Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0G14124g8.837ON36936914120.0
SAKL0D01540g8.837ON3653799381e-125
NCAS0C004308.837ON3693869071e-120
TDEL0B006008.837ON3692568821e-116
Skud_13.4488.837ON3643788451e-111
CAGL0M02937g8.837ON3732588221e-107
Kpol_1068.118.837ON3812548001e-104
KNAG0J002908.837ON3673787961e-103
KAFR0B039008.837ON3792707841e-101
Smik_13.4898.837ON3722587702e-99
NDAI0K004408.837ON4042627619e-98
Suva_13.4648.837ON3662587501e-96
TPHA0I002208.837ON3772587493e-96
YMR276W (DSK2)8.837ON3732587336e-94
KLLA0D01859g8.837ON3712587214e-92
TBLA0D032308.837ON3752507145e-91
Kwal_27.102758.837ON3792717138e-91
KLTH0C03938g8.837ON3762487111e-90
Ecym_46088.837ON4062537027e-89
ABL129W8.837ON3452496961e-88
TBLA0B032408.837ON2842531733e-13
KLTH0G12540g8.311ON77691121e-06
TDEL0G017504.16ON77541041e-05
CAGL0B01589g8.311ON77561041e-05
NCAS0B035208.311ON77711032e-05
NDAI0H002704.16ON77541032e-05
SAKL0H15818g8.311ON77561022e-05
KLLA0F17974g8.311ON77591022e-05
Suva_10.32singletonON62541003e-05
SAKL0E14894g5.701ON128581053e-05
Kwal_YGOB_Anc_5.7015.701ON128581053e-05
ZYRO0G06622g5.701ON128581053e-05
Smik_9.215.701ON124581043e-05
KLTH0E01078g5.701ON128581043e-05
Skud_9.205.701ON125581043e-05
Smik_11.3575.701ON125581043e-05
Kpol_1043.695.701ON128581043e-05
KLLA0A00616g5.701ON128581043e-05
TPHA0E002405.701ON128581043e-05
TPHA0D046005.701ON128581043e-05
TBLA0E021105.701ON128581043e-05
CAGL0G02475g5.701ON128581043e-05
KAFR0D022305.701ON128581044e-05
KAFR0H002205.701ON128581044e-05
Suva_11.3305.701ON128581044e-05
Skud_11.3335.701ON128581044e-05
YIL148W (RPL40A)5.701ON128581044e-05
YKR094C (RPL40B)5.701ON128581044e-05
AFR285C5.701ON128581044e-05
KNAG0L021205.701ON128581044e-05
Ecym_40195.701ON128581044e-05
NDAI0E050305.701ON128581044e-05
NCAS0A032105.701ON128581044e-05
NCAS0G002405.701ON128581044e-05
TDEL0B022005.701ON128581044e-05
Kpol_1036.628.311ON7769987e-05
KLTH0C03410g1.480ON391531088e-05
Suva_9.405.701ON144581028e-05
Kwal_27.101521.480ON381471088e-05
Ecym_84084.16ON153581029e-05
TPHA0K022504.16ON153581029e-05
KNAG0J028804.16ON153581029e-05
KNAG0C065805.701ON149581021e-04
TDEL0F043808.311ON7771961e-04
Suva_10.34singletonON151581011e-04
ZYRO0C04026g8.386ON152581011e-04
TPHA0C023908.386ON150581011e-04
NCAS0C029408.386ON152581011e-04
AGL128W8.386ON152581011e-04
Ecym_41818.386ON152581012e-04
Kwal_23.33118.386ON150581012e-04
KLTH0F08734g8.386ON150581012e-04
SAKL0H13926g8.386ON154581012e-04
KLLA0D18304g8.386ON150581002e-04
TPHA0C008908.311ON7771962e-04
NDAI0J010708.311ON7756962e-04
KAFR0H020008.386ON152581002e-04
YLR167W (RPS31)8.386ON152581002e-04
NDAI0G022808.386ON152581002e-04
TBLA0G006704.16ON229581022e-04
NDAI0D049304.16ON229581022e-04
KAFR0I014704.16ON229581022e-04
ZYRO0D05962g8.311ON7756952e-04
Kwal_55.206074.16ON231581022e-04
TDEL0F051008.386ON15058992e-04
KLTH0E05852g4.16ON409581042e-04
KNAG0A027308.386ON15058992e-04
CAGL0G08173g8.386ON15258992e-04
Kpol_1030.58.386ON15258992e-04
Kpol_1024.168.386ON15258992e-04
Suva_10.33singletonON254581023e-04
Suva_10.2668.386ON15258993e-04
Skud_12.2348.386ON15258993e-04
Smik_12.2298.386ON15258993e-04
SAKL0H25784g4.16ON305581023e-04
KAFR0C030008.142ON397491033e-04
NDAI0F003005.701ON187581003e-04
TBLA0H031808.386ON15258983e-04
Skud_12.294.16ON381581024e-04
YLL039C (UBI4)4.16ON381581024e-04
Suva_10.304.16ON381581024e-04
ACL062C4.16ON382581024e-04
SAKL0D11814g1.480ON400671024e-04
KLLA0E00749g4.16ON381581024e-04
NCAS0C058504.16ON388581024e-04
Smik_12.184.16ON460581024e-04
Kpol_1070.64.16ON533581034e-04
ZYRO0G07854g4.16ON460581024e-04
CAGL0D05082g4.16ON533581024e-04
KLLA0E22133g1.480ON38358999e-04
Ecym_35721.480ON44367970.002
AFR358W1.480ON41367950.003
ZYRO0F05192g1.480ON38458950.003
KAFR0E005301.480ON37961920.007
YDR139C (RUB1)8.311ON7771840.008
Suva_5.321.480ON40958920.008
CAGL0L06028g8.142ON50538910.009
NDAI0G003301.480ON42758910.011
Skud_5.531.480ON39758900.011
CAGL0L01309g1.480ON39267900.013
TDEL0C025901.480ON36858900.013
SAKL0H24772g8.142ON41443890.017
NDAI0B01850singletonON40344880.022
Smik_5.561.480ON39758880.023
TPHA0O004401.480ON36959880.023
YEL037C (RAD23)1.480ON39858870.026
TBLA0B021601.480ON40462870.027
TDEL0B046908.142ON44238870.030
NCAS0G041201.480ON39258850.053
TBLA0D022108.142ON56338850.053
Kpol_370.61.480ON40458850.054
NCAS0B045908.142ON44738840.061
Smik_7.918.142ON39938800.23
Kwal_56.238838.311ON5247710.26
KAFR0I027801.480ON21445780.26
YGL181W (GTS1)8.142ON39638790.28
Ecym_42448.311ON5034680.54
Suva_7.818.142ON40138750.79
NCAS0C040908.142ON39653750.80
Suva_15.2475.324ON29774750.81
ZYRO0D08140g6.343ON7371680.85
AGL185W8.311ON5035670.87
KLLA0C08470g6.343ON7451680.95
KLTH0G11132g2.317ON133940741.3
KNAG0G005101.480ON37563721.8
Kpol_541.508.142ON51138722.1
TPHA0H004008.142ON46638712.4
TBLA0C012001.369ON50347686.7
Kpol_1018.695.617ON59049677.6
Skud_7.908.142ON39638678.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0G14124g
         (369 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} simi...   548   0.0  
SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {...   365   e-125
NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}...   353   e-120
TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {O...   344   e-116
Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276...   330   e-111
CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highl...   321   e-107
Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {O...   312   e-104
KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON...   311   e-103
KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.8...   306   e-101
Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276...   301   2e-99
NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {O...   297   9e-98
Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276...   293   1e-96
TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837...   293   3e-96
YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}  DSK2Nucle...   286   6e-94
KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} simila...   282   4e-92
TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {O...   279   5e-91
Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {...   279   8e-91
KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {...   278   1e-90
Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar...   275   7e-89
ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic ho...   272   1e-88
TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.83...    71   3e-13
KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 7...    48   1e-06
TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16 ...    45   1e-05
CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa...    45   1e-05
NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234 ...    44   2e-05
NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON} A...    44   2e-05
SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 7...    44   2e-05
KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 7...    44   2e-05
Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON} Y...    43   3e-05
SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212) ...    45   3e-05
Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128...    45   3e-05
ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128 a...    45   3e-05
Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C (REAL)     45   3e-05
KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128 a...    45   3e-05
Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C (REAL)     45   3e-05
Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa] {O...    45   3e-05
Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa] {...    45   3e-05
KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa] {...    45   3e-05
TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa] {O...    45   3e-05
TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083) [...    45   3e-05
TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387 ...    45   3e-05
CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387...    45   3e-05
KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa...    45   4e-05
KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa] {O...    45   4e-05
Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387...    45   4e-05
Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387...    45   4e-05
YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}  ...    45   4e-05
YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,...    45   4e-05
AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp, ...    45   4e-05
KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387...    45   4e-05
Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}...    45   4e-05
NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634) [...    45   4e-05
NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa...    45   4e-05
NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa] {O...    45   4e-05
TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa...    45   4e-05
Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [23...    42   7e-05
KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa] {...    46   8e-05
Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W (REAL)     44   8e-05
Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa] {...    46   8e-05
Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to...    44   9e-05
TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.1...    44   9e-05
KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.1...    44   9e-05
KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304) [...    44   1e-04
TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234 ...    42   1e-04
Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON} ...    44   1e-04
ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar...    44   1e-04
TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON...    44   1e-04
NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON...    44   1e-04
AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic hom...    44   1e-04
Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON} ...    44   2e-04
Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON...    44   2e-04
KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa] {O...    44   2e-04
SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa] ...    44   2e-04
KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON} simil...    43   2e-04
TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]...    42   2e-04
NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa...    42   2e-04
KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON...    43   2e-04
YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusio...    43   2e-04
NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON...    43   2e-04
TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16...    44   2e-04
NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON}              44   2e-04
KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.70...    44   2e-04
ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa...    41   2e-04
Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa] {O...    44   2e-04
TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.38...    43   2e-04
KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {...    45   2e-04
KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON...    43   2e-04
CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly ...    43   2e-04
Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}...    43   2e-04
Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON...    43   2e-04
Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON} ...    44   3e-04
Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W...    43   3e-04
Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W...    43   3e-04
Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W...    43   3e-04
SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highl...    44   3e-04
KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.1...    44   3e-04
NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701        43   3e-04
TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.38...    42   3e-04
Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,...    44   4e-04
YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}  U...    44   4e-04
Suva_10.30 Chr10 complement(67747..67841,68061..68288,68558..690...    44   4e-04
ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON} S...    44   4e-04
SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} simila...    44   4e-04
KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON...    44   4e-04
NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON}             44   4e-04
Smik_12.18 Chr12 complement(49088..49552,49091..49552,49091..495...    44   4e-04
Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON...    44   4e-04
ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa] {...    44   4e-04
CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} simila...    44   4e-04
KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]...    43   9e-04
Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa] {O...    42   0.002
AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic ...    41   0.003
ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} simila...    41   0.003
KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa] {O...    40   0.007
YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp, ...    37   0.008
Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON} Y...    40   0.008
CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa] ...    40   0.009
NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}...    40   0.011
Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON} Y...    39   0.011
CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa] ...    39   0.013
TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa] {O...    39   0.013
SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]...    39   0.017
NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {O...    39   0.022
Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON} Y...    39   0.023
TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.48...    39   0.023
YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}  RA...    38   0.026
TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa] {O...    38   0.027
TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.1...    38   0.030
NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON} Anc_1.4...    37   0.053
TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.1...    37   0.053
Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON} (10094..11...    37   0.054
NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {O...    37   0.061
Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]...    35   0.23 
Kwal_56.23883 s56 complement(755602..755760) [159 bp, 52 aa] {ON...    32   0.26 
KAFR0I02780 Chr9 (560687..561331) [645 bp, 214 aa] {ON} Anc_1.48...    35   0.26 
YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protei...    35   0.28 
Ecym_4244 Chr4 complement(507884..508036) [153 bp, 50 aa] {ON} s...    31   0.54 
Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]...    33   0.79 
NCAS0C04090 Chr3 (833393..834583) [1191 bp, 396 aa] {ON} Anc_8.142     33   0.80 
Suva_15.247 Chr15 complement(420607..421500) [894 bp, 297 aa] {O...    33   0.81 
ZYRO0D08140g Chr4 (705216..705437) [222 bp, 73 aa] {ON} similar ...    31   0.85 
AGL185W Chr7 (350325..350477) [153 bp, 50 aa] {ON} Syntenic homo...    30   0.87 
KLLA0C08470g Chr3 (742530..742754) [225 bp, 74 aa] {ON} highly s...    31   0.95 
KLTH0G11132g Chr7 complement(934626..938645) [4020 bp, 1339 aa] ...    33   1.3  
KNAG0G00510 Chr7 complement(85742..86869) [1128 bp, 375 aa] {ON}...    32   1.8  
Kpol_541.50 s541 complement(162130..163665) [1536 bp, 511 aa] {O...    32   2.1  
TPHA0H00400 Chr8 (77122..78522) [1401 bp, 466 aa] {ON} Anc_8.142...    32   2.4  
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    31   6.7  
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    30   7.6  
Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W (...    30   8.6  

>ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 369

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/369 (77%), Positives = 286/369 (77%)

Query: 1   MSTITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQF 60
           MSTITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQF
Sbjct: 1   MSTITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQF 60

Query: 61  YNLQDGHSVHLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTPTTGAPSNLSA 120
           YNLQDGHSVHLV                                   TTPTTGAPSNLSA
Sbjct: 61  YNLQDGHSVHLVKSSKAPGNASGGSSSTAAATAGSGASAVPPSGNASTTPTTGAPSNLSA 120

Query: 121 GQSGGFNPLADLTSARYAGFTSLPSADMFGPDGGATNMPNQEDLLNMLDNPIFQSQMNEM 180
           GQSGGFNPLADLTSARYAGFTSLPSADMFGPDGGATNMPNQEDLLNMLDNPIFQSQMNEM
Sbjct: 121 GQSGGFNPLADLTSARYAGFTSLPSADMFGPDGGATNMPNQEDLLNMLDNPIFQSQMNEM 180

Query: 181 LSNPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMMNPGGGEN 240
           LSNPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMMNPGGGEN
Sbjct: 181 LSNPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMMNPGGGEN 240

Query: 241 DAANAFPAPGNENTEGESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
           DAANAFPAPGNENTEGES                                          
Sbjct: 241 DAANAFPAPGNENTEGESAAGANDGGNPAAAATNAGAPPAGNPFAALLGGGGPLQQPGGL 300

Query: 301 XXXXXXSMLGAPSQQQQPQDNRPPEERYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGA 360
                 SMLGAPSQQQQPQDNRPPEERYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGA
Sbjct: 301 DPQLLASMLGAPSQQQQPQDNRPPEERYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGA 360

Query: 361 LDSLLNGDV 369
           LDSLLNGDV
Sbjct: 361 LDSLLNGDV 369

>SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {ON}
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin- binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 365

 Score =  365 bits (938), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 209/379 (55%), Positives = 239/379 (63%), Gaps = 27/379 (7%)

Query: 3   TITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYN 62
           +IT+ IKSGQNKW+V+++P +TV   KE ISKVSEIP ++QRLIYSGKILKDDQT++ Y 
Sbjct: 2   SITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYK 61

Query: 63  LQDGHSVHLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTPTTGAPSNLSAGQ 122
           + D H+VHLV                                          PSN+S+GQ
Sbjct: 62  IADDHAVHLVRSGGPKPAASKSESTSATDTGAAA--------------AAAVPSNISSGQ 107

Query: 123 SGGFNPLADLTSARYAGFTSLPSADMFGPDGGATNMPNQEDLLNMLDNPIFQSQMNEMLS 182
           +GGFNPLADLT ARYAG+ +LPSADMFGPDGG TN PN +++LNMLDNPI QSQMNEMLS
Sbjct: 108 TGGFNPLADLTGARYAGYANLPSADMFGPDGGLTNAPNSDEILNMLDNPIVQSQMNEMLS 167

Query: 183 NPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMMNPGGGENDA 242
           NPQMVDFMIQ NPQLQAMGP+AR++ QS +FRQM+TNP MIRQSMQFARM     G   A
Sbjct: 168 NPQMVDFMIQQNPQLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFARMFG-MEGAEGA 226

Query: 243 ANAFPAPG----NENTEGESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 298
             AFPAPG      +TEG                                          
Sbjct: 227 GGAFPAPGTATQTASTEGGPAGTTASPSTTGNGSANSEAANPFASLFNGQANPFASMFPN 286

Query: 299 XXXXXXXXSML--------GAPSQQQQPQDNRPPEERYETQLRQLNEMGFFDFDRNVAAL 350
                   S+L         AP QQQQPQDNRPPEERYE QLRQLN+MGFFDFDRNVAAL
Sbjct: 287 GRAPQFDPSLLSSFLGGNTAAPGQQQQPQDNRPPEERYEQQLRQLNDMGFFDFDRNVAAL 346

Query: 351 RRSGGSVQGALDSLLNGDV 369
           RRSGGSVQGALD+LLNGDV
Sbjct: 347 RRSGGSVQGALDALLNGDV 365

>NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  353 bits (907), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 197/386 (51%), Positives = 245/386 (63%), Gaps = 37/386 (9%)

Query: 3   TITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYN 62
           +I++ +KSGQN W+V++DP ST+   KEEI+KVSE+PA++QRLI+SGKILKDDQT++FY 
Sbjct: 2   SISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYK 61

Query: 63  LQDGHSVHLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTPTTGAPSNLSAGQ 122
           + DG S+H+V                                   TT T  AP N++AG+
Sbjct: 62  ILDGLSIHMVKSGGGSANKNKSPPPQAN-----------------TTATPVAP-NMAAGE 103

Query: 123 SGGFNPLADLTSARYAGFTSLPSADMFGPDGGATNM-PNQEDLLNMLDNPIFQSQMNEML 181
           +GGFNPL+DLTSARYAG+ +LPSAD FGPDGG  N  PNQ+++L MLDNP+FQSQMNEML
Sbjct: 104 TGGFNPLSDLTSARYAGYLNLPSADTFGPDGGLNNSGPNQDEMLRMLDNPVFQSQMNEML 163

Query: 182 SNPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMMNP-----G 236
           SNPQM+DF+IQ+NPQLQAMGPQARQ+ Q+P FRQMLTNP MIRQSMQ AR MN      G
Sbjct: 164 SNPQMLDFIIQANPQLQAMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPNG 223

Query: 237 GGENDAANAFPAPG--NENTEGESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 294
            G+ + ++ FPAPG  ++NT  E+                                    
Sbjct: 224 NGQANTSSDFPAPGGDDDNTVSENTPSTTNTASTNPSSTATTNAANPFASLFNPAMNPFA 283

Query: 295 XXXXXXXXXXX-----------XSMLGAPSQQQQPQDNRPPEERYETQLRQLNEMGFFDF 343
                                  SM   P+ QQQ +D RPPEERYE QLRQLN+MGFFDF
Sbjct: 284 AGMANTNAAGSGNPPAFDPSFFASMFQPPAAQQQQEDTRPPEERYEHQLRQLNDMGFFDF 343

Query: 344 DRNVAALRRSGGSVQGALDSLLNGDV 369
           DRNVAALRRSGG+V+ AL++LLNGDV
Sbjct: 344 DRNVAALRRSGGNVESALNALLNGDV 369

>TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  344 bits (882), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 166/256 (64%), Positives = 197/256 (76%), Gaps = 12/256 (4%)

Query: 3   TITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYN 62
           +ITVQ+K GQ+KWEV+V+PE TV+ FK+EI+KVSEIPA++QRLIYSGKILKDDQ ++ Y 
Sbjct: 2   SITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYK 61

Query: 63  LQDGHSVHLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTPTTGAPSNLSAGQ 122
           +QDGH++HLV                                      +   PSN+++GQ
Sbjct: 62  IQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPG------------SATVPSNIASGQ 109

Query: 123 SGGFNPLADLTSARYAGFTSLPSADMFGPDGGATNMPNQEDLLNMLDNPIFQSQMNEMLS 182
           +GGFNPL+DLTSARYAGFT+LPSADMFGPDGG TNMPNQ+D+L ML+NPIFQSQMNEMLS
Sbjct: 110 TGGFNPLSDLTSARYAGFTNLPSADMFGPDGGLTNMPNQDDMLGMLENPIFQSQMNEMLS 169

Query: 183 NPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMMNPGGGENDA 242
           NPQMVDFMIQSNPQLQAMGPQARQ+ QSPFFRQMLTNPQM+RQSMQF+ MMNP GG + A
Sbjct: 170 NPQMVDFMIQSNPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMMNPSGGNDAA 229

Query: 243 ANAFPAPGNENTEGES 258
           A +FPAPG+  TE  S
Sbjct: 230 AASFPAPGDSTTEASS 245

 Score =  107 bits (268), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 55/60 (91%)

Query: 310 GAPSQQQQPQDNRPPEERYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 369
           G  +QQ+  QDNRPPEERYE QLRQLN+MGFFDF++NVAALRRSGGSVQGALDSLLNGDV
Sbjct: 310 GGAAQQRAEQDNRPPEERYEQQLRQLNDMGFFDFEKNVAALRRSGGSVQGALDSLLNGDV 369

>Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276W
           (REAL)
          Length = 364

 Score =  330 bits (845), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 194/378 (51%), Positives = 230/378 (60%), Gaps = 26/378 (6%)

Query: 3   TITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYN 62
           ++ + IKSGQ+KWEV V PE TV  FKE ISK + IP ++QRLIYSGKILKDDQT+  Y+
Sbjct: 2   SLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYH 61

