q ++S F   K  K+++ L     ++ D   ++A+   P  D  
Sbjct: 108 ELLLRGLNLNMSELHYQLQVSNFMKSKNGKDYDTLIKDSSTIFDSSDTMAN---PGHD-- 162

Query: 141 AVRQNVSTVLVPPTNPLQDFLPKWLPDFPPDHTYKFTPQYSHPITDETTIRRQIVEEAKQ 200
           ++  N S +L+ P NP +  +P WLP FPPDHTYKFTPQ++ PITD+  I+++++EE K+
Sbjct: 163 SMVNNPSNILIKPNNPFEISIPNWLPAFPPDHTYKFTPQFNKPITDQVLIKQKLIEEGKK 222

Query: 201 SELALSHLSQKKNPTDDIVNR--SQYDSELAEQETLAIYGSQLKKRKTQHPQ-----ANS 253
           SE +L +L         I N   S +DSELA +E +AIYG     RK + P       ++
Sbjct: 223 SEKSLLNLLNDITEQSSIENEETSNFDSELAREENIAIYGYDAMSRKKRKPPHLISIHDT 282

Query: 254 ADLLSKLPQTN--FSVEEYAHNRIEVARKKVLEFEERQLQSQQDPFLKLSRIAFTQCND- 310
                  PQ +  F+V  YAH R+E+ RK+V EFE  QL+ +++PFL+LSR+     ND 
Sbjct: 283 EQNFFNHPQGSKHFNVGNYAHFRVELTRKRVEEFELEQLKWEKNPFLRLSRM----INDK 338

Query: 311 KFTKKQVHREFQLALQRSFIHLVKSIPELERNKLETEEKAKEER 354
           K ++  +  E + +LQRS+  + ++ P+L++ +    E A+++R
Sbjct: 339 KVSRSDLKLEIKNSLQRSYKSIFRNYPKLKQERDRRLELARQKR 382

>KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 570

 Score =  213 bits (542), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 137/374 (36%), Positives = 217/374 (58%), Gaps = 41/374 (10%)

Query: 5   IQITKLPTLQELQHEDREPNVVKVLAKSVALQLKPMNAQ--ITQFAFDRLLQLVDGQLND 62
           +Q+  LP L+E+     +  + K+L K+VA+QLK +N+   I+QFAF+ L+ LV+  L++
Sbjct: 19  VQLRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQMLSN 78

Query: 63  MISQLHRMSNLQRRETIAKGDISMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHLHSL 122
           M+  LH+M N+QRR  I+K D+ ++++G+N++ + +     + E    +Y +  N L  +
Sbjct: 79  MLVDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADL-----MVELERSQYVRSHN-LERV 132

Query: 123 RDLQSSL----AHEMVPFEDQEA---------VRQNVSTVLVPPTNPLQDFLPKWLPDFP 169
           R ++       A E  P  ++E          ++      LVPPT     ++P+WLP+FP
Sbjct: 133 RKVREESEVVEAKEKTPLSEKELLESKHLEFFIQDKEILTLVPPTPKNTKYVPRWLPEFP 192

Query: 170 PDHTYKFTPQYSHPITDETTIRRQIVEEAKQSELALSHLSQ---KKNP-----TDDIVNR 221
           PDHTY+FT Q++ PITDE  ++R++ EEA  SE AL HLS+   +++P     +D+I   
Sbjct: 193 PDHTYRFTSQFNRPITDERLMKRKLAEEADLSEKALIHLSKLSHEESPSEGADSDEIFKE 252

Query: 222 SQYDSELAEQETLAIYGSQLKKRKTQHPQANSA-DLLSKLPQTNFSVEEYAHNRIEVARK 280
           SQ D++L       I+G     +KT+    N A DLL  LPQ N++VEEYA NR+E+AR+
Sbjct: 253 SQQDTQL-------IFGP---AKKTKIAAINGASDLLRTLPQQNYNVEEYARNRVEIARR 302

Query: 281 KVLEFEERQLQSQQDPFLKLSRIAFTQCNDKFTKKQVHREFQLALQRSFIHLVKSIPELE 340
           KV E+E  QL  Q+  F+K + +  +    K   KQV +E +  L RS+I L+KS P L 
Sbjct: 303 KVEEYERHQLLLQKGAFIKAAHL-LSPFAKKRNCKQVEKEVRTLLHRSYIGLLKSAPLLR 361

Query: 341 RNKLETEEKAKEER 354
             +    E A+E R
Sbjct: 362 EQRKREVELAEENR 375

>Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}
           YML114C (REAL)
          Length = 510

 Score =  210 bits (535), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 129/364 (35%), Positives = 209/364 (57%), Gaps = 30/364 (8%)

Query: 5   IQITKLPTLQELQHEDREPNVVKVLAKSVALQLKPMNAQITQFAFDRLLQLVDGQLNDMI 64
           +Q+ +LP L E+ H + +  VV++L K+V  QL  +N  I+ FA D L+ LV  Q++ M 
Sbjct: 17  VQLRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFALDELVNLVAVQMDGMF 76

