Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0G13970g8.830ON1121025271e-70
KLLA0D01661g8.830ON1121023483e-43
Kpol_1069.38.830ON1151093414e-42
YML108W8.830ON1051023335e-41
TDEL0B006708.830ON1111093311e-40
CAGL0J06666g8.830ON1121013311e-40
SAKL0D01738g8.830ON1781033326e-40
Smik_13.268.830ON105993213e-39
Suva_13.368.830ON1051043204e-39
Skud_13.338.830ON105993204e-39
KNAG0G033608.830ON1111053128e-38
TBLA0B031908.830ON1221213139e-38
Kwal_27.103288.830ON1271023042e-36
TPHA0I001908.830ON138753026e-36
NDAI0E003608.830ON1221213007e-36
KLTH0C04070g8.830ON1131022991e-35
Ecym_27118.830ON115992991e-35
AAL184W8.830ON112992971e-35
NCAS0B011008.830ON115802884e-34
KAFR0A027608.830ON1121082772e-32
KLLA0B01738g5.573ON61422632.6
Kpol_1050.805.75ON150576623.8
TBLA0C062908.876ON50381624.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0G13970g
         (112 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0G13970g Chr7 complement(1111500..1111838) [339 bp, 112 aa] ...   207   1e-70
KLLA0D01661g Chr4 complement(148193..148531) [339 bp, 112 aa] {O...   138   3e-43
Kpol_1069.3 s1069 (4998..5345) [348 bp, 115 aa] {ON} (4998..5345...   135   4e-42
YML108W Chr13 (54793..55110) [318 bp, 105 aa] {ON} Putative prot...   132   5e-41
TDEL0B00670 Chr2 (127614..127949) [336 bp, 111 aa] {ON} Anc_8.83...   132   1e-40
CAGL0J06666g Chr10 complement(639077..639415) [339 bp, 112 aa] {...   132   1e-40
SAKL0D01738g Chr4 (138687..139223) [537 bp, 178 aa] {ON} similar...   132   6e-40
Smik_13.26 Chr13 (51023..51340) [318 bp, 105 aa] {ON} YML108W (R...   128   3e-39
Suva_13.36 Chr13 (54612..54929) [318 bp, 105 aa] {ON} YML108W (R...   127   4e-39
Skud_13.33 Chr13 (54349..54666) [318 bp, 105 aa] {ON} YML108W (R...   127   4e-39
KNAG0G03360 Chr7 complement(723353..723688) [336 bp, 111 aa] {ON...   124   8e-38
TBLA0B03190 Chr2 complement(742438..742806) [369 bp, 122 aa] {ON...   125   9e-38
Kwal_27.10328 s27 (287686..288069) [384 bp, 127 aa] {ON} YML108W...   121   2e-36
TPHA0I00190 Chr9 complement(33784..34200) [417 bp, 138 aa] {ON} ...   120   6e-36
NDAI0E00360 Chr5 (57992..58360) [369 bp, 122 aa] {ON} Anc_8.830 ...   120   7e-36
KLTH0C04070g Chr3 (355923..356264) [342 bp, 113 aa] {ON} similar...   119   1e-35
Ecym_2711 Chr2 (1376908..1377255) [348 bp, 115 aa] {ON} similar ...   119   1e-35
AAL184W Chr1 (12906..13244) [339 bp, 112 aa] {ON} Syntenic homol...   119   1e-35
NCAS0B01100 Chr2 complement(181912..182259) [348 bp, 115 aa] {ON...   115   4e-34
KAFR0A02760 Chr1 complement(575048..575386) [339 bp, 112 aa] {ON...   111   2e-32
KLLA0B01738g Chr2 (137171..139015) [1845 bp, 614 aa] {ON} simila...    29   2.6  
Kpol_1050.80 s1050 complement(173056..177573) [4518 bp, 1505 aa]...    28   3.8  
TBLA0C06290 Chr3 complement(1521582..1523093) [1512 bp, 503 aa] ...    28   4.3  