Query: 63  LQDGHSVHLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTPTTGAPSNLSAGQ 122
           +QDGHSVHLV                                       T A  N+S+GQ
Sbjct: 62  IQDGHSVHLVKSQPKPDAGGATGANNATATSAAVG--------------TSATPNMSSGQ 107

Query: 123 SGGFNPLADLTSARYAGFTSLPSADMFGPDGGATNMP--NQEDLLNMLDNPIFQSQMNEM 180
           S GFNPLADLTSARYAG+ ++PSADMFGPDGGA N    NQ++LL M++NPIFQSQMNEM
Sbjct: 108 SAGFNPLADLTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEM 167

Query: 181 LSNPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMMNPGGGEN 240
           LSNPQM+DFMIQSNPQLQAMGPQARQM QSP FRQMLTNP+M+RQSMQFARMM+P   +N
Sbjct: 168 LSNPQMLDFMIQSNPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMMDP-NADN 226

Query: 241 DAANAFPAPGNENTE--GESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 298
            AA+AFPAPG + +E    +                                        
Sbjct: 227 SAASAFPAPGGDASEEGANTNAVPSSNAGTNGSANAAANPFASLLNPALNPFANAGNTAP 286

Query: 299 XXXXXXXXSMLGAPSQQQQ--PQDNRPPEER--YETQLRQLNEMGFFDF---DRNVAALR 351
                   ++L +  Q QQ   Q ++P + R   E    QL ++    F   DRNVAALR
Sbjct: 287 TGMPAFDPALLASMFQPQQASAQASQPEDSRPPEERYEHQLRQLNDMGFFDFDRNVAALR 346

Query: 352 RSGGSVQGALDSLLNGDV 369
           RSGGSVQGALDSLLNGDV
Sbjct: 347 RSGGSVQGALDSLLNGDV 364

>CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highly
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276w DSK2
          Length = 373

 Score =  321 bits (822), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 157/258 (60%), Positives = 191/258 (74%), Gaps = 22/258 (8%)

Query: 3   TITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYN 62
           +IT+ IKSGQNKW+V++DP  T+   KEEI+KVSEIP+ +QRLIYSGKILKDDQT++ YN
Sbjct: 2   SITIHIKSGQNKWDVSIDPSQTILNLKEEIAKVSEIPSGNQRLIYSGKILKDDQTVESYN 61

Query: 63  LQDGHSVHLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTPTTGAPSNLSAGQ 122
           ++D H++H+V                                    + TT  PSN+++GQ
Sbjct: 62  IKDDHAIHMVKSGGNASTSNAPTNANESS----------------NSSTTAVPSNIASGQ 105

Query: 123 SGGFNPLADLTSARYAGFTSLPSADMFGPDGGATNMPNQEDLLNMLDNPIFQSQMNEMLS 182
           +GGFNPLADLT ARYAG+ +LPSADMFGPDGG  N P+Q+++L M++NPIFQSQMNEMLS
Sbjct: 106 TGGFNPLADLTGARYAGYANLPSADMFGPDGGINNAPDQDEMLRMMENPIFQSQMNEMLS 165

Query: 183 NPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMMN-----PGG 237
           NP+M+DFMIQSNPQLQAMGPQARQM QSPFFRQMLTNP MIRQSMQFARMMN     PG 
Sbjct: 166 NPEMLDFMIQSNPQLQAMGPQARQMLQSPFFRQMLTNPAMIRQSMQFARMMNGQGGMPGA 225

Query: 238 GENDAANAFPAPGNENTE 255
              DA+ AFPAPG ++TE
Sbjct: 226 DATDAS-AFPAPGGDDTE 242

 Score =  105 bits (261), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 51/61 (83%), Positives = 55/61 (90%), Gaps = 4/61 (6%)

Query: 309 LGAPSQQQQPQDNRPPEERYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGALDSLLNGD 368
           L AP+Q+    DNRPPEERYE QLRQLN+MGFFDFDRNVAALRRSGGSVQGALD+LLNGD
Sbjct: 317 LPAPAQE----DNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLNGD 372

Query: 369 V 369
           V
Sbjct: 373 V 373

>Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {ON}
           complement(21199..22344) [1146 nt, 382 aa]
          Length = 381

 Score =  312 bits (800), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 161/254 (63%), Positives = 184/254 (72%), Gaps = 14/254 (5%)

Query: 4   ITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNL 63
           I + IKSGQNKWEVTVD  +TV   KEEI+KVSEIP  +QRLIYSGKILKDDQ L+FY +
Sbjct: 3   IKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKI 62

Query: 64  QDGHSVHLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTPTTGAPSNLSAGQS 123
           QD HS+HLV                                          PSN++AGQS
Sbjct: 63  QDEHSIHLVKSGGASKTNTSASAAAASTSTATNSDS-----------NAPLPSNIAAGQS 111

Query: 124 GGFNPLADLTSARYAGF-TSLPSADMFGPDGGATNMPNQEDLLNMLDNPIFQSQMNEMLS 182
           GGFNPL+DLTSARYAG+  +LPSADMFGPDGG  +MPNQ+D+L ML+NP+FQSQMNEMLS
Sbjct: 112 GGFNPLSDLTSARYAGYGLNLPSADMFGPDGGMNSMPNQDDMLRMLENPVFQSQMNEMLS 171

Query: 183 NPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMMNPGG--GEN 240
           NPQM+DFMIQSNPQLQAMGP+ARQMFQSPFFRQMLTNP+MIRQSMQ A MM   G  G N
Sbjct: 172 NPQMIDFMIQSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIRQSMQMANMMGGNGQFGAN 231

Query: 241 DAANAFPAPGNENT 254
            AA++FPAPG  +T
Sbjct: 232 AAASSFPAPGETDT 245

 Score = 99.4 bits (246), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 49/50 (98%)

Query: 320 DNRPPEERYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 369
           DNRPPEERYE+QLRQLN+MGFFDFDRNVAALRRSGGSVQGALD+LL+ DV
Sbjct: 332 DNRPPEERYESQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLSNDV 381

>KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON}
           Anc_8.837 YMR276W
          Length = 367

 Score =  311 bits (796), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 190/378 (50%), Positives = 227/378 (60%), Gaps = 25/378 (6%)

Query: 4   ITVQIKSGQNKWEVTV--DP-ESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQF 60
           ITV +K GQN+W+V V  +P E+TV+ FKE ++ V+ +P  +QRLIYSGKILKD QTL+ 
Sbjct: 3   ITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEE 62

Query: 61  YNLQDGHSVHLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTPTTGAPSNLSA 120
           Y + DGH+VHLV                                           ++++A
Sbjct: 63  YKITDGHTVHLVKSGGAKSAGSSSSSSEATTAAGTAGTAPAAG------------ASMAA 110

Query: 121 GQSGGFNPLADLTSARYAGFT-SLPSADMFGPDGGATNMPNQ------EDLLNMLDNPIF 173
           GQ  GFNPLADLTSARYAG+   +PSADMFGPDGG T+          E++L+ML+NPIF
Sbjct: 111 GQQPGFNPLADLTSARYAGYNLPMPSADMFGPDGGLTSGGGPGGPQSQEEILSMLENPIF 170

Query: 174 QSQMNEMLSNPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMM 233
           QSQMNEM SNPQMVDF+IQSNPQLQAMGPQAR+M QSP FRQMLTNP M+RQSMQF++MM
Sbjct: 171 QSQMNEMFSNPQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVRQSMQFSQMM 230

Query: 234 NPGGGENDAA--NAFPAPGNENTEGESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 291
              G     A  NAFPAPG ++T G                                   
Sbjct: 231 QGSGAGAGGADPNAFPAPGGDDT-GAPTNTSTNASAAGPAGANPFSSLFGGAPAPAAQPF 289

Query: 292 XXXXXXXXXXXXXXXSMLGAPSQQQQPQDNRPPEERYETQLRQLNEMGFFDFDRNVAALR 351
                          S  GA +    PQD RPPEERYE QLRQLN+MGF DFDRNVAALR
Sbjct: 290 QSAPGFDAAAFMQAMSRNGATAPAAAPQDTRPPEERYEQQLRQLNDMGFSDFDRNVAALR 349

Query: 352 RSGGSVQGALDSLLNGDV 369
           R+GGS+QGALD+LLNGDV
Sbjct: 350 RAGGSLQGALDALLNGDV 367

>KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.837
           YMR276W
          Length = 379

 Score =  306 bits (784), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 158/270 (58%), Positives = 189/270 (70%), Gaps = 27/270 (10%)

Query: 3   TITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYN 62
           +IT+ IKSGQNKW+V  +   +++T KEEISK+SEIPA++QRLIYSGKILKDDQT++ Y 
Sbjct: 2   SITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYK 61

Query: 63  LQDGHSVHLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTPTTGAPSNLSAGQ 122
           +++GHS+HLV                                   T      PSN+++GQ
Sbjct: 62  IEEGHSIHLVKSGGNVARNSAATNTTPTATSNEN-----------TNSAPSVPSNIASGQ 110

Query: 123 SGGFNPLADLTSARYAGFTSLPSADMFGPDGGATNMPNQEDLLNMLDNPIFQSQMNEMLS 182
           +GGFNPL DLTSARYAG+ ++PSADMFGPDGG  + P+Q+D+L MLDNP+FQSQMNEMLS
Sbjct: 111 TGGFNPLNDLTSARYAGYLNMPSADMFGPDGGLNSGPSQDDMLRMLDNPVFQSQMNEMLS 170

Query: 183 NPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMMNPGGGENDA 242
           NPQM+DFMIQSNPQLQAMGPQARQM QSP FRQML NP MIRQSMQFARMMN  GG + A
Sbjct: 171 NPQMIDFMIQSNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMN--GGNDPA 228

Query: 243 A-----NAFPAPG---------NENTEGES 258
           A     +AFPAPG         N N  GES
Sbjct: 229 ATGNDPSAFPAPGEASASTNEQNTNASGES 258

 Score =  115 bits (288), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 58/65 (89%), Gaps = 2/65 (3%)

Query: 307 SMLGAPSQQQQP--QDNRPPEERYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGALDSL 364
           SMLG P  QQ P  QDNRPPEERYE QLRQLN+MGFFDFDRNVAALRRSGGSVQGALD+L
Sbjct: 315 SMLGMPQSQQTPAQQDNRPPEERYEAQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 374

Query: 365 LNGDV 369
           LNGDV
Sbjct: 375 LNGDV 379

>Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276W
           (REAL)
          Length = 372

 Score =  301 bits (770), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 159/258 (61%), Positives = 185/258 (71%), Gaps = 19/258 (7%)

Query: 3   TITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYN 62
           ++ + IKSGQ+KWEV+V PESTVS FKE ISK + +P ++QRLIYSGKILKDDQT++ Y+
Sbjct: 2   SLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYH 61

Query: 63  LQDGHSVHLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTPTTGAPSNLSAGQ 122
           +QDGHSVHLV                                       T A  N+S+GQ
Sbjct: 62  IQDGHSVHLVKSQPKPQPGAAAGTNNATATG--------------AAAGTVATPNMSSGQ 107