Query: 65  SQLHRMSNLQRRETIAKGDISMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHLHSLRD 124
             LH ++ LQRR   ++ D+ +L   FN+  +S+  Q ++SEF    +  E+  L  L  
Sbjct: 77  RNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFIKSNHAVEYGKLVRLSS 136

Query: 125 LQSSLAHEMVPFEDQEAVRQNVS------TVLVPPTNPLQDFLPKWLPDFPPDHTYKFTP 178
              +LAH     ED+E    N+        VL+PP+NPL+  +P WLP+FPPDHTYKFTP
Sbjct: 137 F-PALAHNE---EDEEDELSNIEEQQSEINVLLPPSNPLEKLIPSWLPNFPPDHTYKFTP 192

Query: 179 QYSHPITDETTIRRQIVEEAKQSELA-------LSHLSQKKNPTDDIVNRSQYDSELAEQ 231
           +++HPITD  TI+++IV+E+++SE A       LSHLS   + +   V     D   A +
Sbjct: 193 EFNHPITDLKTIKKEIVKESEESEKALLNLNKRLSHLSSASHTSPPPV----LDDADATE 248

Query: 232 ETLAIYGSQLKKRKTQHPQANSADLLSKLPQTNFSVEEYAHNRIEVARKKVLEFEERQLQ 291
           + L I+G+ L++RK   P   +    + L ++N  +E+YA  R+E+AR++V +FE  QL+
Sbjct: 249 QQLEIWGNALQERK---PTITA----TSLNESN--IEQYAKYRVELARERVAKFELNQLK 299

Query: 292 SQQDPFLKLSRIAFTQCNDKFTKKQVHREFQLALQRSFIHLVKSIPELERNKLETEEKAK 351
             ++PFLKLS   +       + K +     L  ++S    + ++P++++ K E    AK
Sbjct: 300 RTKNPFLKLSETLYFSEGPHQSHKTIQSAIDLQFRKSMTLFMHNLPKVQKLKKERIRMAK 359

Query: 352 EERS 355
           EER+
Sbjct: 360 EERA 363

>ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML114C (TAF65)
          Length = 474

 Score =  209 bits (531), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 125/356 (35%), Positives = 201/356 (56%), Gaps = 38/356 (10%)

Query: 5   IQITKLPTLQELQHEDREPNVVKVLAKSVALQLKPM--NAQITQFAFDRLLQLVDGQLND 62
           IQ+ KLP L E+   +    + K+LA++V L LK M  +  ITQ  F+ L+Q V+ QL+D
Sbjct: 19  IQLKKLPDLTEVTKSN---PMQKLLAQAVGLHLKTMRSDVGITQLGFENLVQFVELQLDD 75

Query: 63  MISQLHRMSNLQRRETIAKGDISMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHLHSL 122
           M+  LHR +N+QRR  ++  D+ + + G       +E +S   E+   +Y ++  H  ++
Sbjct: 76  MLQILHRFANVQRRNEVSLKDVRLFLHG-----CGVEEESLYEEYVRSQYVRQ-QHAGAV 129

Query: 123 RDLQ----SSLAHEMVPFEDQEAVRQNVSTV---------LVPPTNPLQDFLPKWLPDFP 169
           R ++    S + H   P  ++E +  + +           LVPPTN    ++PKWLP+FP
Sbjct: 130 RSIEEQSASLMGHWHQPMSEEELLSSSHAEFFFKDVDILNLVPPTNNNNHYVPKWLPEFP 189

Query: 170 PDHTYKFTPQYSHPITDETTIRRQIVEEAKQSELALSHL--SQKKNPTDDIVNRSQYDSE 227
           PDHTYKFT  Y+ PITDE  ++R++ EE+K SE AL H+  +  K P  D     Q  S+
Sbjct: 190 PDHTYKFTSIYNQPITDERQMKRKLFEESKLSEKALLHMLGTATKKPRADDAQLPQIISD 249

Query: 228 LAEQETLAIYGSQLKKRKTQHPQANSADLLSKLPQTNFSVEEYAHNRIEVARKKVLEFEE 287
             +QE L IYG + ++R    P           P   F++E+YA  R+E+AR++V EFE+
Sbjct: 250 -GQQENLLIYGPE-RRRLAPEPA----------PTRGFNIEDYARCRVELARRRVEEFEQ 297

Query: 288 RQLQSQQDPFLKLSRIAFTQCNDKFTKKQVHREFQLALQRSFIHLVKSIPELERNK 343
           ++LQ Q++PF++ +         + ++K + REF + L RS+I ++ +IP L R K
Sbjct: 298 QKLQVQKNPFIRAAAACSPYATTRLSRKAIEREFGVLLHRSYIGVLHAIPRLRRTK 353

>YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}
           TAF8TFIID subunit (65 kDa), involved in RNA polymerase
           II transcription initiation
          Length = 510

 Score =  208 bits (529), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 126/364 (34%), Positives = 211/364 (57%), Gaps = 30/364 (8%)