>ZYRO0G13970g Chr7 complement(1111500..1111838) [339 bp, 112 aa]
           {ON} highly similar to uniprot|Q03759 Saccharomyces
           cerevisiae YML108W defines a new subfamily of the split
           beta-alpha-beta sandwiches.
          Length = 112

 Score =  207 bits (527), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%)

Query: 1   MSGPENSYRMLVLLEEPVSGSKPEDEKKVHEFMDELVLPFNVDEIDQLNSWFDKFDEQIC 60
           MSGPENSYRMLVLLEEPVSGSKPEDEKKVHEFMDELVLPFNVDEIDQLNSWFDKFDEQIC
Sbjct: 1   MSGPENSYRMLVLLEEPVSGSKPEDEKKVHEFMDELVLPFNVDEIDQLNSWFDKFDEQIC 60

Query: 61  IPNEGHIKYEITSDGIIVLILDKEMEPLVSQVRSFVEKHGNR 102
           IPNEGHIKYEITSDGIIVLILDKEMEPLVSQVRSFVEKHGNR
Sbjct: 61  IPNEGHIKYEITSDGIIVLILDKEMEPLVSQVRSFVEKHGNR 102

>KLLA0D01661g Chr4 complement(148193..148531) [339 bp, 112 aa] {ON}
           similar to uniprot|Q03759 Saccharomyces cerevisiae
           YML108W defines a new subfamily of the split beta-alpha-
           beta sandwiches.
          Length = 112

 Score =  138 bits (348), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 69/102 (67%), Positives = 83/102 (81%), Gaps = 3/102 (2%)

Query: 1   MSGPENSYRMLVLLEEPVSGSKPEDEKK---VHEFMDELVLPFNVDEIDQLNSWFDKFDE 57
           MS  EN YRML+LLEEP+S S  + +KK    HEF+DEL LP  VDE+D LNSWFDKFDE
Sbjct: 1   MSATENVYRMLILLEEPISESAGDTKKKQNATHEFVDELPLPIQVDEMDLLNSWFDKFDE 60

Query: 58  QICIPNEGHIKYEITSDGIIVLILDKEMEPLVSQVRSFVEKH 99
           +ICIPNEGHIKYEI+SDG+IVLILDK +E +V +V SFVE++
Sbjct: 61  KICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQN 102

>Kpol_1069.3 s1069 (4998..5345) [348 bp, 115 aa] {ON} (4998..5345)
           [348 nt, 116 aa]
          Length = 115

 Score =  135 bits (341), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 84/109 (77%), Gaps = 11/109 (10%)

Query: 2   SGPENSYRMLVLLEEPVSG-----------SKPEDEKKVHEFMDELVLPFNVDEIDQLNS 50
            G E++YRML+LLEE +              +P++ KK+HEF+DELVLPF VDEID LN 
Sbjct: 3   GGAESNYRMLILLEEGMENLDEEQTQQDRTEEPKESKKMHEFVDELVLPFQVDEIDSLND 62

Query: 51  WFDKFDEQICIPNEGHIKYEITSDGIIVLILDKEMEPLVSQVRSFVEKH 99
           WFDKFDE+ICIPNEGHIKYEITSDGIIVLILDKE+E ++ +V+ FV+ +
Sbjct: 63  WFDKFDEEICIPNEGHIKYEITSDGIIVLILDKEIENVLDKVKEFVQSN 111

>YML108W Chr13 (54793..55110) [318 bp, 105 aa] {ON} Putative protein
           of unknown function whose structure defines a new
           subfamily of the split beta-alpha-beta sandwiches; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; YML108W is not an essential
           gene
          Length = 105

 Score =  132 bits (333), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 85/102 (83%), Gaps = 8/102 (7%)

Query: 6   NSYRMLVLLEEPVSGSKPEDEK-------KVHEFMDELVLPFNVDEIDQLNSWFDKFDEQ 58
           N+YRMLVLLE+    +K EDEK       K+HEF+DEL+LPFNVDE+D+LN+WFDKFD +
Sbjct: 5   NTYRMLVLLEDDTKINK-EDEKFLKGKPGKMHEFVDELILPFNVDELDELNTWFDKFDAE 63