Query: 123 SGGFNPLADLTSARYAGFTSLPSADMFGPDGGATN--MPNQEDLLNMLDNPIFQSQMNEM 180
           S GFNPLADLTSARYAG+ ++PSADMFGPDGGA N    NQ++LL M++NPIFQSQMNEM
Sbjct: 108 SAGFNPLADLTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEM 167

Query: 181 LSNPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMMNPGGGEN 240
           LSNPQM+DFMIQSNPQLQAMGPQARQM QSP FRQMLTNP MIRQSMQFARMM+P  G  
Sbjct: 168 LSNPQMLDFMIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNAGTG 227

Query: 241 D---AANAFPAPGNENTE 255
               AA+AFPAPG +  E
Sbjct: 228 STGGAASAFPAPGGDAPE 245

 Score =  109 bits (272), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 54/59 (91%)

Query: 311 APSQQQQPQDNRPPEERYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 369
           A +Q  QP+D RPPEERYE QLRQLN+MGFFDFDRNVAALRRSGGSVQGALDSLLNGDV
Sbjct: 314 ASAQASQPEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 372

>NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {ON}
           Anc_8.837 YMR276W
          Length = 404

 Score =  297 bits (761), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 156/262 (59%), Positives = 186/262 (70%), Gaps = 27/262 (10%)

Query: 1   MSTITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQF 60
           MSTI++ IKSGQN W+V++D  ++++T K+EI+KVSEIPA++QRLIYSGKILKDDQ + F
Sbjct: 1   MSTISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDF 60

Query: 61  YNLQDGHSVHLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTPTTGAPSNLSA 120
           YN+QDGHSVHLV                                          PSN+SA
Sbjct: 61  YNIQDGHSVHLVRSGKKSTPTPATTNTTT------------------NASNNTVPSNISA 102

Query: 121 GQSGGFNPLADLTSARYAGFT-SLPSADMFGPDGGAT-NMPNQEDLLNMLDNPIFQSQMN 178
           GQ+GGFNPLADLTSARYAG+  +LPSAD FGPDGG   +  N ++ L+MLDNPI QSQMN
Sbjct: 103 GQTGGFNPLADLTSARYAGYNLNLPSADAFGPDGGMNQSGTNPDEFLSMLDNPIVQSQMN 162

Query: 179 EMLSNPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMMNPGGG 238
           EMLSNPQM+DFMIQSNPQLQAMGPQARQMFQSP FRQMLTNP MIRQSMQ A MM  G G
Sbjct: 163 EMLSNPQMIDFMIQSNPQLQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMMGMGPG 222

Query: 239 E-------NDAANAFPAPGNEN 253
                   ++AA++FPAPG ++
Sbjct: 223 ARGSTNATDNAASSFPAPGGDD 244

 Score =  104 bits (259), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 54/60 (90%)

Query: 310 GAPSQQQQPQDNRPPEERYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 369
           GAPS   Q QD RPPEERYETQLRQLN+MGFFDFDRN+AALRR+GGSV+ A+++LLNGDV
Sbjct: 345 GAPSTTPQQQDTRPPEERYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNALLNGDV 404

>Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276W
           (REAL)
          Length = 366

 Score =  293 bits (750), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 159/258 (61%), Positives = 185/258 (71%), Gaps = 18/258 (6%)

Query: 3   TITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYN 62
           ++ V +KSGQ+KWEV+V PESTV  FKE IS+ + IP ++QRLIYSGKILKDDQT++ Y+
Sbjct: 2   SLNVYVKSGQDKWEVSVAPESTVLQFKEAISEANGIPVANQRLIYSGKILKDDQTVESYH 61

Query: 63  LQDGHSVHLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTPTTGAPSNLSAGQ 122
           +QDGHSVHLV                                   T  +  A  N+S+GQ
Sbjct: 62  IQDGHSVHLVKSQPRPQAGAATGAGGDAGASA-------------TNASVSATPNMSSGQ 108

Query: 123 SGGFNPLADLTSARYAGFTSLPSADMFGPDGGATNMP--NQEDLLNMLDNPIFQSQMNEM 180
           S GFNPLADLTSARYAG+ ++PSADMFGPDGGA N    NQ++LL M+DNPIFQSQMNEM
Sbjct: 109 SAGFNPLADLTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMDNPIFQSQMNEM 168

Query: 181 LSNPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMMNP---GG 237
           LSNPQM+DFMIQSNPQLQAMGPQARQM QSP FRQMLTNP MIRQSMQFARMM+P    G
Sbjct: 169 LSNPQMLDFMIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNAGNG 228

Query: 238 GENDAANAFPAPGNENTE 255
               AA+AFPAPG +  E
Sbjct: 229 SAGGAASAFPAPGGDAPE 246

 Score =  102 bits (254), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 49/51 (96%)

Query: 319 QDNRPPEERYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 369
           +D RPPEERYE QLRQLN+MGFFDFDRNVAALRRSGGSVQGALDSLLNGDV
Sbjct: 316 EDTRPPEERYEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 366

>TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837
           YMR276W
          Length = 377

 Score =  293 bits (749), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 150/258 (58%), Positives = 184/258 (71%), Gaps = 16/258 (6%)

Query: 3   TITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYN 62
           +I+VQIKSGQNKW+V V+P +T+  FKE ISK S+IPA +QRLIYSGKILKD +T++ Y 
Sbjct: 2   SISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESYK 61

Query: 63  LQDGHSVHLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTPTTGAPSNLSAGQ 122
           +QDGHS+HLV                                       +  P+N+++GQ
Sbjct: 62  IQDGHSIHLVKSGDASANAAKSSTAAAATANAAAGSAE-----------SAVPTNITSGQ 110

Query: 123 SGGFNPLADLTSARYAGFT-SLPSADMFGPDGGATNMPNQEDLLNMLDNPIFQSQMNEML 181
           + GFNPLADLTSARYAG+   +PSADMFGPDGG TNMPNQ+D+L+ML+NP+FQSQMNEML
Sbjct: 111 TNGFNPLADLTSARYAGYNLPMPSADMFGPDGGMTNMPNQDDMLSMLENPVFQSQMNEML 170

Query: 182 SNPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMMNPGGGEND 241
           SNPQMV++MI SNPQLQA+GPQAR+MFQSPFFRQMLTNP MIRQSM+ ARMM   G    
Sbjct: 171 SNPQMVEYMINSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMMGGEGVGIG 230

Query: 242 AA----NAFPAPGNENTE 255
                 ++FPAPG  +TE
Sbjct: 231 GGLNGDSSFPAPGETSTE 248

 Score = 98.2 bits (243), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 54/63 (85%), Gaps = 1/63 (1%)

Query: 307 SMLGAPSQQQQPQDNRPPEERYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGALDSLLN 366
           SML  P Q  Q +D RPPE RYE+QLRQLN+MGFF+FDRN+AALRRSGGSVQGALD+LLN
Sbjct: 316 SMLQQPRQPAQ-EDTRPPEVRYESQLRQLNDMGFFEFDRNIAALRRSGGSVQGALDALLN 374

Query: 367 GDV 369
            DV
Sbjct: 375 NDV 377

>YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}
           DSK2Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein, required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle, involved in proteolysis,
           interacts with the proteasome
          Length = 373

 Score =  286 bits (733), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 159/258 (61%), Positives = 184/258 (71%), Gaps = 19/258 (7%)

Query: 3   TITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYN 62
           ++ + IKSGQ+KWEV V PESTV  FKE I+K + IP ++QRLIYSGKILKDDQT++ Y+
Sbjct: 2   SLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYH 61

Query: 63  LQDGHSVHLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTPTTGAPSNLSAGQ 122
           +QDGHSVHLV                                       TGA  N+S+GQ
Sbjct: 62  IQDGHSVHLVKSQPKPQTASAAGANNATATG--------------AAAGTGATPNMSSGQ 107

Query: 123 SGGFNPLADLTSARYAGFTSLPSADMFGPDGGATNMP--NQEDLLNMLDNPIFQSQMNEM 180
           S GFNPLADLTSARYAG+ ++PSADMFGPDGGA N    NQ++LL M++NPIFQSQMNEM
Sbjct: 108 SAGFNPLADLTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEM 167

Query: 181 LSNPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMMNPG---G 237
           LSNPQM+DFMIQSNPQLQAMGPQARQM QSP FRQMLTNP MIRQSMQFARMM+P    G
Sbjct: 168 LSNPQMLDFMIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNAGMG 227

Query: 238 GENDAANAFPAPGNENTE 255
               AA+AFPAPG +  E
Sbjct: 228 SAGGAASAFPAPGGDAPE 245

 Score =  108 bits (270), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 52/63 (82%), Positives = 54/63 (85%)

Query: 307 SMLGAPSQQQQPQDNRPPEERYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGALDSLLN 366
           SM   P Q  Q +D RPPEERYE QLRQLN+MGFFDFDRNVAALRRSGGSVQGALDSLLN
Sbjct: 311 SMFQPPVQASQAEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLN 370

Query: 367 GDV 369
           GDV
Sbjct: 371 GDV 373

>KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 371

 Score =  282 bits (721), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 147/258 (56%), Positives = 177/258 (68%), Gaps = 18/258 (6%)

Query: 1   MSTITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQF 60
           MS I+V +KSGQN W V ++  +T+  FKE IS VS +PA +QRLIYSGKILKD +T++ 
Sbjct: 1   MSQISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVES 60

Query: 61  YNLQDGHSVHLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTPTTGAPSNLSA 120
           Y +QDGHSVH+V                                       + APSN+SA
Sbjct: 61  YKIQDGHSVHMVKSGGASAATTGSTTTGSAASPAAT--------------NSAAPSNISA 106

Query: 121 GQSGGFNPLADLTSARYAGFTSLPSADMFGPDGG--ATNMPNQEDLLNMLDNPIFQSQMN 178
           GQ+GGFNPLADLT ARYAG  +LPSADMFGPDGG  ++N  N E +L ML+NPIFQSQMN
Sbjct: 107 GQTGGFNPLADLTGARYAGLANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMN 166

Query: 179 EMLSNPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMMNPGGG 238
           EMLSNPQMVDF+IQ NPQLQA+GP+AR M QSPFFRQM+T+PQMIRQSMQ A  M  G  
Sbjct: 167 EMLSNPQMVDFLIQQNPQLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSM--GMS 224

Query: 239 ENDAANAFPAPGNENTEG 256
            + AA+AFPAPG+ +  G
Sbjct: 225 PDGAASAFPAPGSASGAG 242

 Score =  103 bits (257), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 50/50 (100%)

Query: 320 DNRPPEERYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 369
           DNRPPEERYE+QLRQLN+MGFFDFDRNVAALRR+GGSVQGALD+LLNGDV
Sbjct: 322 DNRPPEERYESQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDALLNGDV 371

>TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {ON}
           Anc_8.837 YMR276W
          Length = 375