Query: 5   IQITKLPTLQELQHEDREPNVVKVLAKSVALQLKPMNAQITQFAFDRLLQLVDGQLNDMI 64
           +Q+  LP L E+ H + +  VV++L K+V  QL  +N  I+ FA D L+ LV  Q++ M 
Sbjct: 17  VQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFALDELVNLVTVQMDGMF 76

Query: 65  SQLHRMSNLQRRETIAKGDISMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHLHSLRD 124
             LH ++ LQRR   ++ D+ +L+  FN+   S+  Q + SEF   K+  E+  L S   
Sbjct: 77  RNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFIKSKHSTEYEKLMSWSS 136

Query: 125 LQSSLAHE-------MVPFEDQEAVRQNVSTVLVPPTNPLQDFLPKWLPDFPPDHTYKFT 177
           L ++L H        +   E+Q    QN   VL+PP+NPL+  +P WLP+FPPDHTYKFT
Sbjct: 137 L-AALPHNEEDEEDELNNIEEQ----QNEINVLLPPSNPLEKQIPSWLPNFPPDHTYKFT 191

Query: 178 PQYSHPITDETTIRRQIVEEAKQSELALSHLSQKKNPTDDIVNRSQ---YDSELAEQETL 234
           P+++HPITD  TI+++IV+E+++SE AL +L++  +      N  Q    D E A ++ L
Sbjct: 192 PEFNHPITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASNTPQPPGLDDEDAIEQQL 251

Query: 235 AIYGSQLKKRKTQHPQANSADLLSKLPQTNF---SVEEYAHNRIEVARKKVLEFEERQLQ 291
            I+G+ L++RK              + + +F   ++E+YA  R+E+AR++V +FE  QL+
Sbjct: 252 EIWGNALEERK------------PTITEKSFNENNIEQYAKYRVELARERVTKFEVNQLK 299

Query: 292 SQQDPFLKLSRIAFTQCNDKFTKKQVHREFQLALQRSFIHLVKSIPELERNKLETEEKAK 351
             ++PFLK+S   +   +   + K + +  +L  ++S    + ++P++++ K E    AK
Sbjct: 300 RTKNPFLKISETLYLPESPHQSHKTIQKTIELQFRKSMTLFMHNLPKVQKLKKEKIRMAK 359

Query: 352 EERS 355
           EER+
Sbjct: 360 EERA 363

>Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}
           YML114C (REAL)
          Length = 509

 Score =  205 bits (521), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 127/361 (35%), Positives = 210/361 (58%), Gaps = 27/361 (7%)

Query: 5   IQITKLPTLQELQHEDREPNVVKVLAKSVALQLKPMNAQITQFAFDRLLQLVDGQLNDMI 64
           +Q+T LP L E+ H + +  V+++L KSV  QL  +N  I+ FA D ++ LV  Q++ M 
Sbjct: 17  VQLTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSLNICISNFALDEMVNLVAVQMDGMF 76

Query: 65  SQLHRMSNLQRRETIAKGDISMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHLHSLRD 124
             LH ++ LQRR  +++ D+ +L   FN++ +S+  Q +ISE    K+  E+  L     
Sbjct: 77  RNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQISEHIKSKHSVEYEKLVKSSS 136

Query: 125 LQSSLAHEMVPFEDQEAV---RQNVSTVLVPPTNPLQDFLPKWLPDFPPDHTYKFTPQYS 181
             ++++H     ED+      +QN   VL+PP+NPL+  +P WLP+FPPDHTYKFTP+++
Sbjct: 137 F-TAVSHIEDDEEDEINNIEEQQNEINVLLPPSNPLEKLIPSWLPNFPPDHTYKFTPEFN 195

Query: 182 HPITDETTIRRQIVEEAKQSELALSHLSQK--------KNPTDDIVNRSQYDSELAEQET 233
           HPITD  TI+R+IV+E+ +SE AL +L+++          P+  + + S         E 
Sbjct: 196 HPITDLKTIKREIVKESGESERALLNLNKRLFRISSASHTPSPRLPDASDAS------ER 249

Query: 234 LAIYGSQLKKRKTQHPQANSADLLSKLPQTNFSVEEYAHNRIEVARKKVLEFEERQLQSQ 293
           L I+G+ L +RK        A +     + N  +E+YA  RIE+AR++V +FE  QL+  
Sbjct: 250 LEIWGNTLHERK-------PAIIAKSFNEKN--IEQYAKYRIELARERVSKFEVNQLKRT 300

Query: 294 QDPFLKLSRIAFTQCNDKFTKKQVHREFQLALQRSFIHLVKSIPELERNKLETEEKAKEE 353
           ++PFLK+S   ++  N   + K + R   L L++S    + ++P++++ K E  + AKEE
Sbjct: 301 KNPFLKISESLYSFKNPHQSHKVIQRSIDLQLRKSVTLFMHNLPKVQKLKKEKIQLAKEE 360

Query: 354 R 354
           R
Sbjct: 361 R 361

>Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar to
           Ashbya gossypii ABL128W
          Length = 520