Query: 59  ICIPNEGHIKYEITSDGIIVLILDKEMEPLVSQVRSFVEKHG 100
           ICIPNEGHIKYEI+SDG+IVL+LDKE+E +V +V+ FVE++ 
Sbjct: 64  ICIPNEGHIKYEISSDGLIVLMLDKEIEEVVEKVKKFVEENN 105

>TDEL0B00670 Chr2 (127614..127949) [336 bp, 111 aa] {ON} Anc_8.830
           YML108W
          Length = 111

 Score =  132 bits (331), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 64/109 (58%), Positives = 82/109 (75%), Gaps = 10/109 (9%)

Query: 1   MSGPENSYRMLVLLEEPV----------SGSKPEDEKKVHEFMDELVLPFNVDEIDQLNS 50
           M G +N Y M++ LEE +          +G   +D K  HEF+DELVLPF VDEID LN 
Sbjct: 1   MGGNDNFYHMIIFLEESIENGQEGNSVDNGEDKQDVKSSHEFVDELVLPFQVDEIDALNE 60

Query: 51  WFDKFDEQICIPNEGHIKYEITSDGIIVLILDKEMEPLVSQVRSFVEKH 99
           WFDKFDE++CIPNEGHIKYEITSDG++VL+LDKE+E LV+ V++FVE++
Sbjct: 61  WFDKFDEKLCIPNEGHIKYEITSDGMMVLLLDKELEHLVNDVKTFVEEN 109

>CAGL0J06666g Chr10 complement(639077..639415) [339 bp, 112 aa] {ON}
           similar to uniprot|Q03759 Saccharomyces cerevisiae
           YML108w
          Length = 112

 Score =  132 bits (331), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 83/101 (82%), Gaps = 6/101 (5%)

Query: 6   NSYRMLVLLEEP----VSGSKPEDEKKV-HEFMDELVLPFNVDEIDQLNSWFDKFDEQIC 60
           N YRM+VLLEEP    ++ S  ++EKKV HEFMDEL LPF +DEID LN WFDKFD++IC
Sbjct: 3   NLYRMMVLLEEPMEEDITISDSKEEKKVMHEFMDELTLPFQIDEIDLLNKWFDKFDDEIC 62

Query: 61  IPNEGHIKYEITSDGIIVLILDKEM-EPLVSQVRSFVEKHG 100
           IPNEGHIKYEITSDG+IVLILDKE+ E  V +V++FVE++ 
Sbjct: 63  IPNEGHIKYEITSDGLIVLILDKELGEEFVGKVKTFVEQNN 103

>SAKL0D01738g Chr4 (138687..139223) [537 bp, 178 aa] {ON} similar to
           uniprot|Q03759 Saccharomyces cerevisiae YML108W defines
           a new subfamily of the split beta-alpha- beta
           sandwiches.
          Length = 178

 Score =  132 bits (332), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 81/103 (78%), Gaps = 5/103 (4%)

Query: 1   MSGPENSYRMLVLLEEPVSGSKPEDE----KKVHEFMDELVLPFNVDEIDQLNSWFDKFD 56
           MSG +N YRML+LLEE +  S  E+     K  HEF+DELVLP  VDE+D LN WFDKFD
Sbjct: 70  MSG-DNGYRMLMLLEEAIPDSSQENNENTTKTSHEFVDELVLPIQVDEMDLLNDWFDKFD 128

Query: 57  EQICIPNEGHIKYEITSDGIIVLILDKEMEPLVSQVRSFVEKH 99
           EQICIPNEG+IKYEI+SDG+IVLIL+KE E +V +VR FVE+H
Sbjct: 129 EQICIPNEGYIKYEISSDGLIVLILNKEREEVVDKVRRFVEEH 171

>Smik_13.26 Chr13 (51023..51340) [318 bp, 105 aa] {ON} YML108W
           (REAL)
          Length = 105

 Score =  128 bits (321), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 64/99 (64%), Positives = 82/99 (82%), Gaps = 8/99 (8%)