 Score =  279 bits (714), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 142/250 (56%), Positives = 178/250 (71%), Gaps = 17/250 (6%)

Query: 3   TITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYN 62
           TI+V IKSGQN W+V ++  ST+  FK++I+ VSEIPA +QRLIYSGKILKDDQT++ Y 
Sbjct: 2   TISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYK 61

Query: 63  LQDGHSVHLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTPTTGAPSNLSAGQ 122
           +QDGHS+H+V                                           S +S G+
Sbjct: 62  IQDGHSIHMVKSGAHATASSTTNSMTTTNTTAPQ--------------NNNGSSGMSTGR 107

Query: 123 SGGFNPLADLTSARYAGFTSLPSADMFGPDGGATNMPNQEDLLNMLDNPIFQSQMNEMLS 182
             GFNPL+DLTSARYAG+T+LPSADMFGPDGG+    +Q+D+L+ML+NP+FQSQMNEMLS
Sbjct: 108 GSGFNPLSDLTSARYAGYTNLPSADMFGPDGGSFASQSQDDMLHMLENPVFQSQMNEMLS 167

Query: 183 NPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMMNPGGGENDA 242
           NP++VDF+I SNPQLQ++GPQAR MFQSP FRQMLTNP MIRQSM+ A+MMN  GGE  A
Sbjct: 168 NPEIVDFLINSNPQLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMN--GGEGTA 225

Query: 243 -ANAFPAPGN 251
            A++FPAPG+
Sbjct: 226 SASSFPAPGD 235

 Score = 96.3 bits (238), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 49/50 (98%)

Query: 316 QQPQDNRPPEERYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGALDSLL 365
           Q+P+DNRPPEERYE QLRQLN+MGFFDFD+NVAALRRSGGSVQGA+++LL
Sbjct: 323 QEPEDNRPPEERYEHQLRQLNDMGFFDFDKNVAALRRSGGSVQGAVNALL 372

>Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {ON}
           YMR276W (DSK2) - ubiquitin-like protein [contig 37] FULL
          Length = 379

 Score =  279 bits (713), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 144/271 (53%), Positives = 185/271 (68%), Gaps = 39/271 (14%)

Query: 3   TITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYN 62
           +ITV +KSGQ+KW+V+VD +STV+ FK  I++ S+I   +QRLIYSGKILKDDQTL+ Y 
Sbjct: 2   SITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESYK 61

Query: 63  LQDGHSVHLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTPTTG--APSNLSA 120
           + DGH+VHLV                                     P +G  AP+N ++
Sbjct: 62  ILDGHAVHLVKSGTKSGSGAIG------------------------APGSGSTAPTNTAS 97

Query: 121 ------------GQSGGFNPLADLTSARYAGFTSLPSADMFGPDGGATNMPNQEDLLNML 168
                       GQ+GGFNPL+DLTSARYAG+ +LPSAD FGPDGG T+ PN +D+L ML
Sbjct: 98  SGAAAAPASLSSGQAGGFNPLSDLTSARYAGYLNLPSADSFGPDGGMTSAPNSDDMLRML 157

Query: 169 DNPIFQSQMNEMLSNPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQ 228
           +NP+ QSQMNEMLSNPQM+DF+IQ +PQLQ+MGPQARQM QSPFFRQM+TNP+MIRQSMQ
Sbjct: 158 ENPVMQSQMNEMLSNPQMIDFLIQQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQ 217

Query: 229 FARMMNPGGGENDA-ANAFPAPGNENTEGES 258
           F+ ++   G  + A ANAFPAPG  +++  +
Sbjct: 218 FSGVLGGAGDPSAAGANAFPAPGTADSDASA 248

 Score =  107 bits (268), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 49/54 (90%), Positives = 52/54 (96%)

Query: 316 QQPQDNRPPEERYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 369
           QQPQD RPPEERYE QLRQLN+MGFF+FDRNVAALRRSGGSVQGALD+LLNGDV
Sbjct: 326 QQPQDTRPPEERYEQQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDALLNGDV 379

>KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {ON}
           some similarities with uniprot|P48510 Saccharomyces
           cerevisiae YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 376

 Score =  278 bits (711), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 141/248 (56%), Positives = 169/248 (68%), Gaps = 5/248 (2%)

Query: 3   TITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYN 62
           +ITV IKSGQNKW+V +DP ST++ FK  I+  SEI   +QRLIYSGKILKDDQT++ Y 
Sbjct: 2   SITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYK 61

Query: 63  LQDGHSVHLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTPTTGAPSNLSAGQ 122
           + D HSVHLV                                     P   AP+NLS GQ
Sbjct: 62  ILDDHSVHLVKSGGSKKATSPGATAAASGDATATGATSTPAAQ----PQQSAPANLSTGQ 117

Query: 123 SGGFNPLADLTSARYAGFTSLPSADMFGPDGGATNMPNQEDLLNMLDNPIFQSQMNEMLS 182
             GFNPL+DLTSARYAGF +LPSAD FGPDGG T+ PN +D+L ML+NP+ QSQMNEMLS
Sbjct: 118 GNGFNPLSDLTSARYAGFLNLPSADSFGPDGGMTSAPNSDDVLRMLENPVMQSQMNEMLS 177

Query: 183 NPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMMNPGGGENDA 242
           NPQM+DF+IQ +PQLQ+MGPQAR + QSPFFRQM+TNP MIRQSMQF+ M+  G      
Sbjct: 178 NPQMIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQFSSMLG-GDSAAGG 236

Query: 243 ANAFPAPG 250
            ++FPAPG
Sbjct: 237 GSSFPAPG 244

 Score =  110 bits (274), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 55/60 (91%)

Query: 310 GAPSQQQQPQDNRPPEERYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 369
           GA +  QQPQD RPPEERYE QLRQLN+MGFF+FDRNVAALRRSGGSVQGALD+LLNGDV
Sbjct: 317 GAGAANQQPQDTRPPEERYEHQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDALLNGDV 376

>Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar to
           Ashbya gossypii ABL129W
          Length = 406

 Score =  275 bits (702), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 135/253 (53%), Positives = 174/253 (68%), Gaps = 9/253 (3%)

Query: 3   TITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYN 62
           +I++ +KSGQNKW+V+ DP S++ T K+ I++VS IPA +QRLIYSGKILKDDQT++ Y 
Sbjct: 2   SISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYK 61

Query: 63  LQDGHSVHLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTPTTGA--PSNLSA 120
           + DGHS+HLV                                   +T  +G+  P+N++A
Sbjct: 62  IADGHSIHLVRSGGGKVSGSSGATGGASGSVEAVGSGGRN-----STAGSGSTVPNNITA 116

Query: 121 GQSGGFNPLADLTSARYAGFTSLPSADMFGPDGGATNMPNQEDLLNMLDNPIFQSQMNEM 180
           GQ GGFNPLADLT ARYAG+ +LPS DMFGPDGG  +   QE++L MLDNPIFQSQ+NEM
Sbjct: 117 GQMGGFNPLADLTGARYAGYANLPSTDMFGPDGGLNSAIGQEEILGMLDNPIFQSQVNEM 176

Query: 181 LSNPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMMNPGGGEN 240
           L+NPQM+DF+IQ +P LQAMGP AR+M QSPFFRQM+TNP +IRQ  +F   M+ G    
Sbjct: 177 LANPQMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRF--QMDMGAANG 234

Query: 241 DAANAFPAPGNEN 253
            + N FPAPG+ N
Sbjct: 235 QSTNDFPAPGSAN 247

 Score =  100 bits (249), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 46/55 (83%), Positives = 51/55 (92%)

Query: 315 QQQPQDNRPPEERYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 369
           +QQ +DNRPPEERY+ QL QLNEMGF DFDRNVAALRRSGGSVQGAL++LLNGDV
Sbjct: 352 RQQTEDNRPPEERYQQQLEQLNEMGFVDFDRNVAALRRSGGSVQGALNALLNGDV 406

>ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR276W (DSK2)
          Length = 345

 Score =  272 bits (696), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 168/249 (67%), Gaps = 16/249 (6%)

Query: 3   TITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYN 62
           TI +Q+KSGQN+WEV+V+   +V   K+EI+KVSEIPA +QRLIYSGKILKDDQT++ Y 
Sbjct: 2   TIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYK 61

Query: 63  LQDGHSVHLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTPTTGAPSNLSAGQ 122
           + DGH++HLV                                          PS++SAGQ
Sbjct: 62  IADGHAIHLVKSGGAKAAPAASAAGGESTGA--------------AAGAGAVPSSISAGQ 107

Query: 123 SGGFNPLADLTSARYAGFTSLPSADMFGPDGGATNMPNQEDLLNMLDNPIFQSQMNEMLS 182
           SGGFNPLADLT ARYAG+T+LPS DMFGPDGG  +   QE+++ ML+NPIFQSQMNEML+
Sbjct: 108 SGGFNPLADLTGARYAGYTNLPSTDMFGPDGGLNSAVGQEEIIGMLENPIFQSQMNEMLN 167

Query: 183 NPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMMNPGGGENDA 242
           NPQM+DF+IQ +P LQAMGP AR+M QSPFFRQMLTNP +IRQ  +    M  GG   + 
Sbjct: 168 NPQMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMLTNPDIIRQMSRL--QMGMGGAGAEQ 225

Query: 243 ANAFPAPGN 251
              FPAPG+
Sbjct: 226 GTDFPAPGS 234

 Score =  101 bits (252), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%)

Query: 320 DNRPPEERYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 369
           DNRPPEERYE QLRQLN+MGFFDFDRNVAALRR+GGSVQGALD+LLNGDV
Sbjct: 296 DNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDALLNGDV 345

>TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.837
           YMR276W
          Length = 284

 Score = 71.2 bits (173), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 67/253 (26%), Positives = 107/253 (42%), Gaps = 31/253 (12%)

Query: 4   ITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNL 63
           I+V IK  + K+ +  + +  +S    +I    +IP ++QRLIYSG+IL  ++TL+ YN 
Sbjct: 2   ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61

Query: 64  QDGHSVHLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTPTTGAPSNLSAGQS 123
           +DGH + ++                                     P +  P N S    
Sbjct: 62  KDGHCIIVI-----------IHKEEKNNLHPPPNNTTNLNPNNSVYPASNTPIN-SPTPF 109

Query: 124 GGFNPLADLTSARYAGFTSLPSADMFGPDGGATNMPNQE-DLLNMLDNPIFQSQMNEMLS 182
           G  N +   T+          S D +G      + P  E +LL +LD+P    Q NEML 
Sbjct: 110 GEGNIITITTT----------SPDPYGVRSNEVHDPEVERELLQVLDHP-RSFQENEMLL 158

Query: 183 NPQ-MVDFMIQSNPQLQAMGPQ-ARQMFQSPFFRQMLTNPQMIRQSMQFARMMNPGGGEN 240
           N Q ++ F+IQ+NP L+ M    ARQ+ + P  ++   +   + Q +   R         
Sbjct: 159 NNQNLLRFLIQTNPHLRHMDINGARQVLRDPRLQRAFMDVNFLNQQISLRRT-----AIE 213