 Score =  203 bits (517), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 135/363 (37%), Positives = 206/363 (56%), Gaps = 38/363 (10%)

Query: 4   YIQITKLPTLQELQHEDREPNVVKVLAKSVALQLKPMNA--QITQFAFDRLLQLVDGQLN 61
           +IQ+ KLP LQE+   +  P  + +L++SVALQLK M +   IT+  F+ ++Q ++ Q+N
Sbjct: 18  FIQLKKLPGLQEVAKHN--PMQI-LLSQSVALQLKTMKSDFSITELGFNNMMQFIEMQMN 74

Query: 62  DMISQLHRMSNLQRRETIAKGDISMLMEGFNISPSSIELQSRISEFYSQKYFK-----EF 116
           DM   LHR +N+QRR  I+  D+ + ++G     + IE+QS   EF   +Y K     EF
Sbjct: 75  DMFQILHRFANIQRRNEISIKDLKLFLKG-----TGIEVQSLYDEFEKSRYIKKTYEAEF 129

Query: 117 NHLHSLRDLQSSLAHEMVPFEDQEAVRQNVSTV---------LVPPTNPLQDFLPKWLPD 167
            ++   R     +     P  D+E +  N +           LVPPTN    ++P WLP+
Sbjct: 130 KNIE--RQSLDLVEKWQKPLRDEELLSSNHAEFFFKDVDILNLVPPTNINNSYVPTWLPE 187

Query: 168 FPPDHTYKFTPQYSHPITDETTIRRQIVEEAKQSELALSHL----SQKKNPTDDIVNRSQ 223
           FPPDHTYKFT  Y+ PI+DE  ++R + EE K SE AL ++      K    +D    +Q
Sbjct: 188 FPPDHTYKFTAIYNKPISDERQMKRMLFEEGKLSEKALLNMLGSAQAKMLKVEDEETIAQ 247

Query: 224 YDSELAEQETLAIYG--SQLKKRKTQHPQANSA---DL-LSKLPQTNFSVEEYAHNRIEV 277
              E +++ET  IYG   Q  +R+  +   NS    DL L+      F+++EYA +RI +
Sbjct: 248 TYKE-SQEETQLIYGVEKQRPRRENAYVGGNSTNNDDLPLNSSHSKGFNIQEYARSRIGL 306

Query: 278 ARKKVLEFEERQLQSQQDPFLKLSRIAFTQCN-DKFTKKQVHREFQLALQRSFIHLVKSI 336
           AR+KV EFE  +LQ+Q++PF++ S I     N  K T+K   REF + L+RS++ ++KSI
Sbjct: 307 ARRKVEEFENHKLQAQKNPFIRASSICSPYGNAQKTTRKAAEREFNILLRRSYVGVLKSI 366

Query: 337 PEL 339
           P+L
Sbjct: 367 PKL 369

>Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}
           YML114C (REAL)
          Length = 514

 Score =  197 bits (501), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 125/365 (34%), Positives = 209/365 (57%), Gaps = 32/365 (8%)

Query: 5   IQITKLPTLQELQHEDREPNVVKVLAKSVALQLKPMNAQITQFAFDRLLQLVDGQLNDMI 64
           +Q+  LP L E+ H   +  VV++L K+V  QL  ++  I+ FA D L+ LV  Q++ M 
Sbjct: 17  VQLKNLPDLTEISHLKIDAPVVEILRKTVLFQLNSLDICISNFALDELVNLVAVQMDGMF 76

Query: 65  SQLHRMSNLQRRETIAKGDISMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHL----- 119
             LH ++ LQRR    + D+ +L + FN+ P+S+  Q +ISEF    +  E+  L     
Sbjct: 77  RNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQQLQISEFIKSNHSVEYEKLVSSSS 136

Query: 120 -----HSLRDLQSSLAHEMVPFEDQEAVRQNVSTVLVPPTNPLQDFLPKWLPDFPPDHTY 174
                H+  D +  L +     E+Q    QN  +VL+PP+NPL+  +P WLP+FPPDHTY
Sbjct: 137 FSASSHNEEDEEDELNN----IEEQ----QNEISVLLPPSNPLEKLMPSWLPNFPPDHTY 188

Query: 175 KFTPQYSHPITDETTIRRQIVEEAKQSELALSHLSQK----KNPTDDIVNRSQYDSELAE 230
           +FTP+++HPITD  TI+R+IV+E+K+SE AL +L+++       +     R   D++  E
Sbjct: 189 RFTPEFNHPITDLKTIKREIVKESKESEKALLNLNKRLLHISLASHAPPPRLPDDADAGE 248

Query: 231 QETLAIYGSQLKKRKTQHPQANSADLLSKLPQTNFSVEEYAHNRIEVARKKVLEFEERQL 290
           Q+ L I+G+ L++ K           +SK    N ++E+YA  R+E+AR++V +FE  QL
Sbjct: 249 QQ-LEIWGNALQEEKRT--------AISKSFNEN-NIEQYAKYRVELARERVSKFEVNQL 298