Query: 6   NSYRMLVLLEEPVSGSKPEDEK-------KVHEFMDELVLPFNVDEIDQLNSWFDKFDEQ 58
           N+YRMLVLLE+    +K EDEK       K+HEF+DEL+LPF+VDE+D+LN WFDKFD +
Sbjct: 5   NTYRMLVLLEDDAKVNK-EDEKFLKGKPGKMHEFVDELILPFDVDELDELNIWFDKFDAE 63

Query: 59  ICIPNEGHIKYEITSDGIIVLILDKEMEPLVSQVRSFVE 97
           ICIPNEGHIKYEI+SDG+IVL+LDKE+E ++ +V+ FVE
Sbjct: 64  ICIPNEGHIKYEISSDGLIVLMLDKEIEEVIEKVKQFVE 102

>Suva_13.36 Chr13 (54612..54929) [318 bp, 105 aa] {ON} YML108W
           (REAL)
          Length = 105

 Score =  127 bits (320), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 65/104 (62%), Positives = 83/104 (79%), Gaps = 8/104 (7%)

Query: 3   GPENSYRMLVLLEEPVSGSKPEDEK-------KVHEFMDELVLPFNVDEIDQLNSWFDKF 55
              N+YRMLVLLE+    +K EDEK       K+HEF+DEL+LPF VDE+D+LN WFDKF
Sbjct: 2   AKNNTYRMLVLLEDDTKINK-EDEKFLKGKPGKMHEFVDELMLPFQVDELDELNVWFDKF 60

Query: 56  DEQICIPNEGHIKYEITSDGIIVLILDKEMEPLVSQVRSFVEKH 99
           D +ICIPNEGHIKYEI+SDG+IVL+LDKE+E +V +V+ FVE++
Sbjct: 61  DAEICIPNEGHIKYEISSDGLIVLMLDKEIEDVVEKVKRFVEEN 104

>Skud_13.33 Chr13 (54349..54666) [318 bp, 105 aa] {ON} YML108W
           (REAL)
          Length = 105

 Score =  127 bits (320), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 64/99 (64%), Positives = 82/99 (82%), Gaps = 8/99 (8%)

Query: 6   NSYRMLVLLEEPVSGSKPEDEK-------KVHEFMDELVLPFNVDEIDQLNSWFDKFDEQ 58
           N+YRMLVLLE+    SK EDEK       K+HEF+DEL+LPF +DE+D+LN WFDKFD +
Sbjct: 5   NAYRMLVLLEDDTKISK-EDEKFLKGKPGKMHEFVDELILPFEIDELDELNIWFDKFDAE 63

Query: 59  ICIPNEGHIKYEITSDGIIVLILDKEMEPLVSQVRSFVE 97
           ICIPNEGHIKYEI+SDG+IVL+LDKE++ +V +V++FVE
Sbjct: 64  ICIPNEGHIKYEISSDGLIVLMLDKEIQEVVEKVKNFVE 102

>KNAG0G03360 Chr7 complement(723353..723688) [336 bp, 111 aa] {ON}
           Anc_8.830 YML108W
          Length = 111

 Score =  124 bits (312), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 78/105 (74%), Gaps = 10/105 (9%)

Query: 5   ENSYRMLVLLEEPVSGSKPEDE----------KKVHEFMDELVLPFNVDEIDQLNSWFDK 54
           +++YRML+L+EEP+    P  E          K  HE++DEL LPF +DE+D LN WFDK
Sbjct: 6   DDTYRMLILVEEPLEDDVPTTEVTSEDGSQPIKSTHEYIDELHLPFGLDELDALNEWFDK 65

Query: 55  FDEQICIPNEGHIKYEITSDGIIVLILDKEMEPLVSQVRSFVEKH 99
           FDE+ICIPNEGHIKYEI+SDG+IVL+L KE+E +  Q++SF+E H
Sbjct: 66  FDEEICIPNEGHIKYEISSDGLIVLMLGKEIEHVYEQIKSFIETH 110

