Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0G13948g8.829ON38438419060.0
Smik_13.4858.829ON38438314220.0
TDEL0B006808.829ON38338214210.0
SAKL0D01760g8.829ON38138214140.0
YMR272C (SCS7)8.829ON38438514100.0
Skud_13.4448.829ON38438514090.0
KLLA0D01639g8.829ON38138214050.0
Suva_13.4608.829ON38438513950.0
KLTH0C04114g8.829ON37838413560.0
Kwal_27.103328.829ON37838413001e-179
NCAS0C004708.829ON42638212891e-177
Kpol_541.98.829ON37438412431e-171
AAL183W8.829ON37737812261e-168
CAGL0F03399g8.829ON38038412031e-164
NDAI0K004708.829ON38638311901e-162
KAFR0B038508.829ON37738411611e-158
Ecym_27128.829ON38138411511e-157
TBLA0D031808.829ON40038611501e-156
KNAG0J003208.829ON37338411261e-153
TPHA0C047108.829ON37738310991e-149
Kpol_1069.48.829ON2772567595e-99
NDAI0F027302.166ON121761661e-13
TDEL0F012102.166ON126711661e-13
Kpol_505.142.166ON123761616e-13
NCAS0G025702.166ON121711591e-12
TBLA0B013102.166ON123721564e-12
KLTH0A04026gna 1ON2331221616e-12
Skud_14.2212.166ON120761546e-12
ZYRO0B09812g2.166ON1831091586e-12
KAFR0B045502.166ON126971521e-11
Kwal_26.84612.166ON123761502e-11
CAGL0L03828g2.166ON121711493e-11
KLTH0D09284g2.166ON123761484e-11
KNAG0I020402.166ON119761475e-11
TPHA0F017902.166ON182761507e-11
KLLA0F27577gna 1ON172791481e-10
Suva_14.2282.166ON120761432e-10
SAKL0F08316gna 1ON178891453e-10
SAKL0E10626g2.166ON123881413e-10
AFL223W2.166ON165821411e-09
Kwal_47.18167na 1ON227931431e-09
Smik_14.2162.166ON1201151362e-09
YNL111C (CYB5)2.166ON120871343e-09
ADL085Cna 1ON273531371e-08
Ecym_54202.166ON145831311e-08
KLTH0D06930g2.536ON204871342e-08
TPHA0B018204.304ON576541382e-08
NCAS0A02770na 2ON609611373e-08
TDEL0H02180na 1ON203671296e-08
Ecym_4346na 1ON209501288e-08
TDEL0D00190singletonON552741321e-07
KNAG0E038604.304ON604601311e-07
KLLA0F23672g2.166ON123761221e-07
KLLA0B14795gna 3ON556501293e-07
ZYRO0C18524gsingletonON554421274e-07
SAKL0F16610gsingletonON564481275e-07
KLLA0D02640g4.304ON589521266e-07
ZYRO0B02090g2.536ON194821217e-07
ZYRO0D16654gna 1ON190601208e-07
KLTH0C11770gsingletonON618501259e-07
SAKL0G16852g4.304ON580611241e-06
Kpol_1014.54.304ON596561241e-06
NDAI0D047104.304ON616531241e-06
Suva_13.1054.304ON591541232e-06
Skud_13.924.304ON591541222e-06
NDAI0D04700na 2ON625621213e-06
KAFR0I005204.304ON586621203e-06
Kwal_23.2823na 3ON5601151194e-06
Smik_13.924.304ON591541195e-06
YML054C (CYB2)4.304ON591541195e-06
KLTH0C11858gsingletonON5551141186e-06
NCAS0A027804.304ON602541186e-06
Kwal_26.80462.536ON198771137e-06
ZYRO0B13728g4.304ON598521161e-05
CAGL0K10736g4.304ON593521123e-05
TDEL0D011404.304ON584611114e-05
SAKL0A09570g2.536ON211571075e-05
CAGL0K03069g2.536ON194471058e-05
NDAI0H013702.536ON224661059e-05
NCAS0F008702.536ON189661031e-04
KAFR0A047406.106ON4831101052e-04
Kwal_14.807singletonON578491026e-04
KNAG0C057802.536ON18074960.001
TDEL0A031102.536ON20081960.001
TBLA0I015302.536ON22153940.002
Kpol_478.176.106ON48494950.003
Kpol_348.122.536ON21768920.004
TPHA0G035502.536ON21858910.005
NDAI0I016206.106ON44193930.006
CAGL0I00418g6.106ON490103920.007
KNAG0F032506.106ON48971910.011
KAFR0A018902.536ON16156860.017
Skud_7.2266.106ON50968880.028
YGL055W (OLE1)6.106ON51068880.029
Smik_7.2256.106ON51068870.034
TBLA0C06220singletonON49446870.035
KLLA0E18459g2.536ON14871800.074
AAR153C6.106ON47873830.098
TDEL0E03250na 4ON53690830.099
AAL078Wna 4ON59276830.10
NCAS0D032506.106ON49773820.12
Ecym_30806.106ON47968800.21
SAKL0A07326g6.106ON48046800.21
TPHA0B027006.106ON48868790.27
Skud_13.2292.536ON20153770.28
SAKL0G10274gna 4ON522109790.32
ZYRO0C05016g6.106ON48390780.38
Suva_13.2502.536ON20153760.40
Kwal_23.5693na 4ON51346780.43
KLTH0H06798g6.106ON48873770.47
Smik_13.2522.536ON20143750.50
KLLA0C05566g6.106ON47773760.66
ZYRO0E01496g2.617ON877136760.86
KLTH0G06358gna 4ON51346751.1
Ecym_72512.536ON19538721.4
TDEL0G036506.106ON48346741.4
KLLA0C10692gna 4ON52083741.4
Ecym_3180na 4ON62151741.4
YMR073C (IRC21)2.536ON20153711.6
ZYRO0G16742gna 4ON54374722.2
TPHA0I015808.599ON124691704.2
Kwal_14.18456.106ON28846685.5
Ecym_2214na 5ON53134677.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0G13948g
         (384 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0G13948g Chr7 complement(1109941..1111095) [1155 bp, 384 aa]...   738   0.0  
Smik_13.485 Chr13 complement(792640..793794) [1155 bp, 384 aa] {...   552   0.0  
TDEL0B00680 Chr2 (128650..129801) [1152 bp, 383 aa] {ON} Anc_8.8...   551   0.0  
SAKL0D01760g Chr4 (140050..141195) [1146 bp, 381 aa] {ON} simila...   549   0.0  
YMR272C Chr13 complement(809623..810777) [1155 bp, 384 aa] {ON} ...   547   0.0  
Skud_13.444 Chr13 complement(783092..784246) [1155 bp, 384 aa] {...   547   0.0  
KLLA0D01639g Chr4 complement(146344..147489) [1146 bp, 381 aa] {...   545   0.0  
Suva_13.460 Chr13 complement(792221..793375) [1155 bp, 384 aa] {...   541   0.0  
KLTH0C04114g Chr3 (357195..358331) [1137 bp, 378 aa] {ON} highly...   526   0.0  
Kwal_27.10332 s27 (289484..290620) [1137 bp, 378 aa] {ON} YMR272...   505   e-179
NCAS0C00470 Chr3 (78059..79339) [1281 bp, 426 aa] {ON} Anc_8.829      501   e-177
Kpol_541.9 s541 complement(23399..24523) [1125 bp, 374 aa] {ON} ...   483   e-171
AAL183W Chr1 (13713..14846) [1134 bp, 377 aa] {ON} Syntenic homo...   476   e-168
CAGL0F03399g Chr6 complement(333955..335097) [1143 bp, 380 aa] {...   468   e-164
NDAI0K00470 Chr11 (107509..108669) [1161 bp, 386 aa] {ON} Anc_8....   462   e-162
KAFR0B03850 Chr2 complement(796399..797532) [1134 bp, 377 aa] {O...   451   e-158
Ecym_2712 Chr2 (1378070..1379215) [1146 bp, 381 aa] {ON} similar...   447   e-157
TBLA0D03180 Chr4 complement(774883..776085) [1203 bp, 400 aa] {O...   447   e-156
KNAG0J00320 Chr10 (50267..51388) [1122 bp, 373 aa] {ON} Anc_8.82...   438   e-153
TPHA0C04710 Chr3 complement(1015392..1016525) [1134 bp, 377 aa] ...   427   e-149
Kpol_1069.4 s1069 (6163..6996) [834 bp, 277 aa] {ON} (6163..6996...   296   5e-99
NDAI0F02730 Chr6 (669821..670186) [366 bp, 121 aa] {ON} Anc_2.166      69   1e-13
TDEL0F01210 Chr6 complement(216322..216702) [381 bp, 126 aa] {ON...    69   1e-13
Kpol_505.14 s505 (37085..37456) [372 bp, 123 aa] {ON} (37085..37...    67   6e-13
NCAS0G02570 Chr7 complement(460218..460583) [366 bp, 121 aa] {ON...    66   1e-12
TBLA0B01310 Chr2 (276173..276544) [372 bp, 123 aa] {ON} Anc_2.16...    65   4e-12
KLTH0A04026g Chr1 complement(337200..337901) [702 bp, 233 aa] {O...    67   6e-12
Skud_14.221 Chr14 complement(407119..407481) [363 bp, 120 aa] {O...    64   6e-12
ZYRO0B09812g Chr2 (765874..766425) [552 bp, 183 aa] {ON} similar...    65   6e-12
KAFR0B04550 Chr2 (946561..946941) [381 bp, 126 aa] {ON} Anc_2.16...    63   1e-11
Kwal_26.8461 s26 (794482..794853) [372 bp, 123 aa] {ON} YNL111C ...    62   2e-11
CAGL0L03828g Chr12 (442660..443025) [366 bp, 121 aa] {ON} simila...    62   3e-11
KLTH0D09284g Chr4 (770560..770931) [372 bp, 123 aa] {ON} similar...    62   4e-11
KNAG0I02040 Chr9 (397527..397886) [360 bp, 119 aa] {ON} Anc_2.16...    61   5e-11
TPHA0F01790 Chr6 (412270..412818) [549 bp, 182 aa] {ON} Anc_2.16...    62   7e-11
KLLA0F27577g Chr6 (2556662..2557180) [519 bp, 172 aa] {ON} some ...    62   1e-10
Suva_14.228 Chr14 complement(413753..414115) [363 bp, 120 aa] {O...    60   2e-10
SAKL0F08316g Chr6 complement(634949..635485) [537 bp, 178 aa] {O...    60   3e-10
SAKL0E10626g Chr5 (885272..885643) [372 bp, 123 aa] {ON} similar...    59   3e-10
AFL223W Chr6 (19601..20098) [498 bp, 165 aa] {ON} Syntenic homol...    59   1e-09
Kwal_47.18167 s47 complement(716570..717253) [684 bp, 227 aa] {O...    60   1e-09
Smik_14.216 Chr14 complement(396585..396947) [363 bp, 120 aa] {O...    57   2e-09
YNL111C Chr14 complement(416940..417302) [363 bp, 120 aa] {ON}  ...    56   3e-09
ADL085C Chr4 complement(535293..536114) [822 bp, 273 aa] {ON} NO...    57   1e-08
Ecym_5420 Chr5 (865505..865942) [438 bp, 145 aa] {ON} similar to...    55   1e-08
KLTH0D06930g Chr4 complement(604805..605419) [615 bp, 204 aa] {O...    56   2e-08
TPHA0B01820 Chr2 complement(406416..408146) [1731 bp, 576 aa] {O...    58   2e-08
NCAS0A02770 Chr1 (528814..530643) [1830 bp, 609 aa] {ON}               57   3e-08
TDEL0H02180 Chr8 (369539..370150) [612 bp, 203 aa] {ON}                54   6e-08
Ecym_4346 Chr4 (739106..739735) [630 bp, 209 aa] {ON} similar to...    54   8e-08
TDEL0D00190 Chr4 (29971..31629) [1659 bp, 552 aa] {ON}                 55   1e-07
KNAG0E03860 Chr5 (763388..765202) [1815 bp, 604 aa] {ON} Anc_4.3...    55   1e-07
KLLA0F23672g Chr6 (2212223..2212594) [372 bp, 123 aa] {ON} simil...    52   1e-07
KLLA0B14795g Chr2 (1299429..1301099) [1671 bp, 556 aa] {ON} simi...    54   3e-07
ZYRO0C18524g Chr3 (1450641..1452305) [1665 bp, 554 aa] {ON} simi...    54   4e-07
SAKL0F16610g Chr6 (1373674..1375368) [1695 bp, 564 aa] {ON} simi...    54   5e-07
KLLA0D02640g Chr4 complement(225482..227251) [1770 bp, 589 aa] {...    53   6e-07
ZYRO0B02090g Chr2 complement(169589..170173) [585 bp, 194 aa] {O...    51   7e-07
ZYRO0D16654g Chr4 complement(1380316..1380888) [573 bp, 190 aa] ...    51   8e-07
KLTH0C11770g Chr3 (970979..972835) [1857 bp, 618 aa] {ON} simila...    53   9e-07
SAKL0G16852g Chr7 (1452894..1454636) [1743 bp, 580 aa] {ON} simi...    52   1e-06
Kpol_1014.5 s1014 complement(3107..4897) [1791 bp, 596 aa] {ON} ...    52   1e-06
NDAI0D04710 Chr4 (1106280..1108130) [1851 bp, 616 aa] {ON} Anc_4...    52   1e-06
Suva_13.105 Chr13 complement(168279..170054) [1776 bp, 591 aa] {...    52   2e-06
Skud_13.92 Chr13 complement(163654..165429) [1776 bp, 591 aa] {O...    52   2e-06
NDAI0D04700 Chr4 (1103670..1105547) [1878 bp, 625 aa] {ON}             51   3e-06
KAFR0I00520 Chr9 complement(107239..108999) [1761 bp, 586 aa] {O...    51   3e-06
Kwal_23.2823 s23 (29032..30714) [1683 bp, 560 aa] {ON} YML054C (...    50   4e-06
Smik_13.92 Chr13 complement(163135..164910) [1776 bp, 591 aa] {O...    50   5e-06
YML054C Chr13 complement(165533..167308) [1776 bp, 591 aa] {ON} ...    50   5e-06
KLTH0C11858g Chr3 (979073..980740) [1668 bp, 555 aa] {ON} simila...    50   6e-06
NCAS0A02780 Chr1 (531072..532880) [1809 bp, 602 aa] {ON} Anc_4.304     50   6e-06
Kwal_26.8046 s26 complement(621715..622311) [597 bp, 198 aa] {ON...    48   7e-06
ZYRO0B13728g Chr2 (1110636..1112432) [1797 bp, 598 aa] {ON} simi...    49   1e-05
CAGL0K10736g Chr11 (1046127..1047908) [1782 bp, 593 aa] {ON} hig...    48   3e-05
TDEL0D01140 Chr4 complement(214858..216612) [1755 bp, 584 aa] {O...    47   4e-05
SAKL0A09570g Chr1 complement(838406..839041) [636 bp, 211 aa] {O...    46   5e-05
CAGL0K03069g Chr11 complement(285190..285774) [585 bp, 194 aa] {...    45   8e-05
NDAI0H01370 Chr8 (336807..337481) [675 bp, 224 aa] {ON} Anc_2.536      45   9e-05
NCAS0F00870 Chr6 (177678..178247) [570 bp, 189 aa] {ON} Anc_2.53...    44   1e-04
KAFR0A04740 Chr1 (942850..944301) [1452 bp, 483 aa] {ON} Anc_6.1...    45   2e-04
Kwal_14.807 s14 complement(57218..58954) [1737 bp, 578 aa] {ON} ...    44   6e-04
KNAG0C05780 Chr3 (1124591..1125133) [543 bp, 180 aa] {ON} Anc_2....    42   0.001
TDEL0A03110 Chr1 complement(554890..555492) [603 bp, 200 aa] {ON...    42   0.001
TBLA0I01530 Chr9 (334102..334767) [666 bp, 221 aa] {ON} Anc_2.53...    41   0.002
Kpol_478.17 s478 (61375..62829) [1455 bp, 484 aa] {ON} (61375..6...    41   0.003
Kpol_348.12 s348 complement(21978..22631) [654 bp, 217 aa] {ON} ...    40   0.004
TPHA0G03550 Chr7 complement(755688..756344) [657 bp, 218 aa] {ON...    40   0.005
NDAI0I01620 Chr9 complement(382761..384086) [1326 bp, 441 aa] {O...    40   0.006
CAGL0I00418g Chr9 (30058..31530) [1473 bp, 490 aa] {ON} highly s...    40   0.007
KNAG0F03250 Chr6 complement(607667..609136) [1470 bp, 489 aa] {O...    40   0.011
KAFR0A01890 Chr1 complement(392001..392486) [486 bp, 161 aa] {ON...    38   0.017
Skud_7.226 Chr7 (402118..403647) [1530 bp, 509 aa] {ON} YGL055W ...    39   0.028
YGL055W Chr7 (398628..400160) [1533 bp, 510 aa] {ON}  OLE1Delta(...    39   0.029
Smik_7.225 Chr7 (393200..394732) [1533 bp, 510 aa] {ON} YGL055W ...    38   0.034
TBLA0C06220 Chr3 (1507690..1509174) [1485 bp, 494 aa] {ON}             38   0.035
KLLA0E18459g Chr5 (1641507..1641953) [447 bp, 148 aa] {ON} simil...    35   0.074
AAR153C Chr1 complement(619953..621389) [1437 bp, 478 aa] {ON} S...    37   0.098
TDEL0E03250 Chr5 complement(612008..613618) [1611 bp, 536 aa] {O...    37   0.099
AAL078W Chr1 (209600..211378) [1779 bp, 592 aa] {ON} Non-synteni...    37   0.10 
NCAS0D03250 Chr4 (608476..609969) [1494 bp, 497 aa] {ON} Anc_6.106     36   0.12 
Ecym_3080 Chr3 (149461..150900) [1440 bp, 479 aa] {ON} similar t...    35   0.21 
SAKL0A07326g Chr1 (648420..649862) [1443 bp, 480 aa] {ON} unipro...    35   0.21 
TPHA0B02700 Chr2 (620423..621889) [1467 bp, 488 aa] {ON} Anc_6.1...    35   0.27 
Skud_13.229 Chr13 complement(386598..387203) [606 bp, 201 aa] {O...    34   0.28 
SAKL0G10274g Chr7 complement(874738..876306) [1569 bp, 522 aa] {...    35   0.32 
ZYRO0C05016g Chr3 (394581..396032) [1452 bp, 483 aa] {ON} simila...    35   0.38 
Suva_13.250 Chr13 complement(393510..394115) [606 bp, 201 aa] {O...    34   0.40 
Kwal_23.5693 s23 (1277807..1279348) [1542 bp, 513 aa] {ON} YGL05...    35   0.43 
KLTH0H06798g Chr8 (596966..598432) [1467 bp, 488 aa] {ON} unipro...    34   0.47 
Smik_13.252 Chr13 complement(396365..396970) [606 bp, 201 aa] {O...    33   0.50 
KLLA0C05566g Chr3 complement(497877..499310) [1434 bp, 477 aa] {...    34   0.66 
ZYRO0E01496g Chr5 complement(108148..110756,110823..110847) [263...    34   0.86 
KLTH0G06358g Chr7 complement(503325..504866) [1542 bp, 513 aa] {...    33   1.1  
Ecym_7251 Chr7 (530372..530959) [588 bp, 195 aa] {ON} similar to...    32   1.4  
TDEL0G03650 Chr7 (673347..674798) [1452 bp, 483 aa] {ON} Anc_6.1...    33   1.4  
KLLA0C10692g Chr3 complement(916718..918280) [1563 bp, 520 aa] {...    33   1.4  
Ecym_3180 Chr3 (344929..346794) [1866 bp, 621 aa] {ON} similar t...    33   1.4  
YMR073C Chr13 complement(412268..412873) [606 bp, 201 aa] {ON}  ...    32   1.6  
ZYRO0G16742g Chr7 (1373818..1375449) [1632 bp, 543 aa] {ON} weak...    32   2.2  
TPHA0I01580 Chr9 complement(358279..362019) [3741 bp, 1246 aa] {...    32   4.2  
Kwal_14.1845 s14 (491597..492463) [867 bp, 288 aa] {ON} YGL055W ...    31   5.5  
Ecym_2214 Chr2 (422005..423600) [1596 bp, 531 aa] {ON} similar t...    30   7.8  