Query: 291 QSQQDPFLKLSRIAFTQCNDKFTKKQVHREFQLALQRSFIHLVKSIPELERNKLETEEKA 350
           +  ++PFL++S   ++  +     + + R   L  ++S +    ++P++++ K E    A
Sbjct: 299 KRTKNPFLRISETLYSSKSPHQPHRAIQRAIDLQFRKSMMLFAHNLPKVQKLKKEKIRMA 358

Query: 351 KEERS 355
            EERS
Sbjct: 359 IEERS 363

>TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.838
           YML114C
          Length = 683

 Score =  196 bits (498), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 146/425 (34%), Positives = 208/425 (48%), Gaps = 98/425 (23%)

Query: 25  VVKVLAKSVALQLKPMN--AQITQFAFDRLLQLVDGQLNDMISQLHRMSNLQRRETIAKG 82
           + ++LAKS+ALQLKPMN    I+  AF+RLL LVD QLNDMI QL R+S  QRR TIA  
Sbjct: 60  IGQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMIYQLARLSITQRRLTIASN 119

Query: 83  DISMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHLHSL-RDLQSSLAHEMV-PFEDQE 140
           D+S+ +  FN++PS + L    S F   K+ K++N L+ L RD  +   H    P     
Sbjct: 120 DLSLWLRSFNLNPSDLTLYLEESNFIKSKFNKDYNLLYELLRDYNTETNHNFKNPNYSTS 179

Query: 141 AVRQNVSTV-----LVPPTNPLQDFLPKWLPDFPPDHTYKFTPQYSHPITDETTIRRQIV 195
            +  N S+      +VPP+N +   +P+WLP  PPDHTYKFTP Y+ PITDET +++ +V
Sbjct: 180 DLLNNKSSESSSSRIVPPSNTILRSMPEWLPSLPPDHTYKFTPLYNEPITDETVMKKILV 239

Query: 196 EEAKQSELALSHLSQKKN-------PT------DDI------------------------ 218
            E K +E AL  L +          PT      +D+                        
Sbjct: 240 NEGKLAESALIKLLEASTTSEINSLPTPETDRENDLEQNINIDTNTNGNSMTLKSVSENE 299

Query: 219 ---VNRSQYDSELAEQETLAIYGSQLKKRKTQH-------PQANSADLLSK---LPQTNF 265
               N    D  LA+ ET AIYGS L+ RK +        P+A +   LS+    P T F
Sbjct: 300 KTNTNERLNDELLAQDETKAIYGSALQVRKIKKRFELMIDPKAETQ--LSEEFVYPST-F 356

Query: 266 SVEEYAHNRIEVARKKVLEFEERQLQSQQDPFLKLSRIAFTQCN---------------- 309
           +VEEYA  +++  R++VL +EE+QLQ+Q++PF K S++                      
Sbjct: 357 NVEEYARKQVQKIREQVLFYEEKQLQAQKNPFWKYSKMIVGPSQFHHGPHHHHHHHHHHH 416

Query: 310 --------------------DKFTKKQVHREFQLALQRSFIHLVKSIPELERNKLETEEK 349
                                  +KKQ++ + Q    RS  +L+ S+P L + K    E 
Sbjct: 417 RRYSNSSTSSVSSSPSPGLFGGVSKKQINHDIQQMFNRSLNNLINSLPNLAKEKASAREI 476

Query: 350 AKEER 354
           A+ ER
Sbjct: 477 AENER 481

>NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}
           Anc_8.838 YML114C
          Length = 664

 Score =  186 bits (473), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 130/444 (29%), Positives = 212/444 (47%), Gaps = 109/444 (24%)

Query: 14  QELQHEDREPNVVKVLAKSVALQLKPMNAQITQFAFDRLLQLVDGQLNDMISQLHRMSNL 73
           +E+ H   +  + K+L KS+A+QLK      ++ AF++L  LVD QLN +I++LHR+S L
Sbjct: 19  REIAHNHMDMQIEKLLQKSIAIQLKAFKVDFSKLAFNQLTLLVDDQLNSLITELHRLSLL 78

Query: 74  QRRETIAKGDISMLMEGFNISPSSIELQSRISEFYSQKY-FKEFNHLHSLRDLQSSLAHE 132
           QRR ++AK D+ + M GFNI+PS +  Q   S++  +K   KE+     LRDL   +  +
Sbjct: 79  QRRNSMAKVDLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEY---RILRDLNEEVVKQ 135

Query: 133 MVPFEDQEAVRQNV---------------STVLVPPTNPLQDF-LPKWLPDFPPDHTYKF 176
                +      N                S +L+ PTNP +   +  WLP FPPDHTYKF
Sbjct: 136 RTHIMESSTSDDNYDLTKQFRNISDATDSSNILIKPTNPFKGINISSWLPSFPPDHTYKF 195

Query: 177 TPQYSHPITDETTIRRQIVEEAKQSELA----LSHLSQKKNPT----------------- 215
           TPQ+++PITDE  I++++VEE  +SE A    L ++S  K  T                 
Sbjct: 196 TPQFNNPITDEKLIKQKLVEEGTKSEKALLNFLKNISNAKKGTSIAPMTIPPSPSLSNEG 255