>TBLA0B03190 Chr2 complement(742438..742806) [369 bp, 122 aa] {ON}
           Anc_8.830 YML108W
          Length = 122

 Score =  125 bits (313), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 64/121 (52%), Positives = 82/121 (67%), Gaps = 22/121 (18%)

Query: 1   MSGPENSYRMLVLLEE----------------------PVSGSKPEDEKKVHEFMDELVL 38
           MS    +YRM+VLLEE                       V+ +K  + KK HEF+DEL+L
Sbjct: 1   MSSNSVAYRMMVLLEEDMEPIEDDINLKSESSSNDNTEKVTTTKNTEPKKSHEFIDELIL 60

Query: 39  PFNVDEIDQLNSWFDKFDEQICIPNEGHIKYEITSDGIIVLILDKEMEPLVSQVRSFVEK 98
           PF+VDE+D LN WFDKFDEQICIPNEGHIKYEITSDG+I+LILD +++ +V QV+ FV+ 
Sbjct: 61  PFHVDELDILNEWFDKFDEQICIPNEGHIKYEITSDGLIILILDNDIKHVVEQVKDFVQN 120

Query: 99  H 99
           +
Sbjct: 121 N 121

>Kwal_27.10328 s27 (287686..288069) [384 bp, 127 aa] {ON} YML108W -
           Hypothetical ORF [contig 36] FULL
          Length = 127

 Score =  121 bits (304), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 58/102 (56%), Positives = 77/102 (75%), Gaps = 9/102 (8%)

Query: 5   ENSYRMLVLLEEPVS------GSKPEDE---KKVHEFMDELVLPFNVDEIDQLNSWFDKF 55
           E +YRMLVL+E+PV       G K E+    K  HEF+DEL+LPF +D++D LN WFDKF
Sbjct: 18  ERAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNEWFDKF 77

Query: 56  DEQICIPNEGHIKYEITSDGIIVLILDKEMEPLVSQVRSFVE 97
           D +ICIPNEG IKYEI+SDG++VL+LD+  E +V++VR FV+
Sbjct: 78  DAEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFVQ 119

>TPHA0I00190 Chr9 complement(33784..34200) [417 bp, 138 aa] {ON}
           Anc_8.830 YML108W
          Length = 138

 Score =  120 bits (302), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 67/75 (89%)

Query: 22  KPEDEKKVHEFMDELVLPFNVDEIDQLNSWFDKFDEQICIPNEGHIKYEITSDGIIVLIL 81
           K E + K HEF+DEL+LPFNVDE+D LN WFDKFD+++CIPNEGHIKYEITSDG+IVL+L
Sbjct: 41  KGETQSKSHEFVDELILPFNVDELDMLNEWFDKFDDEVCIPNEGHIKYEITSDGLIVLML 100

Query: 82  DKEMEPLVSQVRSFV 96
           DKE+E +VS+V+ FV
Sbjct: 101 DKEIEHVVSKVKEFV 115

>NDAI0E00360 Chr5 (57992..58360) [369 bp, 122 aa] {ON} Anc_8.830
           YML108W
          Length = 122

 Score =  120 bits (300), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 83/121 (68%), Gaps = 22/121 (18%)

Query: 1   MSGPENSYRMLVLLEEPVS------GSKPE------------DE----KKVHEFMDELVL 38
           MS   N YR+++LLEE +       GS  E            DE    KK+HEF++EL+L
Sbjct: 1   MSSTNNMYRLMILLEEEIGEPDLKDGSIDEATETETKDVHNSDEEKNVKKMHEFIEELIL 60

Query: 39  PFNVDEIDQLNSWFDKFDEQICIPNEGHIKYEITSDGIIVLILDKEMEPLVSQVRSFVEK 98
           PF  +E+D LN WFDKFDE+ICIPNEGHIKYEITSDG+IVL+LDKE+E +V +++ F+E 
Sbjct: 61  PFGTEELDLLNEWFDKFDEEICIPNEGHIKYEITSDGLIVLLLDKEIEDVVGEIKKFIET 120