>ZYRO0G13948g Chr7 complement(1109941..1111095) [1155 bp, 384 aa]
           {ON} similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 384

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/384 (94%), Positives = 361/384 (94%)

Query: 1   MSTKSPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDIT 60
           MSTKSPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDIT
Sbjct: 1   MSTKSPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDIT 60

Query: 61  EVLKDRDVHEHSESAYEILDDNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDST 120
           EVLKDRDVHEHSESAYEILDDNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDST
Sbjct: 61  EVLKDRDVHEHSESAYEILDDNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDST 120

Query: 121 TFVPELPAEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYGK 180
           TFVPELPAEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYGK
Sbjct: 121 TFVPELPAEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYGK 180

Query: 181 GSAPLFGNFLEPISKTXXXXXXXXXXXVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLIE 240
           GSAPLFGNFLEPISKT           VVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLIE
Sbjct: 181 GSAPLFGNFLEPISKTPWWAIPIIWIPVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLIE 240

Query: 241 YCLHRFLFHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTVF 300
           YCLHRFLFHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTVF
Sbjct: 241 YCLHRFLFHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTVF 300

Query: 301 GLLPTYWAYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRXXXXXXXXXXXXNYQLGFGVT 360
           GLLPTYWAYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMR            NYQLGFGVT
Sbjct: 301 GLLPTYWAYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRKLKKYHLEHHYKNYQLGFGVT 360

Query: 361 SWFWDNVFGTYLGPDAPLAHMKYD 384
           SWFWDNVFGTYLGPDAPLAHMKYD
Sbjct: 361 SWFWDNVFGTYLGPDAPLAHMKYD 384

>Smik_13.485 Chr13 complement(792640..793794) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  552 bits (1422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/383 (67%), Positives = 305/383 (79%), Gaps = 1/383 (0%)

Query: 2   STKSPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITE 61
           +  S TL+LFS++ + KHN  KDCWV+   RKIY+VT+FL EHPGG E IL YAG+DITE
Sbjct: 3   ANTSKTLELFSKKTVEKHNTAKDCWVTYQNRKIYDVTKFLSEHPGGDESILDYAGKDITE 62

Query: 62  VLKDRDVHEHSESAYEILDDNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDSTT 121
           V+KD DVHEHS+SAYEIL+D YL+GYLAT EEA +LLTNK H+VEV L+  + ++FDSTT
Sbjct: 63  VMKDTDVHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLS-SDGTEFDSTT 121

Query: 122 FVPELPAEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYGKG 181
           FV +LPAEEKL+IATDYG DYKKHKFLDLNR LL Q++  +F KDFY+DQ+HRPRHYGKG
Sbjct: 122 FVKDLPAEEKLSIATDYGNDYKKHKFLDLNRPLLMQILCSDFKKDFYVDQIHRPRHYGKG 181

Query: 182 SAPLFGNFLEPISKTXXXXXXXXXXXVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLIEY 241
           SAPLFGNFLEP++KT           VV +H  V   NMN+LF+ FLFC+G+FVWTLIEY
Sbjct: 182 SAPLFGNFLEPLTKTAWWVVPTAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIEY 241

Query: 242 CLHRFLFHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTVFG 301
            LHRFLFH D+WLP++N A   HFLLHG HHYLPMD+YRLVMPPTL ++L AP YK VF 
Sbjct: 242 GLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFA 301

Query: 302 LLPTYWAYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRXXXXXXXXXXXXNYQLGFGVTS 361
           LLP YWAY+GFAGGLFGYVCYD  H+FLHH+KLP +MR            NYQLGFGVTS
Sbjct: 302 LLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTS 361

Query: 362 WFWDNVFGTYLGPDAPLAHMKYD 384
           WFWD VFGTYLGPDAPL+ MKY+
Sbjct: 362 WFWDEVFGTYLGPDAPLSKMKYE 384

>TDEL0B00680 Chr2 (128650..129801) [1152 bp, 383 aa] {ON} Anc_8.829
           YMR272C
          Length = 383

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/382 (69%), Positives = 305/382 (79%), Gaps = 4/382 (1%)

Query: 4   KSPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVL 63
           +S TL+LFS++Q+S+HNN  DCWV+V  RKIY+VT+FLDEHPGG +YIL YAG+DITEVL
Sbjct: 5   QSKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVL 64

Query: 64  KDRDVHEHSESAYEILDDN-YLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDSTTF 122
           KD  +HEHSESAYEIL+D+ YLVGY+AT+ E  +LLTN  H+VEV L      DFDSTTF
Sbjct: 65  KDSTIHEHSESAYEILEDSSYLVGYMATELEEKELLTNSSHKVEVKLA---TLDFDSTTF 121

Query: 123 VPELPAEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYGKGS 182
           V +LP EEKL+IATDY RDYK+H FLDL + LLPQVMFG F+KDFY+DQ+HRPRHYGKGS
Sbjct: 122 VKDLPTEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRHYGKGS 181

Query: 183 APLFGNFLEPISKTXXXXXXXXXXXVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLIEYC 242
           APLFGNFLEP+SKT           VV +H  V F NMN +F+ F FCLG FVWTLIEY 
Sbjct: 182 APLFGNFLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWTLIEYG 241

Query: 243 LHRFLFHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTVFGL 302
           LHRFLFH D+WLP++N   TLHFLLHGVHHYLPMD+YRLVMPPTL ++L  P YK VFGL
Sbjct: 242 LHRFLFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYKLVFGL 301

Query: 303 LPTYWAYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRXXXXXXXXXXXXNYQLGFGVTSW 362
           LP Y AY+GFAGGLFGYVCYDLTHYFLHH+KLPS+MR            NYQLGFGVTSW
Sbjct: 302 LPLYVAYAGFAGGLFGYVCYDLTHYFLHHSKLPSFMRKLKKYHLEHHYKNYQLGFGVTSW 361

Query: 363 FWDNVFGTYLGPDAPLAHMKYD 384
           FWD VFGTYL P +P++ MKYD
Sbjct: 362 FWDKVFGTYLSPTSPISQMKYD 383

>SAKL0D01760g Chr4 (140050..141195) [1146 bp, 381 aa] {ON} similar
           to uniprot|Q03529 Saccharomyces cerevisiae YMR272C SCS7
           Required for the hydroxylation of the very long chain
           fatty acid (VLCFA) located in the endoplasmic reticulum
           desaturase/hydroxylase enzyme
          Length = 381

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/382 (69%), Positives = 305/382 (79%), Gaps = 2/382 (0%)

Query: 3   TKSPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEV 62
           ++S TL L S+ QLS+HN ++DCWVS+Y RK+YNVT FL+EHPGG +YIL +AG DITE+
Sbjct: 2   SESKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61