Query: 216 ---------------------DDIVNRSQYDSELAEQETLAIYGSQLKKRKTQHPQANSA 254
                                D ++     D  LA +ETLAIYG++ +  + +   ++  
Sbjct: 256 PITDTDEEEKQAKNEKEKEQEDTVIIPKDIDMNLANEETLAIYGTKSQSYEIERDSSSKP 315

Query: 255 DLLS------------KLPQTNFSVEEYAHNRIEVARKKVLEFEERQLQSQQDPFLKLSR 302
           +++S                  F V +Y+H+R+E+ RKKV  FE ++L+ +++PFLKLS+
Sbjct: 316 NIISIHDEKIVNFFGHSSSDKKFDVNKYSHHRVELVRKKVEAFENKKLRLEKNPFLKLSK 375

Query: 303 IAFTQCNDKFT--------------------------------KKQVHREFQLALQRSFI 330
           +    C +K                                  + Q++ E    L+RSF 
Sbjct: 376 LV---CLEKEDYYDYDNDEDDLEERKNYNNNNDNDNRLSPIRKRAQINNEIISNLKRSFY 432

Query: 331 HLVKSIPELERNKLETEEKAKEER 354
            ++ + P+L++ K +  + A E+R
Sbjct: 433 SILNNYPKLKKAKKQRVKLAIEKR 456

>KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.838
           YML114C
          Length = 453

 Score =  179 bits (455), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 121/338 (35%), Positives = 185/338 (54%), Gaps = 32/338 (9%)

Query: 23  PNVVKVLAKSVALQLKPMN--AQITQFAFDRLLQLVDGQLNDMISQLHRMSNLQRRETIA 80
           P +  +L KSVA++LKP+N   Q+   AFD L+ L+D QLND+I QL R+S LQRR + A
Sbjct: 24  PQLDNLLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRLSLLQRRNSNA 83

Query: 81  -KGDISMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHLHSLRDLQSSLAHEMVPFEDQ 139
            K DI +L++GFN+S S +  +  IS    + Y ++          +  L+ + + +   
Sbjct: 84  TKSDILLLLKGFNLSESELNTELEISNHIKRLYSED----------EKKLSEDSIHYNQH 133

Query: 140 EAVRQNVSTV---LVPPTNPLQDFLPKWLPDFPPDHTYKFTPQYSHPITDETTIRRQIVE 196
                 V T    L+ PTNPL+D +P W P  PPDHTYKFTP+Y++ I D   I+++  +
Sbjct: 134 TDFVGPVETSSFQLLNPTNPLKDAIPSWFPSLPPDHTYKFTPKYNNFINDPKIIKQKRFD 193

Query: 197 EAKQSELALSHLSQKKNPTDDIVNRSQYDSELAEQETLAIYGSQLKKRKTQHPQANSADL 256
           E+K  + AL +L  K    ++  N   YD  LA+ E+ A++G+  +K  T      S + 
Sbjct: 194 ESKTVKTALFNLINKIESNEE-RNDLHYDETLAKLESQALFGTVEEKMNTNKKVYKSLNS 252

Query: 257 LSKLPQTNFSVEEYAHNRIEVARKKVLEFEERQLQSQQDPFLKLSRIAFTQCNDKFTKKQ 316
           +  +P T F +EEY+H R+ +AR KV +FE + L  + +PF+ L        ND+   K 
Sbjct: 253 II-VPITKFDIEEYSHKRVNIARNKVSKFENKMLALKYNPFINL-------INDQTDVKS 304

Query: 317 VHREFQLALQRSFIHLVKSIPELERNKLETEEKAKEER 354
                   L RSF  ++ SIPEL   K +   +A+ ER
Sbjct: 305 Y-------LNRSFQLMINSIPELTLEKKKAIRQAEIER 335

>KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 562

 Score =  134 bits (338), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 108/381 (28%), Positives = 197/381 (51%), Gaps = 41/381 (10%)

Query: 5   IQITKLPTLQELQHEDREPNVVKVLAKSVALQLKPMNAQ--ITQFAFDRLLQLVDGQLND 62
           +++ KLP L E+ H +    + ++ A++V LQLK +N    I+Q AFD L  +   QL+D
Sbjct: 21  VRLDKLPNLNEVPHANP---MERLFAQAVLLQLKTLNKNVVISQLAFDDLCYVSLLQLDD 77

Query: 63  MISQLHRMSNLQRRETIAKGDISMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHLHS- 121
           ++  L +++ +QRR  I+K D+++  +G  +    +  Q  IS F   K+  E N L+  
Sbjct: 78  LLQSLKKITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEISNFVHGKFKDEANALNET 137

Query: 122 --------LRDLQSSLAHEMVPFEDQEAVRQNVSTV-LVPPTNPLQDFLPKWLPDFPPDH 172
                   +++L+     E++  +  E   Q+V  + L+P +N    ++P WLP+ PPDH
Sbjct: 138 VLKVKQQFMKELEEK---ELLSSKHSEFFVQDVDILNLLPSSNKSNKYVPSWLPELPPDH 194