Query: 99  H 99
           +
Sbjct: 121 N 121

>KLTH0C04070g Chr3 (355923..356264) [342 bp, 113 aa] {ON} similar to
           uniprot|Q03759 Saccharomyces cerevisiae YML108W defines
           a new subfamily of the split beta-alpha- beta
           sandwiches.
          Length = 113

 Score =  119 bits (299), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 59/102 (57%), Positives = 77/102 (75%), Gaps = 9/102 (8%)

Query: 5   ENSYRMLVLLEEPV--SGSKPEDE-------KKVHEFMDELVLPFNVDEIDQLNSWFDKF 55
           E +YRMLVL+E+ +  +G K E E       K  HEF+DEL+LPF +D++D+LN WFDKF
Sbjct: 4   ERNYRMLVLVEDVLEQAGEKNEQETKGEGAPKATHEFVDELILPFEIDDMDKLNEWFDKF 63

Query: 56  DEQICIPNEGHIKYEITSDGIIVLILDKEMEPLVSQVRSFVE 97
           D  ICIPNEG IKYEI+SDG++VL+LD+  E +V+QVR FVE
Sbjct: 64  DADICIPNEGFIKYEISSDGLVVLLLDRSKEDVVAQVRKFVE 105

>Ecym_2711 Chr2 (1376908..1377255) [348 bp, 115 aa] {ON} similar to
           Ashbya gossypii AAL184W
          Length = 115

 Score =  119 bits (299), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 56/99 (56%), Positives = 78/99 (78%), Gaps = 2/99 (2%)

Query: 3   GPENSYRMLVLLEEPVSGSKPEDEKK--VHEFMDELVLPFNVDEIDQLNSWFDKFDEQIC 60
             +N YRM++LLEE +  SK E+ K    H+F+DE+VLP  VDE+D LN WFDKFDE+IC
Sbjct: 5   SADNFYRMMILLEEAIPESKDENIKANATHDFVDEVVLPMQVDELDVLNKWFDKFDEEIC 64

Query: 61  IPNEGHIKYEITSDGIIVLILDKEMEPLVSQVRSFVEKH 99
           +PNEG+IKYEI+SDG+IVL++ +E   +V+QV++FV K+
Sbjct: 65  LPNEGYIKYEISSDGLIVLMVSQERSSIVNQVKNFVAKN 103

>AAL184W Chr1 (12906..13244) [339 bp, 112 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YML108W
          Length = 112

 Score =  119 bits (297), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 58/99 (58%), Positives = 75/99 (75%), Gaps = 7/99 (7%)

Query: 3  GPENSYRMLVLLEEP-----VSGSKPEDEKKVHEFMDELVLPFNVDEIDQLNSWFDKFDE 57
            +N YRM++LLEEP       G K E+    H+F+DEL+LP  VD+++ LN+WFDKFDE
Sbjct: 2  ATDNFYRMMILLEEPHKQHSTDGRKIENAS--HDFVDELLLPIQVDDLEVLNTWFDKFDE 59

Query: 58 QICIPNEGHIKYEITSDGIIVLILDKEMEPLVSQVRSFV 96
          +ICIPNEGHIKYEI+SDG+IVLILDKE+  ++  VR FV
Sbjct: 60 EICIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFV 98

>NCAS0B01100 Chr2 complement(181912..182259) [348 bp, 115 aa] {ON}
           Anc_8.830 YML108W
          Length = 115

 Score =  115 bits (288), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 51/80 (63%), Positives = 68/80 (85%)

Query: 18  VSGSKPEDEKKVHEFMDELVLPFNVDEIDQLNSWFDKFDEQICIPNEGHIKYEITSDGII 77
            + SK  + KK HEF++EL+LPF V E+D LN WFDKFDE+ICIPNEGHIKYEI+SDG+I
Sbjct: 27  TTDSKATEPKKTHEFIEELLLPFEVSELDALNKWFDKFDEEICIPNEGHIKYEISSDGLI 86