Query: 63  LKDRDVHEHSESAYEILDDNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDSTTF 122
           +KD+ VHEHSESAYEI++D YLVGYLA +EE  KLLTN+ H VEV L +  ++ FDSTTF
Sbjct: 62  MKDKLVHEHSESAYEIMNDMYLVGYLANEEEEKKLLTNEDHTVEVKLNE--STQFDSTTF 119

Query: 123 VPELPAEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYGKGS 182
           V ELP E+KL+IATDY  DYKKHKFLDL++ LL QV+FGNF+KDFYLDQVHRPRHYGKGS
Sbjct: 120 VKELPTEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKGS 179

Query: 183 APLFGNFLEPISKTXXXXXXXXXXXVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLIEYC 242
           APLFGNFLEP+SKT           VV +H YV  TNMNK F+ FLF LG+FVWTLIEYC
Sbjct: 180 APLFGNFLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEYC 239

Query: 243 LHRFLFHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTVFGL 302
           LHRFLFHLD++LP+   A  LHFLLHGVHHYLPMDRYRLVMPPTL ++L  P YK VF L
Sbjct: 240 LHRFLFHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFSL 299

Query: 303 LPTYWAYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRXXXXXXXXXXXXNYQLGFGVTSW 362
           LP YWA +GFAGG+ GY CYDLTHYFLHHAKLP YMR            NY+LGFGVTSW
Sbjct: 300 LPYYWACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRKLKKYHLEHHYKNYELGFGVTSW 359

Query: 363 FWDNVFGTYLGPDAPLAHMKYD 384
           FWD VFGTYLG DAPL+ MKY+
Sbjct: 360 FWDKVFGTYLGSDAPLSKMKYE 381

>YMR272C Chr13 complement(809623..810777) [1155 bp, 384 aa] {ON}
           SCS7Sphingolipid alpha-hydroxylase, functions in the
           alpha-hydroxylation of sphingolipid-associated very long
           chain fatty acids, has both cytochrome b5-like and
           hydroxylase/desaturase domains, not essential for growth
          Length = 384

 Score =  547 bits (1410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/385 (67%), Positives = 304/385 (78%), Gaps = 2/385 (0%)

Query: 1   MSTK-SPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDI 59
           MST  S TL+LFS++ + +HN   DCWV+   RKIY+VT FL EHPGG E IL YAG+DI
Sbjct: 1   MSTNTSKTLELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDI 60

Query: 60  TEVLKDRDVHEHSESAYEILDDNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDS 119
           TE++KD DVHEHS+SAYEIL+D YL+GYLAT EEA +LLTNK H+VEV L+  + ++FDS
Sbjct: 61  TEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLS-ADGTEFDS 119

Query: 120 TTFVPELPAEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYG 179
           TTFV ELPAEEKL+IATDY  DYKKHKFLDLNR LL Q++  +F KDFY+DQ+HRPRHYG
Sbjct: 120 TTFVKELPAEEKLSIATDYSNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYG 179

Query: 180 KGSAPLFGNFLEPISKTXXXXXXXXXXXVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLI 239
           KGSAPLFGNFLEP++KT           VV +H  V   NMN+LF+ FLFC+G+FVWTLI
Sbjct: 180 KGSAPLFGNFLEPLTKTAWWVVPVAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLI 239

Query: 240 EYCLHRFLFHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTV 299
           EY LHRFLFH D+WLP++N A   HFLLHG HHYLPMD+YRLVMPPTL ++L AP YK V
Sbjct: 240 EYGLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLV 299

Query: 300 FGLLPTYWAYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRXXXXXXXXXXXXNYQLGFGV 359
           F LLP YWAY+GFAGGLFGYVCYD  H+FLHH+KLP +MR            NYQLGFGV
Sbjct: 300 FALLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGV 359

Query: 360 TSWFWDNVFGTYLGPDAPLAHMKYD 384
           TSWFWD VFGTYLGPDAPL+ MKY+
Sbjct: 360 TSWFWDEVFGTYLGPDAPLSKMKYE 384

>Skud_13.444 Chr13 complement(783092..784246) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/385 (67%), Positives = 305/385 (79%), Gaps = 2/385 (0%)

Query: 1   MSTK-SPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDI 59
           MST  S TL+LFS++ + +HN  KDCWV+   RKIY+VT+FL EHPGG E IL YAG+D+
Sbjct: 1   MSTNTSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDV 60

Query: 60  TEVLKDRDVHEHSESAYEILDDNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDS 119
           TE++KD DVHEHS+SAYEIL+D YL+GYLAT EEAT+LLTNK H+VEV L+  +  +FDS
Sbjct: 61  TEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEEATRLLTNKSHKVEVQLS-ADGKEFDS 119

Query: 120 TTFVPELPAEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYG 179
           TTFV  LP EEKL+IATDYG DYKKHKFLDLNR LL Q++  +F KDFY+DQ+HRPRHYG
Sbjct: 120 TTFVKNLPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYG 179

Query: 180 KGSAPLFGNFLEPISKTXXXXXXXXXXXVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLI 239
           KGSAPLFGNFLEP++KT           VV +H  V   NMN+LF+ FLFC+G+FVWTLI
Sbjct: 180 KGSAPLFGNFLEPLTKTAWWVVPLPWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLI 239

Query: 240 EYCLHRFLFHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTV 299
           EY LHRFLFH D+WLP++N A   HFLLHG HHYLPMD+YRLVMPPTL ++L AP YK V
Sbjct: 240 EYGLHRFLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLV 299

Query: 300 FGLLPTYWAYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRXXXXXXXXXXXXNYQLGFGV 359
           F LLP YWAY+GFAGGLFGYVCYD  H+FLHH+KLP +MR            NYQLGFGV
Sbjct: 300 FALLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGV 359

Query: 360 TSWFWDNVFGTYLGPDAPLAHMKYD 384
           TSWFWD VFGTYLGPDAPL+ MKY+
Sbjct: 360 TSWFWDEVFGTYLGPDAPLSKMKYE 384

>KLLA0D01639g Chr4 complement(146344..147489) [1146 bp, 381 aa] {ON}
           similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 381

 Score =  545 bits (1405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/382 (69%), Positives = 305/382 (79%), Gaps = 2/382 (0%)

Query: 3   TKSPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEV 62
           + S  L L+S+  L KHN++ DCWVS+YQRKIYNVTEFLDEHPGGAEYIL YAG DIT+V
Sbjct: 2   SSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDV 61

Query: 63  LKDRDVHEHSESAYEILDDNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDSTTF 122
           +KD   HEHSESAYEI+D++YLVGYLAT+EE  KLLTNK H VEV+L  + N++FDST F
Sbjct: 62  MKDVLTHEHSESAYEIMDESYLVGYLATEEEEKKLLTNKDHVVEVNL--KGNNEFDSTVF 119

Query: 123 VPELPAEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYGKGS 182
           V ELP E+KL+IATDY  DYKKHKFLDLN+ LL QV+FG F+KDFYLDQVHRPRHYGKGS
Sbjct: 120 VKELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGS 179

Query: 183 APLFGNFLEPISKTXXXXXXXXXXXVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLIEYC 242
           APLFGNFLEP+SKT           VV++H Y    NMN+ F+ FLF +G+FVWTLIEY 
Sbjct: 180 APLFGNFLEPLSKTPWWMVPVVWLPVVTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYG 239

Query: 243 LHRFLFHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTVFGL 302
           LHRFLFHLD+ LP+   A TLHFLLHGVHHYLPMDR+RLVMPPTL +VL  P YK VF L
Sbjct: 240 LHRFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFAL 299

Query: 303 LPTYWAYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRXXXXXXXXXXXXNYQLGFGVTSW 362
           LP YWA +GFAGG+ GYVCYDLTHYFLHH++LP YMR            NY+LGFGVTSW
Sbjct: 300 LPYYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRKLKKYHLEHHYKNYELGFGVTSW 359

Query: 363 FWDNVFGTYLGPDAPLAHMKYD 384
           FWD VFGTYLG +APL++MKYD
Sbjct: 360 FWDKVFGTYLGENAPLSNMKYD 381

>Suva_13.460 Chr13 complement(792221..793375) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  541 bits (1395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/385 (67%), Positives = 306/385 (79%), Gaps = 2/385 (0%)

Query: 1   MSTK-SPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDI 59
           MST  S TL+LFS++ + +HN  KDCWV+   RKIY+VT+FL EHPGG E IL YAG+DI
Sbjct: 1   MSTNTSKTLELFSKKTVEEHNTAKDCWVTYQNRKIYDVTKFLSEHPGGEESILDYAGKDI 60

Query: 60  TEVLKDRDVHEHSESAYEILDDNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDS 119
           TEV+KD DVHEHSESAYEIL+D YLVGYLAT EEAT+LLTNK H+VEV L+  + ++FDS
Sbjct: 61  TEVMKDSDVHEHSESAYEILEDEYLVGYLATDEEATRLLTNKNHKVEVQLS-ADGTEFDS 119

Query: 120 TTFVPELPAEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYG 179
           TTFV +LP EEKL+IATDYG DYKKHKFLDLN+ LL Q++  +F++DFY+DQ+HRPRHYG
Sbjct: 120 TTFVKDLPTEEKLSIATDYGSDYKKHKFLDLNKPLLMQILRSDFTRDFYVDQIHRPRHYG 179

Query: 180 KGSAPLFGNFLEPISKTXXXXXXXXXXXVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLI 239
           KGSAPLFGNFLEP++KT           VV +H  V   NMN LF+ FLF +G+FVWTLI
Sbjct: 180 KGSAPLFGNFLEPLTKTAWWVVPVAWVPVVVYHMGVALKNMNPLFACFLFGVGMFVWTLI 239

Query: 240 EYCLHRFLFHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTV 299
           EY LHRFLFH D+WLP++N A   HFLLHG HHYLPMD YRLVMPP+L ++L AP YK V
Sbjct: 240 EYSLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDGYRLVMPPSLFVILCAPFYKLV 299

Query: 300 FGLLPTYWAYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRXXXXXXXXXXXXNYQLGFGV 359
           F LLP YWAY+GFAGGLFGYVCYD  HYF+HH+KLP +MR            NYQLGFGV
Sbjct: 300 FALLPLYWAYAGFAGGLFGYVCYDECHYFIHHSKLPPFMRKLKKYHLEHHYKNYQLGFGV 359

Query: 360 TSWFWDNVFGTYLGPDAPLAHMKYD 384
           TSWFWD+VFGTYLGPDAPL+ MKY+
Sbjct: 360 TSWFWDDVFGTYLGPDAPLSKMKYE 384

>KLTH0C04114g Chr3 (357195..358331) [1137 bp, 378 aa] {ON} highly
           similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 378

 Score =  526 bits (1356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/384 (66%), Positives = 294/384 (76%), Gaps = 6/384 (1%)

Query: 1   MSTKSPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDIT 60
           M TK  TL L+SQ QL +HN   DCWVS++ RKIYNVT FLDEHPGGAE I +YAG+D+T
Sbjct: 1   METK--TLPLYSQSQLEQHNTRDDCWVSLHHRKIYNVTSFLDEHPGGAELIEEYAGKDVT 58

Query: 61  EVLKDRDVHEHSESAYEILDDNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDST 120
           E++KD   HEHS  AYE+LD+ Y VGYLAT EE  KLL N +H VEV L +    D+DST
Sbjct: 59  EIMKDGPTHEHSYVAYEVLDEEYHVGYLATPEEEKKLLGNPEHPVEVKLEE----DYDST 114

Query: 121 TFVPELPAEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYGK 180
            FVPE+P EEKL+I TDY +DY +HKFLDLNR LL Q++  +FSK+FYLDQVHRPRHYG+
Sbjct: 115 VFVPEVPPEEKLSIVTDYTKDYGRHKFLDLNRPLLMQMLTSDFSKEFYLDQVHRPRHYGR 174

Query: 181 GSAPLFGNFLEPISKTXXXXXXXXXXXVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLIE 240
           GSAPLFGNFLEP+SKT           VV +H Y    NMN + + FLFCLG+FVWTLIE
Sbjct: 175 GSAPLFGNFLEPLSKTAWYVIPLVWFPVVVYHMYTALQNMNNVLAVFLFCLGVFVWTLIE 234

Query: 241 YCLHRFLFHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTVF 300
           Y LHRFLFHLD +LP N  A T+HFLLHGVHHYLPMDRYRLVMPPTL +VL  P YK VF
Sbjct: 235 YGLHRFLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFVVLCTPFYKLVF 294

Query: 301 GLLPTYWAYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRXXXXXXXXXXXXNYQLGFGVT 360
            LLP YWA +GFAGG+FGY+CYDLTHYFLHHAKLPSYMR            NY+LGFGVT
Sbjct: 295 ALLPKYWACAGFAGGMFGYMCYDLTHYFLHHAKLPSYMRKLKKYHMEHHYKNYELGFGVT 354

Query: 361 SWFWDNVFGTYLGPDAPLAHMKYD 384
           SWFWD VFGTYLG +APL+ MK+D
Sbjct: 355 SWFWDKVFGTYLGDNAPLSQMKFD 378

>Kwal_27.10332 s27 (289484..290620) [1137 bp, 378 aa] {ON} YMR272C
           (SCS7) - desaturase/hydroxylase enzyme [contig 36] FULL
          Length = 378

 Score =  505 bits (1300), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 244/384 (63%), Positives = 293/384 (76%), Gaps = 6/384 (1%)

Query: 1   MSTKSPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDIT 60
           M TK  TL L+S  Q+ +HN+  DCWV++  RKIY+VT+FL++HPGG + I++YAG+DIT
Sbjct: 1   METK--TLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDIT 58