Query: 173 TYKFTPQYSHPITDETTIRRQIVEEAKQSELALSHLSQKKNPTDDIVNRSQYDSELAEQE 232
           TYKFT  Y  PITDE  ++++++EE + SE AL ++  +    D +V  ++   + A   
Sbjct: 195 TYKFTSLYKRPITDERLMKKKLLEEGRLSEKALLNMLSQVVNQDPLVALNKDSDQSANNA 254

Query: 233 TLA--IYGSQLKKRKTQHP--------QANSADLLSKL------PQTNFSVEEYAHNRIE 276
            L+  I  SQL+      P        +  +  +L  +      P  NF+V EY   R  
Sbjct: 255 ALSEHIKESQLETDLIFDPHKTIPTDKEWGTTTVLHGIESFNLSPVKNFNVLEYCKKRDA 314

Query: 277 VARKKVLEFEERQLQSQQDPFLKLSRIA--FTQCNDKFTKKQVHREFQLALQRSFIHLVK 334
           + +++    E +    +++PF++ + I   + Q + K ++K V  + +  L+RS++ L+ 
Sbjct: 315 IVKRRAERAENQVSNKRRNPFIRGAMICSPYGQGSTK-SRKSVENQLKTMLRRSYLGLID 373

Query: 335 SIPEL----ERNKLETEEKAK 351
           SIP +    ER + E EE+ +
Sbjct: 374 SIPRVKEVRERARKEAEERER 394

>CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some
           similarities with uniprot|Q03750 Saccharomyces
           cerevisiae YML114c TAF65 TBP Associated Factor
          Length = 643

 Score =  111 bits (278), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 67/211 (31%), Positives = 112/211 (53%), Gaps = 33/211 (15%)

Query: 28  VLAKSVALQLKPMN--AQITQFAFDRLLQLVDGQLNDMISQLHRMSNLQRRETIAKGDIS 85
           +L ++V +QL+ ++    +T+ A D+L+   + QLN ++  LHR+S LQRR++IA  D+ 
Sbjct: 37  LLKRAVGVQLQTIDKDVTVTRMAMDQLVLFAEDQLNALVDGLHRISLLQRRQSIAVSDLE 96

Query: 86  MLMEGFNISPSSIELQSRISEFYSQKYFKE----FNHLHSLRDLQSSLA----------- 130
           + M G+N+ PS + + +  S+F  + Y  +    F  ++    ++S+L            
Sbjct: 97  IWMRGYNLLPSDLYMTAEESKFIRENYRNDTSVVFKDINIDNPMESALGRINIQNKENIE 156

Query: 131 -------------HEMVPFEDQEAVRQNVSTVLVPPTNPLQDFLPKWLPDFPPDHTYKFT 177
                        +E++  + Q A+ Q   T      N    + P WLPDFPPDHTYK+T
Sbjct: 157 PTDNDVDIDEDDDYELIELQ-QHAMEQLFKTDTGRGRNLR--YKPGWLPDFPPDHTYKYT 213

Query: 178 PQYSHPITDETTIRRQIVEEAKQSELALSHL 208
           P Y + +  ET IR+++VEE + SE AL  L
Sbjct: 214 PSYVNVVKPETEIRQKLVEEGRLSEKALVKL 244

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 51/89 (57%), Gaps = 5/89 (5%)

Query: 264 NFSVEEYAHNRIEVARKKVLEFEERQLQSQQDPFLKLSRIAFTQCNDKFTKKQVHREFQL 323
           +F VE YA  RIE+AR+KV++FE  QL  + +P L+L+++ +    +         E+Q 
Sbjct: 397 DFDVEAYARQRIEIARRKVVDFEYEQLYLKYNPLLRLAKMKYYDAEE----SDFETEYQK 452

Query: 324 ALQRSFIHLVKSIPEL-ERNKLETEEKAK 351
            ++R+     ++IP + E+ K+  +E  K
Sbjct: 453 CIKRTMDRFKRNIPIIKEKRKMVRKESIK 481

>KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.838
           YML114C
          Length = 526

 Score =  103 bits (258), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 98/361 (27%), Positives = 175/361 (48%), Gaps = 38/361 (10%)

Query: 15  ELQHEDREPNVVKVLAKSVALQLKPMNAQITQFA--------FDRLLQLVDGQLNDMISQ 66
           EL HE  +  V ++LA SVA Q+    A+             F  LLQLV+ QL+ M+++
Sbjct: 25  ELPHEPWDARVDQMLANSVAFQMSAGLARGGGGGGVGMAGQAFQLLLQLVEEQLSGMVTE 84

Query: 67  LHRMSNLQRRETIAKGDISMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHLHSLRDLQ 126
           LHR++ +QRR+     D+++L++GF ++P  IE Q  +S+         +N +   R+  
Sbjct: 85  LHRIATVQRRQHATHDDVALLLQGFQLTPEDIEEQMYLSKKIG------YNRMQVPREQT 138