Query: 78  VLILDKEMEPLVSQVRSFVE 97
           VL+LDKE+E ++S+V+ F++
Sbjct: 87  VLLLDKEIENVISEVKKFID 106

>KAFR0A02760 Chr1 complement(575048..575386) [339 bp, 112 aa] {ON}
           Anc_8.830 YML108W
          Length = 112

 Score =  111 bits (277), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 57/108 (52%), Positives = 79/108 (73%), Gaps = 12/108 (11%)

Query: 1   MSGPENSYRMLVL-----------LEEPVSGSKPEDEK-KVHEFMDELVLPFNVDEIDQL 48
           M+G +N YRMLVL            E+  +G +P+ E  K HEF++EL+LPF   E+D L
Sbjct: 1   MAGSDNRYRMLVLLEEESEEVIEKFEDNDNGEQPKQESTKSHEFIEELILPFETSELDTL 60

Query: 49  NSWFDKFDEQICIPNEGHIKYEITSDGIIVLILDKEMEPLVSQVRSFV 96
           N WFDKFDE+ICIPNEG+IKYEI+SDG++VL++DK++E +V +V+ FV
Sbjct: 61  NEWFDKFDEEICIPNEGNIKYEISSDGLVVLLIDKQIENVVEKVKEFV 108

>KLLA0B01738g Chr2 (137171..139015) [1845 bp, 614 aa] {ON} similar
           to uniprot|Q04121 Saccharomyces cerevisiae YDR456W NHX1
           Endosomal Na+/H+ exchanger
          Length = 614

 Score = 28.9 bits (63), Expect = 2.6,   Method: Composition-based stats.
 Identities = 11/22 (50%), Positives = 15/22 (68%)

Query: 41  NVDEIDQLNSWFDKFDEQICIP 62
           +VD+I Q + WF  FDEQ+  P
Sbjct: 563 SVDKIFQQDQWFANFDEQVLKP 584

>Kpol_1050.80 s1050 complement(173056..177573) [4518 bp, 1505 aa] {ON}
            complement(173056..177573) [4518 nt, 1506 aa]
          Length = 1505

 Score = 28.5 bits (62), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 37/76 (48%)

Query: 22   KPEDEKKVHEFMDELVLPFNVDEIDQLNSWFDKFDEQICIPNEGHIKYEITSDGIIVLIL 81
            K + EK +  +  E  L FN D+I+ ++     +D  + +   G  K  + ++ I +L+ 
Sbjct: 1020 KKDGEKPIIPYTIEKDLSFNEDQINAIDKVMRAYDYSLILGMPGTGKTTVIAEIIKILVA 1079

Query: 82   DKEMEPLVSQVRSFVE 97
            +K+   L S   S V+
Sbjct: 1080 NKKTILLTSYTHSAVD 1095

>TBLA0C06290 Chr3 complement(1521582..1523093) [1512 bp, 503 aa]
           {ON} Anc_8.876 YML097C
          Length = 503

 Score = 28.5 bits (62), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 40/81 (49%), Gaps = 15/81 (18%)

Query: 31  EFMDELVLPFNVDEIDQLNSWFDKFDEQICIPNEGHIKYEITSDG-------------II 77
           E +D+ V  F+VDE+ ++N +    D+ +CI N   + + I                 +I
Sbjct: 208 ERLDKFV-NFSVDELSKVNGYKAPRDKVVCILNSCKVLFGILKQSQLEGKGADTFIPLLI 266

Query: 78  VLILDKEMEPLVSQVRSFVEK 98
             +L  ++E LVS VR ++E+
Sbjct: 267 YTLLKSDIENLVSNVR-YIER 286

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.138    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,546,774
Number of extensions: 561762
Number of successful extensions: 1368
Number of sequences better than 10.0: 30
Number of HSP's gapped: 1349
Number of HSP's successfully gapped: 30
Length of query: 112
Length of database: 53,481,399
Length adjustment: 82
Effective length of query: 30
Effective length of database: 44,078,787
Effective search space: 1322363610
Effective search space used: 1322363610
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 59 (27.3 bits)