Query: 61  EVLKDRDVHEHSESAYEILDDNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDST 120
           EV+KD  +H HS  AYE+LD+ Y VGYLAT EE  KLL N KH+VEV L D+    +DST
Sbjct: 59  EVMKDGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLEDE----YDST 114

Query: 121 TFVPELPAEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYGK 180
            FVPE+PAEEKL+I TDY RDY +HKFLDLNR LL Q++  +F+K+FYLDQVHRPRHYG+
Sbjct: 115 VFVPEVPAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGR 174

Query: 181 GSAPLFGNFLEPISKTXXXXXXXXXXXVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLIE 240
           GSAPLFGNFLEP+SKT           VV++H +    NMNKLF+ FLF +GIFVWTLIE
Sbjct: 175 GSAPLFGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIE 234

Query: 241 YCLHRFLFHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTVF 300
           Y +HRFLFHLD +LP N  A T+HFLLHGVHHYLPMDRYRLVMPPTL ++L  P YK VF
Sbjct: 235 YGMHRFLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFLLLCTPFYKLVF 294

Query: 301 GLLPTYWAYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRXXXXXXXXXXXXNYQLGFGVT 360
            LLP YWA +GFAGG+ GYVCYDLTHYFLHHAKLP  ++            NY+LGFGVT
Sbjct: 295 ALLPYYWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVT 354

Query: 361 SWFWDNVFGTYLGPDAPLAHMKYD 384
           SW WD VFGTYL  +APL+ MK+D
Sbjct: 355 SWVWDKVFGTYLAENAPLSQMKFD 378

>NCAS0C00470 Chr3 (78059..79339) [1281 bp, 426 aa] {ON} Anc_8.829
          Length = 426

 Score =  501 bits (1289), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 234/382 (61%), Positives = 292/382 (76%), Gaps = 5/382 (1%)

Query: 2   STKSPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITE 61
           S  S TL+LFS++Q++KHN E+DCWV+VY RKIY+V++FL +HP G + ILK+AG+DITE
Sbjct: 49  SNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITE 108

Query: 62  VLKDRDVHEHSESAYEILDDNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDSTT 121
           +LKD  + + ++    +LDD YL+GY+AT  E  KLLTNK H+VEV L +  N+ FDSTT
Sbjct: 109 LLKDEKIDQQTD----LLDDQYLIGYMATDAEEEKLLTNKDHKVEVKLNESTNT-FDSTT 163

Query: 122 FVPELPAEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYGKG 181
           FV +LP E+KL+IATDY +D KKH FLDLN+ LL Q++FGNF+KDFYLDQ+HRPRHYG+ 
Sbjct: 164 FVKDLPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQE 223

Query: 182 SAPLFGNFLEPISKTXXXXXXXXXXXVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLIEY 241
           SAPLFGNFLEP +KT           VV +H  + F N+N LF+  LFC+G++VWT IEY
Sbjct: 224 SAPLFGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIEY 283

Query: 242 CLHRFLFHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTVFG 301
           C+HRFLFH DE LP++N A  +HFLLHG HHYLPMD+YRLV+PP L I L AP YK VF 
Sbjct: 284 CMHRFLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVFA 343

Query: 302 LLPTYWAYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRXXXXXXXXXXXXNYQLGFGVTS 361
           LLP YWA +GFAGG+FGY+CYDL HYFLHH+KLP +MR            NYQLG+GVTS
Sbjct: 344 LLPYYWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRKLKKYHLEHHYKNYQLGYGVTS 403

Query: 362 WFWDNVFGTYLGPDAPLAHMKY 383
           W+WD  FGTYL PD+PL+ MKY
Sbjct: 404 WYWDKKFGTYLSPDSPLSKMKY 425

>Kpol_541.9 s541 complement(23399..24523) [1125 bp, 374 aa] {ON}
           complement(23399..24523) [1125 nt, 375 aa]
          Length = 374

 Score =  483 bits (1243), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 233/384 (60%), Positives = 287/384 (74%), Gaps = 12/384 (3%)

Query: 1   MSTK-SPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDI 59
           MS K S TL+LF++ +  +HN E DCWVSV +R IY+V+ +L ++      IL++AG+DI
Sbjct: 1   MSAKDSKTLELFAKSRFEEHNTEADCWVSVKERLIYDVSSYLKDNADADSSILEHAGKDI 60

Query: 60  TEVLKDRDVHEHSESAYEILDDNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDS 119
           T++ K R+        ++ + D YLVGYLAT+EE  +LLTNK H+VEV+L D     +DS
Sbjct: 61  TKLTKTRE--------FKFISDEYLVGYLATEEEEVRLLTNKDHKVEVNLQD---GTYDS 109

Query: 120 TTFVPELPAEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYG 179
           T FV ELPAEEK  +ATD G+D++ H FLDLN+ +L QV+FGNF++DFY+DQVHRPRHYG
Sbjct: 110 TVFVKELPAEEKFTVATDLGKDFQDHHFLDLNKPMLWQVLFGNFTRDFYIDQVHRPRHYG 169

Query: 180 KGSAPLFGNFLEPISKTXXXXXXXXXXXVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLI 239
           KGSAPLFGNFLEPIS T           VV +H  V   NMN +F+ FLFCLGIFVWTLI
Sbjct: 170 KGSAPLFGNFLEPISLTPWWLIPIIWGPVVVYHLSVALNNMNNIFAGFLFCLGIFVWTLI 229

Query: 240 EYCLHRFLFHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTV 299
           EYCLHRFLFHLD+W+P +N   TLHFLLHGVHHYLPMD+YRLV+PP L +VL  PIYK V
Sbjct: 230 EYCLHRFLFHLDDWVPQHNIFYTLHFLLHGVHHYLPMDQYRLVVPPALFLVLCTPIYKLV 289

Query: 300 FGLLPTYWAYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRXXXXXXXXXXXXNYQLGFGV 359
           FGLLP YWAY+GFAGGL GY+CYDLTHYF+HH KLP +MR            NYQLGFGV
Sbjct: 290 FGLLPLYWAYAGFAGGLLGYICYDLTHYFIHHVKLPKFMRKVKKHHLEHHYKNYQLGFGV 349

Query: 360 TSWFWDNVFGTYLGPDAPLAHMKY 383
           +++FWD VFGTYLGPD+P + M+Y
Sbjct: 350 SNYFWDKVFGTYLGPDSPASIMRY 373

>AAL183W Chr1 (13713..14846) [1134 bp, 377 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR272C (SCS7)
          Length = 377

 Score =  476 bits (1226), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 232/378 (61%), Positives = 282/378 (74%), Gaps = 5/378 (1%)

Query: 5   SPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLK 64
           S TL L+S+  L KH +   CWVSV  RKIY+V++FLDEHPGG +YIL YAG+DIT VLK
Sbjct: 3   SKTLPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVLK 62

Query: 65  DRDVHEHSESAYEILDDNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDSTTFVP 124
           D+ +HEH+E+AYEILD++YLVGYLAT+EE  KLLTN+KH +EV  T +N    D+TTFV 
Sbjct: 63  DKLIHEHTEAAYEILDESYLVGYLATEEEEIKLLTNEKHVMEV--TPEN---LDTTTFVK 117

Query: 125 ELPAEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYGKGSAP 184
           ELPAEE L++ATD+G DY KH FLDLN+ LL QV+ GNF++DFY+DQ+HRPRHYGKGSAP
Sbjct: 118 ELPAEEVLSVATDFGTDYTKHHFLDLNKPLLMQVLRGNFTRDFYIDQIHRPRHYGKGSAP 177

Query: 185 LFGNFLEPISKTXXXXXXXXXXXVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLIEYCLH 244
           LFGNFLEP+SKT           VV ++      NM    +   F  G+FVWTLIEY LH
Sbjct: 178 LFGNFLEPLSKTVWWVVPMVWYPVVLYYLTRALQNMPAHLALTCFAAGVFVWTLIEYSLH 237

Query: 245 RFLFHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTVFGLLP 304
           RFLFH D+ +P++N A T+HFLLHGVHHYLPMD+YRLVMPP L +VL AP Y+ VF + P
Sbjct: 238 RFLFHFDDNMPESNIAFTVHFLLHGVHHYLPMDKYRLVMPPALFVVLCAPFYRLVFSIFP 297

Query: 305 TYWAYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRXXXXXXXXXXXXNYQLGFGVTSWFW 364
            Y A   FAGGLFGYVCYD+THYFLHH KLP +MR            NY+LGFGVTSW+W
Sbjct: 298 EYCACGCFAGGLFGYVCYDVTHYFLHHHKLPPFMRKLKKYHLEHHYKNYELGFGVTSWYW 357

Query: 365 DNVFGTYLGPDAPLAHMK 382
           D VFGTYL  ++P++  K
Sbjct: 358 DKVFGTYLASNSPVSRPK 375

>CAGL0F03399g Chr6 complement(333955..335097) [1143 bp, 380 aa] {ON}
           highly similar to uniprot|Q03529 Saccharomyces
           cerevisiae YMR272c SCS7 required for hydroxylation of
           ceramide
          Length = 380

 Score =  468 bits (1203), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 229/384 (59%), Positives = 277/384 (72%), Gaps = 9/384 (2%)

Query: 2   STKSPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILK-YAGRDIT 60
           +  S TL+LF Q  L+KHN++ DCWVS ++RKIY+V+++L +HP  A+ + K   G+  T
Sbjct: 5   ADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGT 64

Query: 61  EVLKDRDVHEHSESAYEILDDNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDST 120
                 D+ +   +  + + D+YLVGYLAT +E  KLLTNK H+VEV L   N   FDST
Sbjct: 65  ------DISQMELTTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNT--FDST 116

Query: 121 TFVPELPAEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYGK 180
           TFV +LP E+KL+I TDY RDYKKHKFLDLN+ LL Q++FGNF+KDFYLDQ+HRPRHYGK
Sbjct: 117 TFVKDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGK 176

Query: 181 GSAPLFGNFLEPISKTXXXXXXXXXXXVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLIE 240
           GSAPLFGNFLE  +KT           VV +       NMN   + FLF LGIFVWTLIE
Sbjct: 177 GSAPLFGNFLEAFTKTAWWVVPTVWGPVVLYFITTALMNMNNPLALFLFGLGIFVWTLIE 236

Query: 241 YCLHRFLFHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTVF 300
           YCLHRFLFH DEWLP+++    +HFLLHG HHYLPMD YRLV+PP L +VL APIYK VF
Sbjct: 237 YCLHRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVF 296

Query: 301 GLLPTYWAYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRXXXXXXXXXXXXNYQLGFGVT 360
             LP YWA +GFAGG+ GY+CYDL HYFLHH+K+P +MR            NYQLGFGVT
Sbjct: 297 AALPYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRKLKKYHLEHHYKNYQLGFGVT 356

Query: 361 SWFWDNVFGTYLGPDAPLAHMKYD 384
           SWFWD VFGTYLGPDAPL+ MKY+
Sbjct: 357 SWFWDKVFGTYLGPDAPLSKMKYE 380

>NDAI0K00470 Chr11 (107509..108669) [1161 bp, 386 aa] {ON} Anc_8.829
          Length = 386

 Score =  462 bits (1190), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 222/383 (57%), Positives = 283/383 (73%), Gaps = 5/383 (1%)

Query: 5   SPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGA--EYILKYAGRDITEV 62
           S TL+LFS+++++ HN   DCW++   RKIY+VT+FL+++P  A  + +L++AG+DIT+ 
Sbjct: 6   SKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDE 65

Query: 63  LKDRDVHEHSESAYEILD-DNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDSTT 121
           LKD+ +      ++ IL  D YL+GYLAT  E   LLTNK H+VEV L +  N  FDSTT
Sbjct: 66  LKDK-IDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNG-FDSTT 123

Query: 122 FVPELPAEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYGKG 181
           FV +LP E+KL+IATD  +D +KHKFLDL++ LL Q++FGNF+KDFYLDQ+HRPRHYG  
Sbjct: 124 FVKDLPTEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRHYGDK 183

Query: 182 SAPLFGNFLEPISKTXXXXXXXXXXXVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLIEY 241
           SAPLFGN LEP++KT           VV +H  V  TNMN +F+  LF +GI+VWTLIEY
Sbjct: 184 SAPLFGNILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWTLIEY 243

Query: 242 CLHRFLFHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTVFG 301
           C+HRFLFH DE LP++N    +HFLLHG HHYLPMD+YRLV+PPTL I L  P YK VF 
Sbjct: 244 CMHRFLFHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYKVVFK 303

Query: 302 LLPTYWAYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRXXXXXXXXXXXXNYQLGFGVTS 361
           LLP YWAY+GFAGGLFGYVCYDL HYFLHH+K+P  +R            NYQLG+GVTS
Sbjct: 304 LLPLYWAYAGFAGGLFGYVCYDLCHYFLHHSKMPPPLRKLKKYHLEHHYKNYQLGYGVTS 363

Query: 362 WFWDNVFGTYLGPDAPLAHMKYD 384
           W+WD +FGTYL PD+P++ MKY+
Sbjct: 364 WYWDKIFGTYLSPDSPMSKMKYE 386

>KAFR0B03850 Chr2 complement(796399..797532) [1134 bp, 377 aa] {ON}
           Anc_8.829 YMR272C
          Length = 377

 Score =  451 bits (1161), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 226/384 (58%), Positives = 277/384 (72%), Gaps = 10/384 (2%)

Query: 3   TKSPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEV 62
           T + TL+LFS+++++ H   +DCWV+++ RKIY+VT+FLDE+      +L YAG DIT+ 
Sbjct: 2   TTAKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDE 61