Query: 127 SSLAHEMVPF------EDQEAVRQNVSTVLVPPTNPLQDFLPKWLPDFPPDHTYKFTPQY 180
             L      +      E+Q+ +   +S   +    P+ + +P WLP  PP+HTYKFT +Y
Sbjct: 139 VQLQDATGSYDRFKLVENQQLIASGLSGSDMSQELPIAEKIPAWLPKLPPNHTYKFTTEY 198

Query: 181 SHPITDETTIRRQIVEEAKQSELALSHLSQKKNPTDDIV----NRSQYDSELA--EQETL 234
           +  + DE  ++ +I++E+ + E++LS+L +  +   D       R     EL   + E +
Sbjct: 199 NKLLNDEKVLKEKIIKESMEIEVSLSNLVRNCDRDADTKVDERARETPPEELKRIDDEIV 258

Query: 235 AIYGSQLKKRKTQHPQANSADLLSKLPQTNFSVEEYAHNRIEVARKKVLEFEERQLQSQQ 294
           A+YG  L++   +H    +        + +F V+ Y+  R+++AR  V  FE       +
Sbjct: 259 ALYGP-LEEIAERHEGPRTKRRTPLYLKKSFDVQAYSLGRVKLARNAVQRFEWETKYRPR 317

Query: 295 DPFLKLSRIAFTQCNDKFTKKQVHREFQLALQRSFIHLVK-SIPELERNKLETEEKAKEE 353
           +PFL         C+ +   +   + + + L+ S   LV+  +P LE  K      A E+
Sbjct: 318 NPFL---------CSHRAVPENSKKVYSM-LENSLNELVQVDLPRLESRKAAAIAHAVEQ 367

Query: 354 R 354
           R
Sbjct: 368 R 368

>ZYRO0G17204g Chr7 (1419895..1421001) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P32288 Saccharomyces cerevisiae
           YPR035W GLN1 Glutamine synthetase (GS) synthesizes
           glutamine from glutamate and ammonia with Glt1p forms
           the secondary pathway for glutamate biosynthesis from
           ammonia expression regulated by nitrogen source and by
           amino acid limitation
          Length = 368

 Score = 34.7 bits (78), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 45/98 (45%), Gaps = 12/98 (12%)

Query: 231 QETLAIYGSQLKKRKT-QHPQANSADLLSKLPQTNFSVEEYAHNRI--EVARKKVLEFEE 287
           +E + +YG+    R T +H  A+++   S +     S+      RI   VA++    FE+
Sbjct: 277 KEHIKLYGTDNDMRLTGRHETASASSFSSGVANRGASI------RIPRSVAKEGFGYFED 330

Query: 288 RQLQSQQDPFLKLSRIAFTQCN---DKFTKKQVHREFQ 322
           R+  S  DP+L    I  T C    D    K+  REFQ
Sbjct: 331 RRPASNIDPYLVTGIICETVCGSIDDANMTKEYEREFQ 368

>Kwal_47.18151 s47 (709368..710612) [1245 bp, 414 aa] {ON} YIL042C -
           Hypothetical ORF [contig 197] FULL
          Length = 414

 Score = 34.3 bits (77), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 42/86 (48%), Gaps = 20/86 (23%)

Query: 108 YSQKYFKEFNHLHSLRDLQ-----SSLAHEM--VPFEDQEAVRQNVSTVLVPPTNPLQDF 160
           Y++K F   N LH+LR LQ     SSL   +  V FE+   +R N   ++       QDF
Sbjct: 19  YTRKAFH--NGLHTLRPLQKVHGKSSLREMLREVGFEELYRIRSNTELLI-------QDF 69

Query: 161 LPKWLPDFPPDHTYKFTPQYSHPITD 186
             K +P      +Y+F  QY  P+TD
Sbjct: 70  AKKPIPAI----SYEFLTQYKVPLTD 91

>Kpol_1070.20 s1070 complement(46652..48541) [1890 bp, 629 aa] {ON}
           complement(46652..48541) [1890 nt, 630 aa]
          Length = 629

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 42/83 (50%), Gaps = 5/83 (6%)

Query: 134 VPFEDQEAVRQNVSTVLVPPTNPLQDF-LPKWLPDFPPDHTYKFTPQYSHPI-TDETTIR 191
           VP E++  + QN+ST+    +  LQDF  P    D  P H  K    Y + + TDE+ + 
Sbjct: 254 VPGEEEAWISQNISTLAQLESKTLQDFEFPNAERDILPFHQVK---HYENLLTTDESELE 310

Query: 192 RQIVEEAKQSELALSHLSQKKNP 214
            ++V   K +E  +  L+Q  +P
Sbjct: 311 SELVNALKLTEREIEFLAQYISP 333

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.129    0.352 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,578,238
Number of extensions: 1748746
Number of successful extensions: 6734
Number of sequences better than 10.0: 97
Number of HSP's gapped: 6938
Number of HSP's successfully gapped: 105
Length of query: 507
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 393
Effective length of database: 40,409,475
Effective search space: 15880923675
Effective search space used: 15880923675
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)