Query: 241 DAANAFPAPGNEN 253
            A N    PG+ N
Sbjct: 214 HANNGITHPGSSN 226

>KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 47.8 bits (112), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/69 (37%), Positives = 41/69 (59%), Gaps = 1/69 (1%)

Query: 4  ITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNL 63
          +TV+  +G+ +  V VDP+  V   KE + +   IP + QRLI+ GK + DD+++   NL
Sbjct: 3  LTVKTLTGK-EIPVVVDPDDKVYRIKEYLEEKEGIPPTQQRLIFQGKQIDDDKSVSSANL 61

Query: 64 QDGHSVHLV 72
            G  +HLV
Sbjct: 62 SSGMQLHLV 70

>TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16
          YLL039C
          Length = 77

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 22/54 (40%), Positives = 32/54 (59%)

Query: 19 VDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          V+   T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa]
          {ON} highly similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139c RUB1
          Length = 77

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 31/56 (55%)

Query: 17 VTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          V V  E  V   KE + +   IPAS QRLI+ GK + +D T+    L DG  +HLV
Sbjct: 15 VEVSGEDKVYHIKELLEEKEGIPASQQRLIFHGKQINNDDTISTAKLSDGMQLHLV 70

>NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234
          bp, 77 aa] {ON}
          Length = 77

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 28/71 (39%), Positives = 42/71 (59%), Gaps = 3/71 (4%)

Query: 4  ITVQIKSGQNKWEVTVDPEST--VSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFY 61
          + +++K+   K E+ VD + T  V   KE + +   IP S QRLI+ GK + D+QT+   
Sbjct: 1  MIIKVKTLTGK-EIPVDIQGTDPVYRIKEMLEEKEGIPPSQQRLIFQGKQIDDEQTVSSA 59

Query: 62 NLQDGHSVHLV 72
          NL DG  +HLV
Sbjct: 60 NLIDGMQLHLV 70

>NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON}
          Anc_4.16
          Length = 77

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/54 (40%), Positives = 32/54 (59%)

Query: 19 VDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          V+   T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 33/56 (58%)

Query: 17 VTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          ++++    V   KE + +   IP S QRLI+ GK ++DDQT+   NL  G  +HLV
Sbjct: 15 ISLESHEKVYRIKELLEEKEGIPPSQQRLIFQGKQIEDDQTVDSANLSSGMQLHLV 70

>KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 16 EVTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          E++VD +S  TV   KE + +   IP S Q+LI+ GK + D+ T+   +LQDG  +HLV
Sbjct: 12 EISVDVQSSETVYHIKELLEEKEGIPPSQQKLIFQGKQIDDNATIGSADLQDGSLLHLV 70

>Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON}
          YLL039C (REAL)
          Length = 62

 Score = 43.1 bits (100), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 22/54 (40%), Positives = 32/54 (59%)

Query: 19 VDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          V+   T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 3  VEYSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 56

>SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212)
          [387 bp, 128 aa] {ON} highly similar to uniprot|P61864
          Saccharomyces cerevisiae YLR167W RPS31 and highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YIL148W and highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094C and highly similar to
          uniprot|P04838 Saccharomyces cerevisiae YLL039C Fusion
          proteins that are cleaved to yield a ribosomal protein
          of the small (40S) subunit and ubiquitin
          Length = 128

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128
          aa] {ON} ANNOTATED BY YGOB -
          Length = 128

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128
          aa] {ON} highly similar to uniprot|P14796 Saccharomyces
          cerevisiae YKR094C RPL40B
          Length = 128

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C
          (REAL)
          Length = 124

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 9  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 66

>KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128
          aa] {ON} highly similar to uniprot|P61864 Saccharomyces
          cerevisiae YKR094c RPL40B and highly similar to
          uniprot|P61864 Saccharomyces cerevisiae YIL148w RPL40A
          Length = 128

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C
          (REAL)
          Length = 125

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 10 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 67

>Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa]
          {ON} YKR094C (REAL)
          Length = 125

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 10 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 67

>Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa]
          {ON} complement(145335..145721) [387 nt, 129 aa]
          Length = 128

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YKR094C RPL40B Fusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083)
          [387 bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387
          bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387
          bp, 128 aa] {ON} highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094c UBI2 ubiquitin and
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YIL148w UBI1 ubiquitin
          Length = 128

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}
          RPL40AFusion protein, identical to Rpl40Bp, that is
          cleaved to yield ubiquitin and a ribosomal protein of
          the large (60S) ribosomal subunit with similarity to
          rat L40; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,
          128 aa] {ON}  RPL40BFusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp,
          128 aa] {ON} Syntenic homolog of Saccharomyces
          cerevisiae YKR094C (RPL40B) and YIL148W (RPL40A);
          1-intron
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387
          bp, 128 aa] {ON} 
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}
          similar to Ashbya gossypii AFR285C 1-intron
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634)
          [387 bp, 128 aa] {ON} Anc_5.701
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [234
          bp, 77 aa] {ON}
          complement(173662..173746,173844..173992) [234 nt, 78
          aa]
          Length = 77

 Score = 42.4 bits (98), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 26/69 (37%), Positives = 41/69 (59%), Gaps = 3/69 (4%)

Query: 6  VQIKSGQNKWEVTVDPEST--VSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNL 63
          V++K+   K E++V+ + +  V   KE + +   IP S QRLI+ GK + D+QT+    L
Sbjct: 3  VKVKTLTGK-EISVEIQGSDKVYHIKELLEEKEGIPPSQQRLIFQGKQIDDEQTVDSAKL 61

Query: 64 QDGHSVHLV 72
           DG  +HLV
Sbjct: 62 TDGMQLHLV 70

>KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 391

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 34/53 (64%)

Query: 17 VTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSV 69
          + +D  ST+S  K+ +++  +   S  +LIYSGKIL+DD+T+  Y L DG  V
Sbjct: 16 LELDSGSTISEAKQRLAENKDCDESQIKLIYSGKILQDDRTIADYKLNDGDQV 68

>Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W
          (REAL)
          Length = 144

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 29 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 86

>Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa]
          {ON} YEL037C (RAD23) - ubiquitin-like protein [contig
          41] FULL
          Length = 381

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 33/47 (70%)

Query: 23 STVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSV 69
          STV+  K+++++  E   S  +LIYSGKIL+DD+T+  Y L+DG  V
Sbjct: 22 STVNEAKQKLAENKECDDSQIKLIYSGKILQDDRTIGDYKLKDGDQV 68

>Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to
          Ashbya gossypii ACL062C
          Length = 153

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304)
          [450 bp, 149 aa] {ON} 
          Length = 149

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234
          bp, 77 aa] {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 41/71 (57%), Gaps = 3/71 (4%)

Query: 4  ITVQIKSGQNKWEVTVDPESTVSTF--KEEISKVSEIPASSQRLIYSGKILKDDQTLQFY 61
          + +++K+   K E+ V+ +S    +  K+ + +   IP S QRLI+ GK + D QTL+  
Sbjct: 1  MIIKVKTLTGK-EIAVELKSDAPIYRIKQLLEEKEGIPPSQQRLIFQGKQIDDRQTLEAA 59

Query: 62 NLQDGHSVHLV 72
           L DG  +HLV
Sbjct: 60 KLVDGMVLHLV 70

>Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON}
          YALI0E18986g (REAL)
          Length = 151

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar
          to uniprot|P05759 Saccharomyces cerevisiae YLR167W
          RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes interacts genetically
          with translation factor eIF2B
          Length = 152

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YLR167W (RPS31)
          Length = 152

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON}
          similar to Ashbya gossypii AGL128W
          Length = 152

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON}
          YLR167W (RPS31) - Ribosomal protein S31 (S37) (YS24)
          [contig 251] FULL
          Length = 150

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 150

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 and similar to uniprot|P04838
          Saccharomyces cerevisiae YIL148W and similar to
          uniprot|P04838 Saccharomyces cerevisiae YKR094C and
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039C Fusion proteins that are cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 154

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON}
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes; interacts genetically
          with translation factor eIF2B
          Length = 150

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 41.6 bits (96), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/71 (33%), Positives = 43/71 (60%), Gaps = 3/71 (4%)

Query: 4  ITVQIKSGQNKWEVTVDPESTVSTF--KEEISKVSEIPASSQRLIYSGKILKDDQTLQFY 61
          + +++K+   K E+ ++ + +   F  K+ + +   IP S QRLI+ GK + D+QT++  
Sbjct: 1  MQIKVKTLTGK-EIAIEVQGSDKVFHIKDLLEEKEGIPPSQQRLIFQGKQIDDEQTVESA 59

Query: 62 NLQDGHSVHLV 72
          NL DG  +HLV
Sbjct: 60 NLIDGMQLHLV 70

>NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 41.6 bits (96), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 31/56 (55%)

Query: 17 VTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          V +     V   KE + +   IP S QRLI+ GK + D+Q++   NL DG  +HLV
Sbjct: 15 VEISGNEPVYRIKELLEEKEGIPPSQQRLIFQGKQIDDEQSVSSANLVDGMQLHLV 70

>KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON}
          Anc_8.386 YLR167W
          Length = 152

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusion
          protein that is cleaved to yield a ribosomal protein of
          the small (40S) subunit and ubiquitin; ubiquitin may
          facilitate assembly of the ribosomal protein into
          ribosomes; interacts genetically with translation
          factor eIF2B
          Length = 152

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16
          YLL039C
          Length = 229

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 165 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON} 
          Length = 229

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 165 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.701
          YIL148W
          Length = 229

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 165 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa]
          {ON} similar to uniprot|Q03919 Saccharomyces cerevisiae
          YDR139C RUB1 Ubiquitin-like protein with similarity to
          mammalian NEDD8
          Length = 77

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 31/56 (55%)

Query: 17 VTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          V ++ E  +   KE + +   IP S QRLI+ GK + D QT+    L DG  +HLV
Sbjct: 15 VELNGEDPIYRIKELLEEKEGIPPSQQRLIFQGKQIDDQQTVSSAKLVDGMQLHLV 70

>Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa]
          {ON} YLL039C (UBI4) - 1:1 [contig 144] FULL
          Length = 231

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 165 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.386
          YLR167W
          Length = 150

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YLL039c UBI4 ubiquitin
          Length = 409

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 117 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 174

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 193 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 250

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 269 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 326

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 345 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 402

>KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly
          similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167w UBI3 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 152

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}
          complement(10263..10721) [459 nt, 153 aa]
          Length = 152

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON}
          complement(58683..59141) [459 nt, 153 aa]
          Length = 152

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON}
          YLL039C (REAL)
          Length = 254

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 165 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039c UBI4 ubiquitin
          Length = 305

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 165 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 241 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

>KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.142
           YGL181W
          Length = 397

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 32/49 (65%)