Query: 63  LKDRDVHEHSESAYEILD-DNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDSTT 121
           L    V+   +  Y+ LD DNYLVGY+AT +E  KLLTNK H+VEV L      DFD  T
Sbjct: 62  L----VNGKLDEKYKALDNDNYLVGYVATADEEQKLLTNKDHKVEVTL----EQDFDLAT 113

Query: 122 FVPELPAEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYGKG 181
            V ELP EEKL IAT+Y RD+KKHKFLDLN+ LLPQ++ G F+++FY+DQ++RPRHYG+ 
Sbjct: 114 LVVELPPEEKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQK 173

Query: 182 SAPLFGN-FLEPISKTXXXXXXXXXXXVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLIE 240
           SAPLFGN FLEP SKT           VV   F V   NMN   + FLFC+G+FVWTL+E
Sbjct: 174 SAPLFGNAFLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLE 233

Query: 241 YCLHRFLFHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTVF 300
           YCLHRFLFH D +LP+NN A  LHFLLHG HHYLPMD YRLV+PP L I+L APIYKTVF
Sbjct: 234 YCLHRFLFHFDNYLPENNIAFALHFLLHGFHHYLPMDPYRLVVPPALFIILCAPIYKTVF 293

Query: 301 GLLPTYWAYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRXXXXXXXXXXXXNYQLGFGVT 360
            LLP YWA +GFAGGLFGYV YD+ HY LHH+KLP +MR            NY+LG+G+T
Sbjct: 294 LLLPYYWACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGIT 353

Query: 361 SWFWDNVFGTYLGPDAPLAHMKYD 384
           SWFWD VFGTYL  DAP + MK+D
Sbjct: 354 SWFWDKVFGTYLSKDAPASVMKFD 377

>Ecym_2712 Chr2 (1378070..1379215) [1146 bp, 381 aa] {ON} similar to
           Ashbya gossypii AAL183W
          Length = 381

 Score =  447 bits (1151), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 218/384 (56%), Positives = 272/384 (70%), Gaps = 3/384 (0%)

Query: 1   MSTKSPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDIT 60
           MS+   TL L+S+ +  KH     CWVS+ QRKIYNV++FLDE+P G +Y+L +AG+D+T
Sbjct: 1   MSSSCKTLPLYSKSEFEKHVKPNQCWVSIDQRKIYNVSKFLDENPEGYQYVLDHAGQDVT 60

Query: 61  EVLKDRDVHEHSESAYEILDDNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDST 120
           ++LKD    E ++ A+++L D YL+GYLAT EE  KLLTN  H VEV   + N  D   +
Sbjct: 61  QLLKDMQTDEPTDLAHQLLSDAYLIGYLATSEEERKLLTNANHVVEVKPANGNRVD---S 117

Query: 121 TFVPELPAEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYGK 180
            FV +LP EEKL IATD+  DY+KH FLDL++ L  QV+FGNF+K+FY+DQVHRPRHYGK
Sbjct: 118 GFVKKLPTEEKLAIATDFKTDYEKHHFLDLDKPLFMQVLFGNFTKEFYIDQVHRPRHYGK 177

Query: 181 GSAPLFGNFLEPISKTXXXXXXXXXXXVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLIE 240
            SAPLFGNFLEP+SKT            V ++      N++   + FLF +G+FVWTLIE
Sbjct: 178 ESAPLFGNFLEPLSKTSWWVIPIVWYPCVIYYIRTALLNISTPLALFLFGVGVFVWTLIE 237

Query: 241 YCLHRFLFHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTVF 300
           Y LHRFLFH D+ +P++N   TLHFLLHG+HHYLPMD+YRLVMPP L + L  P YK VF
Sbjct: 238 YGLHRFLFHFDDRMPESNIVFTLHFLLHGIHHYLPMDKYRLVMPPALFLALCYPFYKLVF 297

Query: 301 GLLPTYWAYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRXXXXXXXXXXXXNYQLGFGVT 360
            +LP Y A +GFAGGLFGYV YD+THYFLHH KLP +MR            NY+LGFGVT
Sbjct: 298 SILPYYCACAGFAGGLFGYVGYDVTHYFLHHRKLPPFMRKLKKYHLEHHYKNYELGFGVT 357

Query: 361 SWFWDNVFGTYLGPDAPLAHMKYD 384
           SW+WD VF TYL P APL+  KYD
Sbjct: 358 SWYWDKVFNTYLSPTAPLSRAKYD 381

>TBLA0D03180 Chr4 complement(774883..776085) [1203 bp, 400 aa] {ON}
           Anc_8.829 YMR272C
          Length = 400

 Score =  447 bits (1150), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 213/386 (55%), Positives = 278/386 (72%), Gaps = 4/386 (1%)

Query: 2   STKSP-TLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDIT 60
           ++ SP T +LFS E + KHN +KDCWV    RKIY+V+++L ++P G   I+ +AG+DIT
Sbjct: 16  TSSSPLTKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDIT 75

Query: 61  EVLKDRDVHEHSESAYEIL--DDNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFD 118
              K+++ + H    Y+ +  +D YLVGYLA +EEA KLL+N  H+VEV LT+Q  S +D
Sbjct: 76  SSFKNQERYNHDPETYDFMSHNDKYLVGYLANEEEAYKLLSNPSHKVEVKLTEQP-STYD 134

Query: 119 STTFVPELPAEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHY 178
           STTFV ELP+E+   IATDY +D+ +H FLDL + L+PQ+    F++ FY+DQ+HRPRH+
Sbjct: 135 STTFVKELPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFNRAFYIDQIHRPRHF 194

Query: 179 GKGSAPLFGNFLEPISKTXXXXXXXXXXXVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTL 238
           G  SAPLFGNFLEP++KT           VV +H  V F NMN +F+TFLFC+G+FVWTL
Sbjct: 195 GNKSAPLFGNFLEPLTKTAWWVIPVVWLPVVFYHLKVAFHNMNNIFATFLFCVGVFVWTL 254

Query: 239 IEYCLHRFLFHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKT 298
           IEY LHRFLFH+D  +PD+     LHF +HG HHYLPMD YRLVMPPTL ++L  P YK 
Sbjct: 255 IEYSLHRFLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMPPTLFLILCTPFYKL 314

Query: 299 VFGLLPTYWAYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRXXXXXXXXXXXXNYQLGFG 358
           VF +LP YWAY+GFAGGLFGYVCYD  HY+LHH+++P +MR            NYQL FG
Sbjct: 315 VFSVLPLYWAYAGFAGGLFGYVCYDEVHYWLHHSRVPKFMRLLKKLHLEHHYKNYQLAFG 374

Query: 359 VTSWFWDNVFGTYLGPDAPLAHMKYD 384
           V+++FWD VFGTYL PD+PL+ MKY+
Sbjct: 375 VSNYFWDKVFGTYLYPDSPLSPMKYE 400

>KNAG0J00320 Chr10 (50267..51388) [1122 bp, 373 aa] {ON} Anc_8.829
           YMR272C
          Length = 373

 Score =  438 bits (1126), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 214/384 (55%), Positives = 270/384 (70%), Gaps = 11/384 (2%)

Query: 1   MSTKSPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDIT 60
           MS+ S TL+L S++ ++ HN + D WV V  RK+ +++ ++ E P   E +L  AG+DIT
Sbjct: 1   MSSNSRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60

Query: 61  EVLKDRDVHEHSESAYEILDDNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDST 120
           +          S     +  D++LVGYLAT  E  +LL+NK H+VEV L  +    FDS+
Sbjct: 61  D---------RSHEFPGLNADDHLVGYLATDLEEKELLSNKDHKVEVKL--EGGETFDSS 109

Query: 121 TFVPELPAEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYGK 180
           TFV +LP E+KL+IATD  RDY+KH FLDL + L+PQV+FG+F+KDFY+DQ+HRPRHYGK
Sbjct: 110 TFVKDLPTEDKLSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYGK 169

Query: 181 GSAPLFGNFLEPISKTXXXXXXXXXXXVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLIE 240
           GSAPLFGNFLEPISKT           VV +        ++ +F+  LF LG FVWTLIE
Sbjct: 170 GSAPLFGNFLEPISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLIE 229

Query: 241 YCLHRFLFHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTVF 300
           YC+HRFLFH D+WLP+NN A T+HFLLHGVHHYLPMD YRLV+PP L +VL  P YK VF
Sbjct: 230 YCMHRFLFHFDDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLVF 289

Query: 301 GLLPTYWAYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRXXXXXXXXXXXXNYQLGFGVT 360
            LLP Y A +GFAGG+FGY+CYDL HYFLHH+K+P +MR            NYQLGFGV+
Sbjct: 290 KLLPHYVACAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGVS 349

Query: 361 SWFWDNVFGTYLGPDAPLAHMKYD 384
           +WFWD VF TYLG DAP++ MKYD
Sbjct: 350 NWFWDKVFDTYLGKDAPISPMKYD 373

>TPHA0C04710 Chr3 complement(1015392..1016525) [1134 bp, 377 aa]
           {ON} Anc_8.829 YMR272C
          Length = 377

 Score =  427 bits (1099), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 213/383 (55%), Positives = 269/383 (70%), Gaps = 13/383 (3%)

Query: 2   STKSPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGG--AEYILKYAGRDI 59
           S  S TL+LFS E+   HN E DCWVSV  R IY+V++F+ E+      + +LK AG+DI
Sbjct: 4   SNPSKTLELFSSEKFQSHNTEDDCWVSVKDRLIYDVSKFVQENKDVPVEDAVLKRAGKDI 63

Query: 60  TEVLKDRDVHEHSESAYEILDDNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDS 119
           +++L+ +        +++ +DD YLVGYLA   E  +LLTNK H+VEV+L D     +DS
Sbjct: 64  SDLLETK--------SFKFVDDKYLVGYLANSTEEARLLTNKDHKVEVNLKD---GTYDS 112

Query: 120 TTFVPELPAEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYG 179
           T FV ELP+EE   I+TDY +D+  H FLDL + LL Q++ GNF+++FY+DQ+HRPRHYG
Sbjct: 113 TVFVKELPSEEHFTISTDYKKDFVDHHFLDLEKPLLMQMLTGNFTREFYIDQIHRPRHYG 172

Query: 180 KGSAPLFGNFLEPISKTXXXXXXXXXXXVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLI 239
           KGSA LFGN+LEPIS T           VV +HFYVG  +M+ L + F + LGIFVWT I
Sbjct: 173 KGSAKLFGNWLEPISLTPWWLIPIIWGPVVVYHFYVGAQHMHPLSAVFFYFLGIFVWTFI 232

Query: 240 EYCLHRFLFHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTV 299
           EYCLHRFLFHLD+W+P +N   T+HFLLHGVHHYLPMD+YRLV+PP L +VL  P YK V
Sbjct: 233 EYCLHRFLFHLDDWVPQHNFFYTIHFLLHGVHHYLPMDQYRLVVPPALFVVLCTPFYKAV 292

Query: 300 FGLLPTYWAYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRXXXXXXXXXXXXNYQLGFGV 359
           F LLP Y AY GFAGGL GY+ YDLTHYF+HH KLP   R            NYQLGFGV
Sbjct: 293 FALLPLYVAYVGFAGGLTGYIIYDLTHYFIHHVKLPRVFRKIKKHHLEHHYKNYQLGFGV 352

Query: 360 TSWFWDNVFGTYLGPDAPLAHMK 382
           +++FWD VFGTYLGPD+P + M+
Sbjct: 353 SNYFWDLVFGTYLGPDSPASIMR 375

>Kpol_1069.4 s1069 (6163..6996) [834 bp, 277 aa] {ON} (6163..6996)
           [834 nt, 278 aa]
          Length = 277

 Score =  296 bits (759), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 140/256 (54%), Positives = 177/256 (69%), Gaps = 1/256 (0%)

Query: 128 AEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYGKGSAPLFG 187
            EEKL + TDY +D+ ++ FL L+  L  Q++  NF++DFY+DQVH+PRHYG  SAP+FG
Sbjct: 19  TEEKLKVTTDYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYIDQVHKPRHYGIESAPIFG 78

Query: 188 NFLEPISKTXXXXXXXXXXXVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLIEYCLHRFL 247
           NFLEP +KT           VV ++F V    ++ + +  LF +G+FVWTLIEYC+HR+L
Sbjct: 79  NFLEPFTKTHWFMVPLIWGPVVLYNFIVSLREISIILAITLFSIGVFVWTLIEYCMHRYL 138

Query: 248 FHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTVFGLLPTYW 307
           FHLD+ +P+      LHFLLHG+HHYLPMD+YRLVMPP L  +L  P Y   F + P YW
Sbjct: 139 FHLDDSVPETRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFSILCYPFYLLTFAIFPRYW 198

Query: 308 AYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRXXXXXXXXXXXXNYQLGFGVTSWFWDNV 367
           A++GFAGGLFGYVCYD+THYFLHH K+PS+MR            N+QLGFGVTS FWD V
Sbjct: 199 AHAGFAGGLFGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHHYKNFQLGFGVTSSFWDRV 258

Query: 368 FGTYLGPDA-PLAHMK 382
           FGTYL P   P A  K
Sbjct: 259 FGTYLDPKTIPYARSK 274

>NDAI0F02730 Chr6 (669821..670186) [366 bp, 121 aa] {ON} Anc_2.166
          Length = 121

 Score = 68.6 bits (166), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 51/76 (67%), Gaps = 4/76 (5%)

Query: 9  QLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDV 68
          Q+++ E+++KHN+  D W+ V + K+Y+V++FLDEHPGG E I + AG D TE  +D   
Sbjct: 3  QIYTYEEIAKHNSPDDTWI-VIEGKVYDVSKFLDEHPGGEEIIFELAGTDATENFEDIG- 60

Query: 69 HEHSESAYEILDDNYL 84
            HS+ A +IL   Y+
Sbjct: 61 --HSDDALKILKKMYI 74

>TDEL0F01210 Chr6 complement(216322..216702) [381 bp, 126 aa] {ON}
          Anc_2.166 YNL111C
          Length = 126

 Score = 68.6 bits (166), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 50/71 (70%), Gaps = 4/71 (5%)

Query: 10 LFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDVH 69
          ++S +Q+++HN+ +D W+ V   K+Y+VT+F+DEHPGG E IL  AG+D +E  +D    
Sbjct: 4  VYSYQQIAEHNSAEDIWI-VVDGKVYDVTKFMDEHPGGDEIILDLAGQDASEPFRDIG-- 60

Query: 70 EHSESAYEILD 80
           HSE A +IL+
Sbjct: 61 -HSEEALKILN 70

>Kpol_505.14 s505 (37085..37456) [372 bp, 123 aa] {ON}
          (37085..37456) [372 nt, 124 aa]
          Length = 123

 Score = 66.6 bits (161), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 31/76 (40%), Positives = 50/76 (65%), Gaps = 4/76 (5%)

Query: 9  QLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDV 68
          ++++ +++++HN  + CW+ V   K+Y+ T+FLDEHPGG E IL  AG+D TE  +D   
Sbjct: 3  KVYTYQEIAEHNTTESCWI-VIDGKVYDTTKFLDEHPGGDEIILDLAGQDATESFEDIG- 60

Query: 69 HEHSESAYEILDDNYL 84
            HS+ A +IL   Y+
Sbjct: 61 --HSDEALKILKKLYI 74

>NCAS0G02570 Chr7 complement(460218..460583) [366 bp, 121 aa] {ON}
          Anc_2.536 YMR073C
          Length = 121

 Score = 65.9 bits (159), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 31/71 (43%), Positives = 48/71 (67%), Gaps = 4/71 (5%)

Query: 9  QLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDV 68
          Q++S +Q+++HN   D W+ + + K+Y+V++FLDEHPGG E I + AG+D TE   D   
Sbjct: 3  QVYSYQQIAEHNKPDDAWI-IIEGKVYDVSKFLDEHPGGDEIIFELAGQDATEHFLDIG- 60

Query: 69 HEHSESAYEIL 79
            HS+ A +IL
Sbjct: 61 --HSDDALQIL 69

>TBLA0B01310 Chr2 (276173..276544) [372 bp, 123 aa] {ON} Anc_2.166
          YNL111C
          Length = 123

 Score = 64.7 bits (156), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 47/72 (65%), Gaps = 4/72 (5%)

Query: 9  QLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDV 68
          +L+S E+++ HN  +  W+ + + K+Y+VT+FLD HPGG E IL+ AG+D T+  +D   
Sbjct: 3  KLYSYEEIAAHNTTESAWI-IIKDKVYDVTKFLDSHPGGDEIILELAGQDATQDFEDIG- 60

Query: 69 HEHSESAYEILD 80
            HS  A E LD
Sbjct: 61 --HSNDALEFLD 70

>KLTH0A04026g Chr1 complement(337200..337901) [702 bp, 233 aa] {ON}
           weakly similar to uniprot|P40312 Saccharomyces
           cerevisiae YNL111C CYB5 Cytochrome b5, involved in the
           sterol and lipid biosynthesis pathways
          Length = 233

 Score = 66.6 bits (161), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 64/122 (52%), Gaps = 7/122 (5%)

Query: 10  LFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDVH 69
           + S+E+L+ H + +DCW++++   +Y+V+ +L +HPGGA+ +LK AG+D T      DV 
Sbjct: 33  VISREELATHTSAEDCWLAIHG-AVYDVSRYLTQHPGGAQVMLKLAGKDATAQFD--DVG 89

Query: 70  EHSESAYEILDDNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDS----TTFVPE 125
              ES    L     VG L  +   T L T +K Q       +++S ++        VPE
Sbjct: 90  HSMESLMFDLGSGACVGVLKARPVTTALSTPQKQQQASEFAPEHSSYWEQLWTWVKHVPE 149

Query: 126 LP 127
            P
Sbjct: 150 TP 151

>Skud_14.221 Chr14 complement(407119..407481) [363 bp, 120 aa]
          {ON} YNL111C (REAL)
          Length = 120

 Score = 63.9 bits (154), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 28/76 (36%), Positives = 49/76 (64%), Gaps = 4/76 (5%)

Query: 9  QLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDV 68
          +++S +++++HN  ++CW+ +   K+Y+V++F DEHPGG E I+   G+D TE   D   
Sbjct: 3  KVYSYQEVAEHNGPENCWI-IIDDKVYDVSQFKDEHPGGDEIIMDLGGQDATESFVDIG- 60

Query: 69 HEHSESAYEILDDNYL 84
            HS+ A  +L D Y+
Sbjct: 61 --HSDEALRLLKDLYI 74

>ZYRO0B09812g Chr2 (765874..766425) [552 bp, 183 aa] {ON} similar to
           uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
           Cytochrome b5 involved in the sterol and lipid
           biosynthesis pathways required for sterol C5-6 and fatty
           acid desaturation
          Length = 183

 Score = 65.5 bits (158), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 63/109 (57%), Gaps = 7/109 (6%)

Query: 9   QLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDV 68
           ++++ EQ+++HN  +D W+ V   K+Y+VT+F+++HPGG E IL  AG+D TE   D   
Sbjct: 59  KVYTFEQVAEHNTPEDAWLIV-DGKVYDVTKFVEDHPGGDEIILDLAGQDGTEAFNDIG- 116

Query: 69  HEHSESAYEILDDNYLVGYL--ATKEEATKLLTNKKHQVEVHLTDQNNS 115
             HSE A  +L D ++VG L  A++   ++ + N      V    + N 
Sbjct: 117 --HSEDAVNMLKD-FIVGSLDPASRPAKSEKVANVAQTSGVTTGGEGNG 162

>KAFR0B04550 Chr2 (946561..946941) [381 bp, 126 aa] {ON} Anc_2.166
           YNL111C
          Length = 126

 Score = 63.2 bits (152), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 55/97 (56%), Gaps = 8/97 (8%)

Query: 9   QLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDV 68
           Q+++   +++H    DCW+++   K+YNV++FLDEHPGG E I + AG D TE   D   
Sbjct: 3   QVYTYADVAEHVLPDDCWIAI-DGKVYNVSKFLDEHPGGDEIIYELAGSDATEYFLDIG- 60

Query: 69  HEHSESAYEILDDNYLVGYLATKEEATKLLTNKKHQV 105
             HS+ A +IL     +G L    E  +    KKHQV
Sbjct: 61  --HSDDALKIL-KTLCIGELDLNSEKVQ---PKKHQV 91

>Kwal_26.8461 s26 (794482..794853) [372 bp, 123 aa] {ON} YNL111C
          (CYB5) - 1:1 [contig 61] FULL
          Length = 123

 Score = 62.4 bits (150), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 29/76 (38%), Positives = 49/76 (64%), Gaps = 4/76 (5%)

Query: 9  QLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDV 68
          +L+S +++++HN EKD W+ +   K+Y+ T+F+DEHPGG E ++   G+D T    D   
Sbjct: 3  KLYSYKEIAEHNTEKDLWM-IIDGKVYDCTKFMDEHPGGEEVLVDLGGQDATGPFADIG- 60

Query: 69 HEHSESAYEILDDNYL 84
            HS+ A ++L D Y+
Sbjct: 61 --HSDDAVKMLADLYV 74

>CAGL0L03828g Chr12 (442660..443025) [366 bp, 121 aa] {ON} similar
          to uniprot|P40312 Saccharomyces cerevisiae YNL111c CYB5
          Length = 121

 Score = 62.0 bits (149), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 29/71 (40%), Positives = 46/71 (64%), Gaps = 4/71 (5%)

Query: 9  QLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDV 68
          ++++ +Q+S+HN E DCW+ +    +Y+V++FLDEHPGG E I ++ G D T    D   
Sbjct: 3  KVYTYKQVSEHNKEGDCWI-IIDGSVYDVSKFLDEHPGGDEIIFEHRGTDATGDFVDIG- 60

Query: 69 HEHSESAYEIL 79
            HS+ A +IL
Sbjct: 61 --HSDDALKIL 69

>KLTH0D09284g Chr4 (770560..770931) [372 bp, 123 aa] {ON} similar
          to uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
          Cytochrome b5 involved in the sterol and lipid
          biosynthesis pathways required for sterol C5-6 and
          fatty acid desaturation
          Length = 123

 Score = 61.6 bits (148), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 29/76 (38%), Positives = 49/76 (64%), Gaps = 4/76 (5%)

Query: 9  QLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDV 68
          +L+S +++++HN E D W+ +   K+Y+ T+F+DEHPGG E +L   G+D T    D   
Sbjct: 3  KLYSYKEIAEHNTENDLWM-IIDGKVYDCTKFMDEHPGGEEVLLDLGGQDATGPFADIG- 60

Query: 69 HEHSESAYEILDDNYL 84
            HS+ A ++L+D Y+
Sbjct: 61 --HSDDAVKMLEDLYV 74

>KNAG0I02040 Chr9 (397527..397886) [360 bp, 119 aa] {ON} Anc_2.166
          YNL111C
          Length = 119

 Score = 61.2 bits (147), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 29/76 (38%), Positives = 47/76 (61%), Gaps = 4/76 (5%)

Query: 9  QLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDV 68
          ++++ E +++H+  +D W+ V   ++Y VT+FLDEHPGG E +L+ AG D T    D   
Sbjct: 3  KIYTYEDVAQHSTSEDAWI-VIDNRVYEVTKFLDEHPGGEEILLEMAGADATTNFLDIG- 60

Query: 69 HEHSESAYEILDDNYL 84
            HS+ A +IL   Y+
Sbjct: 61 --HSDDAMKILKTRYI 74

>TPHA0F01790 Chr6 (412270..412818) [549 bp, 182 aa] {ON} Anc_2.166
           YNL111C
          Length = 182

 Score = 62.4 bits (150), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 49/76 (64%), Gaps = 4/76 (5%)

Query: 9   QLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDV 68
           ++++ E++++HN  +  W+ V + K+YNVT+FLDEHPGG E I   AG D TE  +D   
Sbjct: 61  KIYTYEEIAEHNTTESSWI-VIEGKVYNVTKFLDEHPGGDEIIFDLAGTDATENFEDIG- 118

Query: 69  HEHSESAYEILDDNYL 84
             HS+ A ++L   Y+
Sbjct: 119 --HSDQALKVLKTLYI 132

>KLLA0F27577g Chr6 (2556662..2557180) [519 bp, 172 aa] {ON} some
          similarities with uniprot|P40312 Saccharomyces
          cerevisiae YNL111C CYB5 Cytochrome b5
          Length = 172

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 50/79 (63%), Gaps = 3/79 (3%)

Query: 10 LFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDVH 69
          L + +++++H++  DCW +V   K+Y++T FL +HPGGA+ +LKYAG+D T  L+  D+ 
Sbjct: 5  LITMDEVARHSSRSDCW-TVIHGKVYDITSFLHKHPGGAQVLLKYAGKDST--LQFDDIG 61

Query: 70 EHSESAYEILDDNYLVGYL 88
             ES    LD   L G L
Sbjct: 62 HSMESLAYDLDPGALKGTL 80

>Suva_14.228 Chr14 complement(413753..414115) [363 bp, 120 aa]
          {ON} YNL111C (REAL)
          Length = 120

 Score = 59.7 bits (143), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/76 (34%), Positives = 49/76 (64%), Gaps = 4/76 (5%)

Query: 9  QLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDV 68
          +++S +++++HN  ++CW+ +   K+Y+V++F DEHPGG E I+   G+D T+   D   
Sbjct: 3  KVYSYQEVAEHNGPENCWI-IIDDKVYDVSQFKDEHPGGDEIIMDLGGQDATDSFVDIG- 60

Query: 69 HEHSESAYEILDDNYL 84
            HS+ A ++L   Y+
Sbjct: 61 --HSDEALKLLKTLYI 74

>SAKL0F08316g Chr6 complement(634949..635485) [537 bp, 178 aa]
          {ON} some similarities with uniprot|P00175
          Saccharomyces cerevisiae YML054C CYB2 Cytochrome b2
          (L-lactate cytochrome-c oxidoreductase), component of
          the mitochondrial intermembrane space, required for
          lactate utilization; expression is repressed by glucose
          and anaerobic conditions
          Length = 178

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 49/89 (55%), Gaps = 3/89 (3%)

Query: 8  LQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRD 67
          + + S  ++ KHN   DCW+ ++  K+YN+T FL +HPGGA  IL+Y GRD T+     +
Sbjct: 1  MHVISPSEVVKHNRPDDCWMIIHG-KVYNLTSFLSQHPGGAHVILQYGGRDATKQFD--E 57

Query: 68 VHEHSESAYEILDDNYLVGYLATKEEATK 96
          V    ES    LD    +G++     A +
Sbjct: 58 VGHSMESLLYDLDPKCCLGFVEGGAPADR 86

>SAKL0E10626g Chr5 (885272..885643) [372 bp, 123 aa] {ON} similar
          to uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
          Cytochrome b5 involved in the sterol and lipid
          biosynthesis pathways required for sterol C5-6 and
          fatty acid desaturation
          Length = 123

 Score = 58.9 bits (141), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 52/88 (59%), Gaps = 5/88 (5%)

Query: 9  QLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDV 68
          +LF+ +++++HN E D W+ +   K+Y+ T+F+DEHPGG E ++   G+D T    D   
Sbjct: 3  KLFTYQEIAEHNTEGDLWM-IIDGKVYDCTKFIDEHPGGEEVLVDLGGQDATGPFADIG- 60