Query: 316 QQPQDNRPPEERYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGALDSL 364
           Q+  D+   E  Y  Q+RQL EMGF D ++N+ AL++S G++  A+D L
Sbjct: 178 QEVSDDDRYESDYRRQVRQLKEMGFSDSEKNLKALKKSNGNMNRAIDVL 226

>NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701
          Length = 187

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 72  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 129

>TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.386
          YLR167W
          Length = 152

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,
          381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 165 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 241 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 317 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}
          UBI4Ubiquitin, becomes conjugated to proteins, marking
          them for selective degradation via the ubiquitin-26S
          proteasome system; essential for the cellular stress
          response; encoded as a polyubiquitin precursor
          comprised of 5 head-to-tail repeats
          Length = 381

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 165 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 241 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 317 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>Suva_10.30 Chr10
          complement(67747..67841,68061..68288,68558..69013,
          69256..69622) [1146 bp, 381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 165 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 241 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++ K L+D +TL  YN+Q   ++HLV
Sbjct: 317 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAEKQLEDGRTLSDYNIQKESTLHLV 374

>ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLL039C
          (UBI4)
          Length = 382

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 165 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 241 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 317 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 400

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 4  ITVQIKS-GQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYN 62
          IT+  K   + K  + +DP STV   K++++          +LI+SGK+L+D +TL+   
Sbjct: 2  ITINFKDFKKEKLPLELDPTSTVLQAKQQLASTKSCDEDQIKLIFSGKVLQDGKTLEECK 61

Query: 63 LQDGHSV 69
          L+DG  V
Sbjct: 62 LKDGDQV 68

>KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON}
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 381

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 165 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 241 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 317 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON} 
          Length = 388

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 165 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 241 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 317 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>Smik_12.18 Chr12
          complement(49088..49552,49091..49552,49091..49546)
          [1383 bp, 460 aa] {ON} YLL039C (REAL)
          Length = 460

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 167 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 224

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 243 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 300

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 321 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 378

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 397 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 454

>Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON}
          complement(16980..18581) [1602 nt, 534 aa]
          Length = 533

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 165 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 241 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 317 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 393 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 469 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 526

>ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 460

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 165 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 241 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 317 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 393 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450

>CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} similar
          to uniprot|P04838 Saccharomyces cerevisiae YLL039c UBI4
          ubiquitin
          Length = 533

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 165 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 241 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 317 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 393 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 17  VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72
           +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 469 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 526

>KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 383

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 37/58 (63%)

Query: 12 QNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSV 69
          + K  + +  ++T+S  KE I++  +  AS  +LIY+GKIL+D +T+   NL++G  V
Sbjct: 10 KEKLPIELADDATISHAKELIAEQKQCDASQIKLIYAGKILQDPKTVSGCNLKEGDQV 67

>Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa]
          {ON} similar to Ashbya gossypii AFR358W
          Length = 443

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 4  ITVQIKS-GQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYN 62
          IT+  K   + K  + + P +T++  K+ ++K  +   S  ++I+SGK+L+D  TL    
Sbjct: 3  ITINFKDFKKEKLPLQLSPTATIAEAKQLLAKEKQCDESQLKMIFSGKVLQDGHTLDACK 62

Query: 63 LQDGHSV 69
          L+DG  V
Sbjct: 63 LKDGDQV 69

>AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YEL037C (RAD23)
          Length = 413

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 39/67 (58%), Gaps = 1/67 (1%)

Query: 4  ITVQIKS-GQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYN 62
          IT+  K   + +  + + P +T++  K+ +++  +   S  ++I+SGK+L+D  TL+   
Sbjct: 3  ITIHFKDFKKERLPLQLSPSATIAEAKQMLARAKQCDESQLKMIFSGKVLQDGNTLEGCK 62

Query: 63 LQDGHSV 69
          L+DG  V
Sbjct: 63 LKDGDQV 69

>ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 384

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%)

Query: 12 QNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSV 69
          + K  + +DP S+V   K  ++       S  +LIYSGK+L+D + LQ   L+DG  V
Sbjct: 11 KEKISLELDPSSSVKDAKVRLATEKSCEESQIKLIYSGKVLQDAKNLQESGLKDGDQV 68

>KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa]
          {ON} Anc_1.480 YEL037C
          Length = 379

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 34/61 (55%)

Query: 12 QNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHL 71
          + K  V ++  ST+   K +++ +        +LI+SGK+LKDDQT+    L+D   V +
Sbjct: 10 KEKIPVELESSSTILDAKNKLASIKSCDIDQIKLIFSGKVLKDDQTVSSCGLKDNDQVIM 69

Query: 72 V 72
          +
Sbjct: 70 M 70

>YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp,
          77 aa] {ON}  RUB1Ubiquitin-like protein with similarity
          to mammalian NEDD8; conjugation (neddylation)
          substrates include the cullins Cdc53p, Rtt101p, and
          Cul3p; activated by Ula1p and Uba3p (E1 enzyme pair);
          conjugation mediated by Ubc12p (E2 enzyme)
          Length = 77

 Score = 37.0 bits (84), Expect = 0.008,   Method: Composition-based stats.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 3/71 (4%)

Query: 4  ITVQIKSGQNKWEVTVDPEST--VSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFY 61
          + V++K+   K E++V+ + +  V   KE + +   IP S QRLI+ GK + D  T+   
Sbjct: 1  MIVKVKTLTGK-EISVELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQIDDKLTVTDA 59

Query: 62 NLQDGHSVHLV 72
          +L +G  +HLV
Sbjct: 60 HLVEGMQLHLV 70

>Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON}
          YEL037C (REAL)
          Length = 409

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 35/58 (60%)

Query: 12 QNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSV 69
          + K  + ++P +T+   K ++++ S    S  +LIYSGK+L+D +T+    L+DG  V
Sbjct: 11 KEKVPLDLEPSNTIFEAKTKLAQSSSCEESQIKLIYSGKVLQDSKTVSECGLKDGDQV 68

>CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181w GTS1
          Length = 505

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 25/38 (65%)

Query: 327 RYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGALDSL 364
           +Y  +LRQL E+GF +  +N+ A+  S G V GALD L
Sbjct: 211 KYGRELRQLRELGFTNEQKNIDAITYSHGDVNGALDYL 248

>NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}
          Anc_1.480 YEL037C
          Length = 427

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 35/58 (60%)

Query: 12 QNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSV 69
          + K  + ++P +T+   K ++++      S  ++IYSGK+L+D QT++   L++G  +
Sbjct: 11 KEKIPLDLEPSNTILDVKSQLAQAKACEESQIKIIYSGKVLQDGQTVEECQLKEGDQI 68

>Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 35/58 (60%)

Query: 12 QNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSV 69
          + K  + ++P +T+   K ++++ +    S  +LIYSGK+L+D +T+    L+DG  V
Sbjct: 11 KEKVPLDLEPSNTIFEAKTKLAQSTSCEESQIKLIYSGKVLQDSKTVSECGLKDGDQV 68

>CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037c RAD23 nucleotide excision repair protein
          Length = 392

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 39/67 (58%), Gaps = 1/67 (1%)

Query: 4  ITVQIKS-GQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYN 62
          ++V  K+  + K+ + ++   ++   KE +S+      S  +LI+SGK+LKD  +++  N
Sbjct: 2  VSVTFKNFKKEKYPLDLESSQSIVAVKEALSEKLSCDPSQIKLIFSGKVLKDGDSVESCN 61

Query: 63 LQDGHSV 69
           +DG+ V
Sbjct: 62 FKDGNEV 68

>TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa]
          {ON} Anc_1.480 YEL037C
          Length = 368

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 34/58 (58%)

Query: 12 QNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSV 69
          + K  + +D  S+V   K ++++  E      +LIYSGK+L+D ++LQ   L+DG  V
Sbjct: 11 KEKIPLDLDLSSSVLDAKVQLAQKKECEEGQIKLIYSGKVLQDSKSLQESGLKDGDQV 68

>SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181W GTS1 Contains a zinc-finger in the N-
           terminus and a long Gln-rich region in the C-terminus
           regulates ultradian rhythm cell size cell cycle lifespan
           sporulation heat tolerance and multidrug transport
          Length = 414

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 327 RYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 369
           R+  QLR L E+G+ D D NV AL  + G +  ALD +L  DV
Sbjct: 184 RHSHQLRNLKELGYLDTDSNVEALVLARGDINLALD-ILEADV 225

>NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {ON} 
          Length = 403

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 327 RYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGALDSLL--NGD 368
           +Y  +LR+L  MGF D D N  AL  + G + GA+D L   NGD
Sbjct: 166 KYSRELRRLQNMGFRDIDINTEALVLARGDLNGAIDILTQDNGD 209

>Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 34/58 (58%)

Query: 12 QNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSV 69
          + K  + ++P +T+   K ++++      S  +LIYSGK+L+D +T+    L+DG  V
Sbjct: 11 KEKVPLDLEPSNTIFEVKSKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQV 68

>TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.480
          YEL037C
          Length = 369

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 13 NKWEVTVD--PESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSV 69
           K ++++D    STV   K+++++  E   S  +LIYSGK+L+D  +++   L+DG  V
Sbjct: 10 KKQKISLDLPASSTVLHAKKQLAEQKECDDSQIKLIYSGKVLQDSNSIEGCGLKDGDQV 68

>YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}
          RAD23Protein with ubiquitin-like N terminus, subunit of
          Nuclear Excision Repair Factor 2 (NEF2) with Rad4p that
          binds damaged DNA; enhances protein deglycosylation
          activity of Png1p; also involved, with Rad4p, in
          ubiquitylated protein turnover
          Length = 398

 Score = 38.1 bits (87), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 34/58 (58%)

Query: 12 QNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSV 69
          + K  + ++P +T+   K ++++      S  +LIYSGK+L+D +T+    L+DG  V
Sbjct: 11 KEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQV 68

>TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa]
          {ON} Anc_1.480 YEL037C
          Length = 404

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 1/62 (1%)

Query: 12 QNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDG-HSVH 70
          + K  + +D +ST+ + K +I+          +LIYSGKILK+D T+    L+D  H + 
Sbjct: 11 KEKIPLELDADSTIESAKGQIASEKNCDIDQIKLIYSGKILKNDATILNSGLKDNDHIIF 70

Query: 71 LV 72
          ++
Sbjct: 71 MI 72

>TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.142
           YGL181W
          Length = 442

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 22/38 (57%)

Query: 327 RYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGALDSL 364
           RY  +LR L EMG+ D D N  AL  + G +  A+D L
Sbjct: 193 RYSRELRTLKEMGYDDIDHNAEALSHAHGDLNRAIDIL 230

>NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON}
          Anc_1.480 YEL037C
          Length = 392

 Score = 37.4 bits (85), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 34/58 (58%)

Query: 12 QNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSV 69
          + K  + ++  +TV   K ++++      S  +LIYSGK+L+D +TL+   L+DG  V
Sbjct: 11 KEKIPLALESTNTVLDAKTQLAQNKSCEESQIKLIYSGKVLQDAKTLEDCGLKDGDQV 68

>TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.142
           YGL181W
          Length = 563

 Score = 37.4 bits (85), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 24/38 (63%)

Query: 327 RYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGALDSL 364
           +Y  QL++LN+MGF + D N  AL  S G +  ALD L
Sbjct: 219 KYSRQLKELNDMGFTNTDNNAEALSISRGDINRALDLL 256

>Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON}
          (10094..11308) [1215 nt, 405 aa]
          Length = 404

 Score = 37.4 bits (85), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 14 KWEVTVDPESTVSTF--KEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSV 69
          K ++ +D E +V+    K++I+   +   S  +LIYSGK+L++D T+    L+DG  V
Sbjct: 11 KEKIPLDLEGSVTVLDAKKQIAVKKDCEDSQIKLIYSGKVLQNDSTIGDCGLKDGDQV 68

>NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {ON}
           Anc_8.142 YGL181W
          Length = 447

 Score = 37.0 bits (84), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%)

Query: 327 RYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGALDSL 364
           +Y  QLR L +MGF D D NV AL    G++   ++ L
Sbjct: 155 KYSRQLRSLKDMGFNDVDNNVEALNICNGNINKTINIL 192

>Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]
           {ON} YGL181W (REAL)
          Length = 399

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 25/38 (65%)

Query: 327 RYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGALDSL 364
           RY  QL +L +MGF D ++N+ AL  + G++  A+D L
Sbjct: 196 RYSRQLLELRDMGFSDANKNLDALSSAHGNINRAIDYL 233

>Kwal_56.23883 s56 complement(755602..755760) [159 bp, 52 aa] {ON}
          YDR139C (RUB1) - ubiquitin-like protein [contig 171]
          FULL
          Length = 52

 Score = 32.0 bits (71), Expect = 0.26,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 1/47 (2%)

Query: 4  ITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGK 50
          +TV+  +G+ +  V VDP   V   KE + +   IP + Q+LI+ GK
Sbjct: 3  LTVKTLTGK-EIAVVVDPSDKVYRIKEYLEEKEGIPPTQQKLIFQGK 48

>KAFR0I02780 Chr9 (560687..561331) [645 bp, 214 aa] {ON} Anc_1.480
          YEL037C
          Length = 214

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 24 TVSTFKEEISKVSEIPASSQR--LIYSGKILKDDQTLQFYNLQDG 66
          TV   K  I K  ++   +    LIYSGK+L+DD TL   +L+D 
Sbjct: 23 TVRDLKHHIVKSHKLVCHTDEISLIYSGKLLQDDATLNSLHLKDN 67

>YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protein
           involved in Arf3p regulation and in transcription
           regulation; localizes to the nucleus and to endocytic
           patches; contains an N-terminal Zn-finger and ArfGAP
           homology domain, a C-terminal glutamine-rich region, and
           a UBA (ubiquitin associated) domain; gts1 mutations
           affect budding, cell size, heat tolerance, sporulation,
           life span, ultradian rhythms, endocytosis; expression
           oscillates in a pattern similar to metabolic
           oscillations
          Length = 396

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 25/38 (65%)

Query: 327 RYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGALDSL 364
           RY  QL +L +MGF D ++N+ AL  + G++  A+D L
Sbjct: 194 RYSRQLAELKDMGFGDTNKNLDALSSAHGNINRAIDYL 231

>Ecym_4244 Chr4 complement(507884..508036) [153 bp, 50 aa] {ON}
          similar to Ashbya gossypii AGL185W
          Length = 50

 Score = 30.8 bits (68), Expect = 0.54,   Method: Composition-based stats.
 Identities = 14/34 (41%), Positives = 21/34 (61%)

Query: 17 VTVDPESTVSTFKEEISKVSEIPASSQRLIYSGK 50
          + V+PE  V + KE + +   IP + QRLI+ GK
Sbjct: 15 IDVEPEDRVYSIKELLEEKEGIPPAQQRLIFQGK 48

>Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]
           {ON} YGL181W (REAL)
          Length = 401

 Score = 33.5 bits (75), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 25/38 (65%)

Query: 327 RYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGALDSL 364
           RY  QL +L +MGF D ++N+ AL  + G++  A+D L
Sbjct: 194 RYSRQLAELRDMGFNDKNKNLDALSSAHGNLSRAIDYL 231

>NCAS0C04090 Chr3 (833393..834583) [1191 bp, 396 aa] {ON} Anc_8.142
          Length = 396

 Score = 33.5 bits (75), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 313 SQQQQPQDNRPPEERYETQLRQLNEMGF-FDFDRNVAALRRSGGSVQGALDSL 364
           S +  P D+R    +Y  QL +L +MG+  D  R   AL R+ G +  +LD +
Sbjct: 184 SNRHHPHDSRHGRFKYSRQLNELRDMGYSTDTQRIKDALERTHGDINRSLDII 236

>Suva_15.247 Chr15 complement(420607..421500) [894 bp, 297 aa] {ON}
           YHR058C (REAL)
          Length = 297

 Score = 33.5 bits (75), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 35/74 (47%), Gaps = 13/74 (17%)

Query: 196 QLQAMGPQARQMF------------QSPFFRQMLTNPQMIRQSMQFARMMNPGGGENDAA 243
           +LQ   P+  Q+F            +SPFF +  +N Q+I+   QF+++ +P  G N   
Sbjct: 8   ELQWKSPEWIQVFGLRTENVLDYFSESPFFDKT-SNNQVIKMQRQFSQLNDPNAGVNMTQ 66

Query: 244 NAFPAPGNENTEGE 257
           N    P  +N E E
Sbjct: 67  NIMNLPDGKNVEDE 80

>ZYRO0D08140g Chr4 (705216..705437) [222 bp, 73 aa] {ON} similar
          to uniprot|Q6Q546 Saccharomyces cerevisiae YNR032C-A
          HUB1
          Length = 73

 Score = 30.8 bits (68), Expect = 0.85,   Method: Composition-based stats.
 Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 1/71 (1%)

Query: 1  MSTITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQF 60
          M  + V  + G+ K  V    E  V  FK+ +S     PAS  +L+  G ILKD  +L  
Sbjct: 1  MIEVVVNDRLGK-KIRVKCLEEDLVGDFKKILSVQIGTPASKIQLVKGGSILKDHISLDD 59

Query: 61 YNLQDGHSVHL 71
          Y + D   + L
Sbjct: 60 YEIHDNTFLEL 70

>AGL185W Chr7 (350325..350477) [153 bp, 50 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YDR139C (RUB1)
          Length = 50

 Score = 30.4 bits (67), Expect = 0.87,   Method: Composition-based stats.
 Identities = 15/35 (42%), Positives = 20/35 (57%)

Query: 16 EVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGK 50
          ++ V PE  V   KE + +   IP S QRLI+ GK
Sbjct: 14 QIDVAPEDKVYRIKELLEEQEGIPPSQQRLIFQGK 48

>KLLA0C08470g Chr3 (742530..742754) [225 bp, 74 aa] {ON} highly
          similar to uniprot|Q6Q546 Saccharomyces cerevisiae
          YNR032C-A HUB1 Ubiquitin-like protein modifier
          Length = 74

 Score = 30.8 bits (68), Expect = 0.95,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 22 ESTVSTFKEEIS-KVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHL 71
          E TV  FK+ +S ++    AS   L   G +LKD  TL+ Y + DG ++ L
Sbjct: 21 EDTVGDFKKVLSVQLGTASASKIVLQKGGSVLKDHITLEDYEVHDGTNLEL 71

>KLTH0G11132g Chr7 complement(934626..938645) [4020 bp, 1339 aa] {ON}
            similar to uniprot|P53115 Saccharomyces cerevisiae
            YGL150C
          Length = 1339

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 26/40 (65%), Gaps = 4/40 (10%)

Query: 329  ETQLRQLNEMGFF--DFDRNVAALRRSGGSVQGALDSLLN 366
            +TQLR+LN+  F   D  RN+  L +S  S +G LDSLLN
Sbjct: 1031 KTQLRELNKNSFIVEDERRNLVTLSKS--STKGVLDSLLN 1068

>KNAG0G00510 Chr7 complement(85742..86869) [1128 bp, 375 aa] {ON}
          Anc_1.480 YEL037C
          Length = 375

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 35/63 (55%), Gaps = 2/63 (3%)

Query: 12 QNKWEVTVDPE-STVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDG-HSV 69
          +NK  + VD E  +V   KE+++   +  A   +LI+SGK+L+D +      L++  H +
Sbjct: 11 KNKETLDVDLEHESVKDVKEKLAAARDCDAEQIKLIFSGKVLQDAKPFAETGLKENDHVI 70

Query: 70 HLV 72
           +V
Sbjct: 71 MMV 73

>Kpol_541.50 s541 complement(162130..163665) [1536 bp, 511 aa] {ON}
           complement(162130..163665) [1536 nt, 512 aa]
          Length = 511

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%)

Query: 327 RYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGALDSL 364
           RY  +L +L EMGF D D N  A+  + G +  A+  L
Sbjct: 233 RYSRELNRLREMGFNDIDNNAEAMSLANGDISRAITIL 270

>TPHA0H00400 Chr8 (77122..78522) [1401 bp, 466 aa] {ON} Anc_8.142
           YGL181W
          Length = 466

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%)

Query: 327 RYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGALDSL 364
           +Y   ++ L +MG+ D D N  AL  + G +  A+D L
Sbjct: 227 KYSRHIKNLEQMGYTDIDNNAEALSIAHGDINQAIDIL 264

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
          bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 30.8 bits (68), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 11/47 (23%), Positives = 26/47 (55%)

Query: 3  TITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSG 49
          T+   +K   N + +++   +TV   KE++ +++ +P S Q+ +  G
Sbjct: 5  TLEFNVKHSGNVYPISITSSTTVQELKEQVQELTNVPVSRQKFMVKG 51

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 30.4 bits (67), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 29/49 (59%), Gaps = 7/49 (14%)

Query: 151 PDGGATNMPNQEDLL-NMLDNPIFQSQMNEMLSNPQMVDFMIQ--SNPQ 196
           PD G T M N  +L+ N+  NP    +  EM+ +PQ+V  +IQ  SNPQ
Sbjct: 128 PDMGLTQMFNDPNLIENLKKNP----KTAEMMKDPQLVAKLIQYRSNPQ 172

>Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W
           (REAL)
          Length = 396

 Score = 30.4 bits (67), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 24/38 (63%)

Query: 327 RYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGALDSL 364
           RY  QL +L +MG+ D  +N+ AL  + G++  ++D L
Sbjct: 194 RYSRQLIELRDMGYNDTAKNLDALSFAHGNINRSIDYL 231

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.129    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,185,615
Number of extensions: 1111162
Number of successful extensions: 3557
Number of sequences better than 10.0: 176
Number of HSP's gapped: 3601
Number of HSP's successfully gapped: 282
Length of query: 369
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 258
Effective length of database: 40,753,473
Effective search space: 10514396034
Effective search space used: 10514396034
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 66 (30.0 bits)