Query: 69 HEHSESAYEILDDNYLVGYLATKEEATK 96
            HS+ A ++L+  Y +G L    E  K
Sbjct: 61 --HSDDAIKLLEPLY-IGDLDKDSEPIK 85

>AFL223W Chr6 (19601..20098) [498 bp, 165 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL111C (CYB5)
          Length = 165

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 53/82 (64%), Gaps = 4/82 (4%)

Query: 3   TKSPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEV 62
           T++   +L++ +++++HN+E D W+ +   K+Y+ T+F +EHPGG E ++  AG+D TE 
Sbjct: 36  TETTMPKLYTYQEIAEHNSENDLWL-IINGKVYDCTKFAEEHPGGDEVLIDLAGQDATEP 94

Query: 63  LKDRDVHEHSESAYEILDDNYL 84
             D     HS+ A ++L+  Y+
Sbjct: 95  FADIG---HSDDAVKMLEGLYV 113

>Kwal_47.18167 s47 complement(716570..717253) [684 bp, 227 aa] {ON}
           YNL111C (CYB5) - cytochrome b5 [contig 197] FULL
          Length = 227

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 51/93 (54%), Gaps = 3/93 (3%)

Query: 2   STKSPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITE 61
           S  S  L   S ++++ H +  DCW+S++  K+Y+V+ +L +HPGGA+ +LK AG+D T 
Sbjct: 25  SQTSSQLPFISSDEVATHTDADDCWISIHG-KVYDVSSYLPQHPGGAQVMLKLAGKDATV 83

Query: 62  VLKDRDVHEHSESAYEILDDNYLVGYLATKEEA 94
                +V    ES    L     VG L ++  A
Sbjct: 84  PFD--EVGHSIESLIYGLGPRACVGILKSRPRA 114

>Smik_14.216 Chr14 complement(396585..396947) [363 bp, 120 aa] {ON}
           YNL111C (REAL)
          Length = 120

 Score = 57.0 bits (136), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 35/115 (30%), Positives = 58/115 (50%), Gaps = 13/115 (11%)

Query: 9   QLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDV 68
           +++S +++++HN  ++ W+ +   K+Y+V++F DEHPGG E I+   G+D TE   D   
Sbjct: 3   KVYSYQEVAEHNGPENFWI-IIDDKVYDVSKFKDEHPGGDEIIMDLGGQDATESFVDIG- 60

Query: 69  HEHSESAYEILDDNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDSTTFV 123
             HS+ A  +L   Y+     T E  +         VE   T +N S    T  V
Sbjct: 61  --HSDEALRLLKGLYIGDVDKTSERVS---------VETTSTSENQSKGSGTLVV 104

>YNL111C Chr14 complement(416940..417302) [363 bp, 120 aa] {ON}
          CYB5Cytochrome b5, involved in the sterol and lipid
          biosynthesis pathways; acts as an electron donor to
          support sterol C5-6 desaturation
          Length = 120

 Score = 56.2 bits (134), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 28/87 (32%), Positives = 50/87 (57%), Gaps = 4/87 (4%)

Query: 9  QLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDV 68
          +++S +++++HN  ++ W+ +   K+Y+V++F DEHPGG E I+   G+D TE   D   
Sbjct: 3  KVYSYQEVAEHNGPENFWI-IIDDKVYDVSQFKDEHPGGDEIIMDLGGQDATESFVDIG- 60

Query: 69 HEHSESAYEILDDNYLVGYLATKEEAT 95
            HS+ A  +L   Y+     T E  +
Sbjct: 61 --HSDEALRLLKGLYIGDVDKTSERVS 85

>ADL085C Chr4 complement(535293..536114) [822 bp, 273 aa] {ON}
           NOHBY406; No homolog in Saccharomyces cerevisiae
          Length = 273

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 37/53 (69%), Gaps = 1/53 (1%)

Query: 8   LQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDIT 60
           L+  S E++S+H +  DCW  ++ R +Y++T  L+ HPGG + +LKYAGRD T
Sbjct: 90  LRKISIEEVSQHTSRDDCWFIIHGR-VYDITGLLENHPGGTKILLKYAGRDAT 141

>Ecym_5420 Chr5 (865505..865942) [438 bp, 145 aa] {ON} similar to
          Ashbya gossypii AFL223W
          Length = 145

 Score = 55.1 bits (131), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 49/83 (59%), Gaps = 4/83 (4%)

Query: 11 FSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDVHE 70
          F+ ++++ HN+E+D W+ +   K+Y+ ++F DEHPGG E +L   G+D T    D     
Sbjct: 5  FTYQEIADHNSEQDLWL-IINGKVYDCSKFADEHPGGDEVLLDLGGQDATIPFLDI---G 60

Query: 71 HSESAYEILDDNYLVGYLATKEE 93
          H++ A ++LD  Y+     T E+
Sbjct: 61 HTDDAVKLLDHMYIGDVDETSEK 83

>KLTH0D06930g Chr4 complement(604805..605419) [615 bp, 204 aa] {ON}
           weakly similar to uniprot|Q04772 Saccharomyces
           cerevisiae YMR073C Hypothetical ORF
          Length = 204

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 49/87 (56%), Gaps = 11/87 (12%)

Query: 6   PTLQLF-----SQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILK-YAGRDI 59
           PT +++     ++ QL KHN  +DCW  + QR +Y V+ +LD HPGGAE +L+  AG+D 
Sbjct: 119 PTFKIYPPIKVTKAQLQKHNTAEDCWCVLNQR-VYCVSSYLDFHPGGAEILLRTAAGKDA 177

Query: 60  TEVLKDRDVHEHSESAYEILDDNYLVG 86
           T +        H    YE L +  LVG
Sbjct: 178 TALFNKY----HRWVNYERLLETCLVG 200

>TPHA0B01820 Chr2 complement(406416..408146) [1731 bp, 576 aa] {ON}
           Anc_4.304 YML054C
          Length = 576

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 38/54 (70%), Gaps = 1/54 (1%)

Query: 9   QLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEV 62
           ++ + E++++HN   DCWV V    +YN+T+F+D HPGG   I+  +G+D+T++
Sbjct: 71  KVITPEEVARHNKRDDCWV-VINDSVYNLTDFIDSHPGGKNVIVANSGKDVTKL 123

>NCAS0A02770 Chr1 (528814..530643) [1830 bp, 609 aa] {ON} 
          Length = 609

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 42/61 (68%), Gaps = 5/61 (8%)

Query: 2   STKSPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITE 61
           STKSP     S ++++KHN+E DCW+ V   ++Y++T F+  HPGG++ I   AG+D++ 
Sbjct: 90  STKSP----ISTDEVTKHNSENDCWI-VINGQVYDLTSFMSIHPGGSDIIKLNAGKDVSA 144

Query: 62  V 62
           +
Sbjct: 145 I 145

>TDEL0H02180 Chr8 (369539..370150) [612 bp, 203 aa] {ON} 
          Length = 203

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 38/67 (56%), Gaps = 9/67 (13%)

Query: 2  STKSPTLQLFSQEQLSK--------HNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILK 53
          ST+   L+ F    L K        HN   DCW++++ R +Y+VT  L +HPGG + +LK
Sbjct: 8  STREGALENFEDRNLPKIRLAEVREHNTAHDCWMAIHGR-VYDVTPILSKHPGGCQILLK 66

Query: 54 YAGRDIT 60
          YAG D T
Sbjct: 67 YAGMDAT 73

>Ecym_4346 Chr4 (739106..739735) [630 bp, 209 aa] {ON} similar to
          Ashbya gossypii ADL085C
          Length = 209

 Score = 53.9 bits (128), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 11 FSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDIT 60
           S  ++ +H +  DCW  ++  K+Y++T  L  HPGGA+ +LKYAGRD T
Sbjct: 6  ISLSEVRRHTSADDCWFIIHN-KVYDITNLLSTHPGGAKTLLKYAGRDAT 54

>TDEL0D00190 Chr4 (29971..31629) [1659 bp, 552 aa] {ON} 
          Length = 552

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 5/74 (6%)

Query: 11  FSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDVHE 70
            S  +L KHN   DCW+++   ++Y+VT FL  HPGG   +++ AG D TE         
Sbjct: 75  ISASELRKHNTVHDCWIAL-NGEVYDVTAFLQMHPGGVARLMEVAGGDATEKF----YQI 129

Query: 71  HSESAYEILDDNYL 84
           HS+S +E + +N++
Sbjct: 130 HSDSVFEKMKNNFI 143

>KNAG0E03860 Chr5 (763388..765202) [1815 bp, 604 aa] {ON} Anc_4.304
           YML054C
          Length = 604

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 2/60 (3%)

Query: 5   SPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLK 64
           +PT +  S  +++KHN   DCWV V +  +YN+TEF+  HPGG   I   AG+D+T + K
Sbjct: 87  APT-KSISPSEVAKHNTPDDCWV-VIEGYVYNLTEFIPTHPGGPMVIKSNAGKDVTAIFK 144

>KLLA0F23672g Chr6 (2212223..2212594) [372 bp, 123 aa] {ON}
          similar to uniprot|P40312 Saccharomyces cerevisiae
          YNL111C CYB5 Cytochrome b5 involved in the sterol and
          lipid biosynthesis pathways required for sterol C5-6
          and fatty acid desaturation
          Length = 123

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 25/76 (32%), Positives = 46/76 (60%), Gaps = 4/76 (5%)

Query: 9  QLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDV 68
          +L + +++S+H    D W+ +   K+Y+ T+F+DEHPGG E ++   G+D T   +D   
Sbjct: 3  KLLTYKEVSEHKTVDDLWM-IIDGKVYDCTKFVDEHPGGDEILVDLGGQDATGPFEDIG- 60

Query: 69 HEHSESAYEILDDNYL 84
            HS+ A ++L+  Y+
Sbjct: 61 --HSDDAIKLLEPMYV 74

>KLLA0B14795g Chr2 (1299429..1301099) [1671 bp, 556 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 556

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 35/50 (70%), Gaps = 1/50 (2%)

Query: 12  SQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITE 61
           S +++  HN   DCW+ V   ++Y++T+FL +HPGG   ++++AGRD TE
Sbjct: 82  SVKEVKMHNRIDDCWI-VIDNEVYDITKFLSQHPGGVARLMEFAGRDATE 130

>ZYRO0C18524g Chr3 (1450641..1452305) [1665 bp, 554 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 554

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/42 (54%), Positives = 30/42 (71%), Gaps = 1/42 (2%)

Query: 19  HNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDIT 60
           HNN  DCW+ V   +IY+VT F+ +HPGGA  +L+ AGRD T
Sbjct: 84  HNNVNDCWI-VLNGEIYDVTSFIGKHPGGAARLLEVAGRDAT 124

>SAKL0F16610g Chr6 (1373674..1375368) [1695 bp, 564 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 564

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 33/48 (68%), Gaps = 1/48 (2%)

Query: 14  EQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITE 61
           +++  HNN  DCW+ V    +Y++TEF+  HPGGA  +++ AGRD TE
Sbjct: 91  DEVKLHNNIDDCWI-VLNGDVYDITEFIKIHPGGAARLMEVAGRDATE 137

>KLLA0D02640g Chr4 complement(225482..227251) [1770 bp, 589 aa] {ON}
           similar to uniprot|P00175 Saccharomyces cerevisiae
           YML054C CYB2 Cytochrome b2 (L-lactate cytochrome-c
           oxidoreductase) component of the mitochondrial
           intermembrane space required for lactate utilization
           expression is repressed by glucose and anaerobic
           conditions
          Length = 589

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 36/52 (69%), Gaps = 1/52 (1%)

Query: 11  FSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEV 62
            S  +++KH++ KDCWV V +  +YN+T+F+  HPGG   I   AG+D+T++
Sbjct: 90  VSPTEVAKHSSPKDCWV-VIEGYVYNLTDFISAHPGGPAIIENNAGKDVTKI 140

>ZYRO0B02090g Chr2 complement(169589..170173) [585 bp, 194 aa] {ON}
           similar to gnl|GLV|KLLA0E18535g Kluyveromyces lactis
           KLLA0E18535g and weakly similar to YMR073C
           uniprot|Q04772 Saccharomyces cerevisiae YMR073C
           Hypothetical ORF
          Length = 194

 Score = 51.2 bits (121), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 48/82 (58%), Gaps = 7/82 (8%)

Query: 6   PTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKY-AGRDITEVLK 64
           P L++  +E L +HN + DCW  V Q K+Y +T + D HPGG + +L+Y AG+D T++  
Sbjct: 115 PPLRV-DKELLRRHNTKDDCWC-VIQGKVYCLTNYFDFHPGGVDILLRYCAGKDATKMFN 172

Query: 65  DRDVHEHSESAYEILDDNYLVG 86
           +     H   +Y+ L +   VG
Sbjct: 173 E----YHRWVSYDKLLETCFVG 190

>ZYRO0D16654g Chr4 complement(1380316..1380888) [573 bp, 190 aa]
          {ON} conserved hypothetical protein
          Length = 190

 Score = 50.8 bits (120), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 1  MSTKSPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDIT 60
          +S     L   S +++ KH    DCW+ ++ R +YNV   L  HPGG++ +L Y GRD T
Sbjct: 20 LSVDDEDLPSLSWDEIRKHMTPPDCWMVIHGR-VYNVAPVLASHPGGSQILLHYVGRDAT 78

>KLTH0C11770g Chr3 (970979..972835) [1857 bp, 618 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 618

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 11  FSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDIT 60
            S  ++ +HN E DCWV V    +Y+VT F+D+HPGG+  I   AG+D++
Sbjct: 119 VSATEVIRHNKEDDCWV-VIDGYVYDVTAFIDQHPGGSAVIRGNAGKDVS 167

>SAKL0G16852g Chr7 (1452894..1454636) [1743 bp, 580 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 580

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 37/61 (60%), Gaps = 5/61 (8%)

Query: 2   STKSPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITE 61
           S+K P       + ++KHN+ KDCWV V    +Y++TEF+  HPGG   I   AG+D+T 
Sbjct: 76  SSKKP----IDPQDVAKHNDPKDCWV-VIDGYVYDLTEFIHSHPGGPTIIENNAGKDVTA 130

Query: 62  V 62
           +
Sbjct: 131 I 131

>Kpol_1014.5 s1014 complement(3107..4897) [1791 bp, 596 aa] {ON}
           complement(3107..4897) [1791 nt, 597 aa]
          Length = 596

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 40/56 (71%), Gaps = 1/56 (1%)

Query: 7   TLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEV 62
           +L++ + +++ KHN++ DCWV V    +Y++T F+ +HPGG + I+  AG+D++ +
Sbjct: 87  SLKIITPQEVIKHNSKDDCWV-VINDIVYDLTFFIKKHPGGQDVIVGNAGKDVSNI 141

>NDAI0D04710 Chr4 (1106280..1108130) [1851 bp, 616 aa] {ON}
           Anc_4.304
          Length = 616

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 36/53 (67%), Gaps = 1/53 (1%)

Query: 10  LFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEV 62
           L S ++++KH+   DCWV ++  K+Y++T F+  HPGG + I   AG+D+T +
Sbjct: 95  LISPDEVAKHHTPADCWVVIHD-KVYDLTSFIPIHPGGPDIIKSNAGKDVTNI 146

>Suva_13.105 Chr13 complement(168279..170054) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 34/54 (62%), Gaps = 1/54 (1%)

Query: 9   QLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEV 62
           Q  S  +++KHN+  DCWV V    +Y++T F+  HPGG + I   AGRD+T +
Sbjct: 89  QKISPAEVAKHNSADDCWV-VINGYVYDLTRFVPNHPGGPDVIKYNAGRDVTAI 141

>Skud_13.92 Chr13 complement(163654..165429) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 9   QLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEV 62
           Q  S  +++KHN   DCWV V    +Y++T F+  HPGG + I   AGRD+T +
Sbjct: 89  QKISPAEVAKHNKADDCWV-VINGYVYDLTRFMPNHPGGPDVIKFNAGRDVTAI 141

>NDAI0D04700 Chr4 (1103670..1105547) [1878 bp, 625 aa] {ON} 
          Length = 625

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 37/62 (59%), Gaps = 5/62 (8%)

Query: 1   MSTKSPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDIT 60
           + +K+P     +  +L KHN  +DCWV V   ++Y++T F+  HPGG   I   AG+D+T
Sbjct: 99  VKSKTP----ITPNELMKHNTPEDCWV-VINNQVYDLTTFIQVHPGGPNIIRSNAGKDVT 153

Query: 61  EV 62
            +
Sbjct: 154 AI 155

>KAFR0I00520 Chr9 complement(107239..108999) [1761 bp, 586 aa] {ON}
           Anc_4.304 YML054C
          Length = 586

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 38/62 (61%), Gaps = 1/62 (1%)

Query: 1   MSTKSPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDIT 60
           +S ++ T +L   E+++KH    DCWV V    +Y++T F+  HPGG + +   AG+D+T
Sbjct: 73  ISNEAITTRLILPEEVAKHKTPDDCWV-VINGYVYDITSFIMSHPGGPDVLETNAGKDVT 131

Query: 61  EV 62
            +
Sbjct: 132 AI 133

>Kwal_23.2823 s23 (29032..30714) [1683 bp, 560 aa] {ON} YML054C
           (CYB2) - Cytochrome b2 [L--lactate cytochrome-c
           oxidoreductase] [contig 246] FULL
          Length = 560

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 57/115 (49%), Gaps = 23/115 (20%)

Query: 19  HNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDVHEHSESAYEI 78
           HN   DCW+ V   ++Y+VT F+  HPGG + IL+ AG D TE         HSE     
Sbjct: 89  HNKLNDCWI-VLNDEVYDVTSFIAAHPGGVQRILEVAGSDATEKF----YQIHSEDVLNK 143

Query: 79  LDDNYL-VGYLATKEEATKLLTNKKHQVEVHLTDQ-----------NNSDFDSTT 121
           + +  + VG L  K + +K++T +    E+ + DQ           N++DF+S  
Sbjct: 144 MKEKLVYVGKL--KGKFSKIVTEE----ELRIQDQRLKMPPLSMIFNSTDFESVA 192

>Smik_13.92 Chr13 complement(163135..164910) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 9   QLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEV 62
           Q  S  +++KHN   DCWV V    +Y++T FL  HPGG + I   AG+D+T +
Sbjct: 89  QKISPAEVAKHNKPDDCWV-VINGYVYDLTRFLPNHPGGQDVIKFNAGKDVTAI 141

>YML054C Chr13 complement(165533..167308) [1776 bp, 591 aa] {ON}
           CYB2Cytochrome b2 (L-lactate cytochrome-c
           oxidoreductase), component of the mitochondrial
           intermembrane space, required for lactate utilization;
           expression is repressed by glucose and anaerobic
           conditions
          Length = 591

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 9   QLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEV 62
           Q  S  +++KHN   DCWV V    +Y++T FL  HPGG + I   AG+D+T +
Sbjct: 89  QKISPAEVAKHNKPDDCWV-VINGYVYDLTRFLPNHPGGQDVIKFNAGKDVTAI 141

>KLTH0C11858g Chr3 (979073..980740) [1668 bp, 555 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 555

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 58/114 (50%), Gaps = 13/114 (11%)

Query: 15  QLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDVHEHSES 74
           ++ +HN   DCW+ V   ++Y+VT FL  HPGGA  I++ AG D T          HS+S
Sbjct: 80  EVMQHNKPDDCWI-VLNGEVYDVTSFLQMHPGGAARIMEVAGNDATRKF----YSIHSDS 134

Query: 75  AYEILDDNYL-VGYLATK------EEATKLLTNKKHQVEVHLTDQNNSDFDSTT 121
             E + +  + +G L  K      EE  ++  ++K+   + L   N SDF++  
Sbjct: 135 TLEKMKEQLVYIGKLKGKFAETISEEDLRIRESRKNIPSLGLI-FNLSDFEAVA 187

>NCAS0A02780 Chr1 (531072..532880) [1809 bp, 602 aa] {ON} Anc_4.304
          Length = 602

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 34/54 (62%), Gaps = 1/54 (1%)

Query: 9   QLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEV 62
           ++    ++++HN   DCW+ V    +Y++T F+  HPGGA+ I   AG+D+T +
Sbjct: 87  RVIDPSEVARHNTPADCWI-VINGVVYDLTSFIPVHPGGADIIKSNAGKDVTAI 139

>Kwal_26.8046 s26 complement(621715..622311) [597 bp, 198 aa] {ON}
           YMR073C - Hypothetical ORF [contig 55] FULL
          Length = 198

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 43/77 (55%), Gaps = 6/77 (7%)

Query: 11  FSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILK-YAGRDITEVLKDRDVH 69
            ++ QL++H   +DCW  + Q K+Y ++ +LD HPGG + ++K  AG+D T +       
Sbjct: 123 INKAQLAQHKAPEDCWCVINQ-KVYCISSYLDFHPGGVDILMKGAAGKDCTSMFN----K 177

Query: 70  EHSESAYEILDDNYLVG 86
            H    YE + +  LVG
Sbjct: 178 YHRWVNYEKVLETSLVG 194

>ZYRO0B13728g Chr2 (1110636..1112432) [1797 bp, 598 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 598

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 33/52 (63%), Gaps = 1/52 (1%)

Query: 11  FSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEV 62
            S ++++KHN+  DCWV V    +Y++TEF   HPGG   I   AG+D++ +
Sbjct: 84  ISPDEVAKHNSPDDCWV-VIDGYVYDLTEFAPVHPGGPTVIKSNAGKDVSAI 134

>CAGL0K10736g Chr11 (1046127..1047908) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P00175 Saccharomyces cerevisiae
           YML054c CYB2 lactate dehydrogenase cytochrome b2
          Length = 593

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 11  FSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEV 62
            S  ++ KHN  +DCWV V    +Y++T F+  HPGG + I   AG+D+T +
Sbjct: 90  ISPSEVIKHNTPEDCWV-VIDGYVYDLTNFIALHPGGPDIIKTNAGKDVTAI 140

>TDEL0D01140 Chr4 complement(214858..216612) [1755 bp, 584 aa] {ON}
           Anc_4.304 YML054C
          Length = 584

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 35/61 (57%), Gaps = 1/61 (1%)

Query: 2   STKSPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITE 61
           + K  T +    +++ KHN   DCWV V    +Y++++F+  HPGG   I   AG+D++ 
Sbjct: 69  TVKDSTKKSIDPKEVEKHNAPDDCWV-VIDGYVYDLSDFIPSHPGGPAVIRANAGKDVSA 127

Query: 62  V 62
           +
Sbjct: 128 I 128

>SAKL0A09570g Chr1 complement(838406..839041) [636 bp, 211 aa] {ON}
           similar to gnl|GLV|CAGL0K03069g Candida glabrata
           CAGL0K03069g and weakly similar to YMR073C
           uniprot|Q04772 Saccharomyces cerevisiae YMR073C
           Hypothetical ORF
          Length = 211

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 36/57 (63%), Gaps = 3/57 (5%)

Query: 5   SPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYIL-KYAGRDIT 60
           +P L++  +++L KH    DCW  V + K+Y ++ + D HPGG E +L K AGRD T
Sbjct: 131 NPPLKI-DKDELIKHKTVDDCWC-VLKGKVYCLSAYFDFHPGGVEILLNKCAGRDAT 185

>CAGL0K03069g Chr11 complement(285190..285774) [585 bp, 194 aa] {ON}
           weakly similar to uniprot|Q04772 Saccharomyces
           cerevisiae YMR073c
          Length = 194

 Score = 45.1 bits (105), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 34/47 (72%), Gaps = 2/47 (4%)

Query: 15  QLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYIL-KYAGRDIT 60
           +L++HN  +DCW +V   K+Y+++ +L  HPGGA+ ++ K +G+D T
Sbjct: 123 ELARHNTAEDCW-TVINGKVYSISSYLSFHPGGAKILIDKSSGQDST 168

>NDAI0H01370 Chr8 (336807..337481) [675 bp, 224 aa] {ON} Anc_2.536
          Length = 224

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 41/66 (62%), Gaps = 7/66 (10%)

Query: 6   PTLQL-----FSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYIL-KYAGRDI 59
           PT +L     F+ + L KH +E DCW +V+  K+Y +T +L  HPGGA+ +L + AG+D 
Sbjct: 137 PTFKLKPYLRFNHKILQKHVSEDDCW-TVHNGKVYCMTYYLHFHPGGADILLEEAAGKDC 195

Query: 60  TEVLKD 65
           T +  +
Sbjct: 196 TRLFNE 201

>NCAS0F00870 Chr6 (177678..178247) [570 bp, 189 aa] {ON} Anc_2.536
           YMR073C
          Length = 189

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 40/66 (60%), Gaps = 7/66 (10%)

Query: 1   MSTKSPTLQLF-----SQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILK-Y 54
           +  + PT Q++     +   L +H +  DCW ++Y+ K+Y V+++L+ HPGG + I +  
Sbjct: 98  IRMRVPTYQIYPFLKINNSILQRHTSRTDCW-TIYKGKVYCVSDYLEYHPGGPDIIFQNC 156

Query: 55  AGRDIT 60
           AG+D T
Sbjct: 157 AGKDST 162

>KAFR0A04740 Chr1 (942850..944301) [1452 bp, 483 aa] {ON} Anc_6.106
           YGL055W
          Length = 483

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 52/110 (47%), Gaps = 15/110 (13%)

Query: 11  FSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDVHE 70
           +S+ Q     NE+   +++    +++VT+F++EHPGG   I +  G+D T V     V+ 
Sbjct: 386 YSEFQRQIEKNERK--LTIIGGVVHDVTDFINEHPGGEPLIKEALGKDATRVFSG-GVYS 442

Query: 71  HSESAYEILDDNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDST 120
           HS +AY I         LAT   A   + N+K    V    +    +D T
Sbjct: 443 HSNAAYNI---------LATLRVA---VINEKQNTAVTFARKRGEKYDRT 480

>Kwal_14.807 s14 complement(57218..58954) [1737 bp, 578 aa] {ON}
           YML054C (CYB2) - Cytochrome b2 [L--lactate cytochrome-c
           oxidoreductase] [contig 245] FULL
          Length = 578

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 32/49 (65%), Gaps = 1/49 (2%)

Query: 14  EQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEV 62
           ++++KH+   DCWV V    +Y++++F+  HPGG   I   AG+D++ +
Sbjct: 82  QEVAKHSKPDDCWV-VINGYVYDLSDFIAVHPGGPAIIKANAGKDVSAI 129

>KNAG0C05780 Chr3 (1124591..1125133) [543 bp, 180 aa] {ON} Anc_2.536
           YMR073C
          Length = 180

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 6/74 (8%)

Query: 13  QEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDVHEHS 72
           Q+ LSKH    D W +VY+ K+Y ++ +LD HPGG E I+ +A RD  ++    D +   
Sbjct: 108 QDYLSKH----DFW-AVYKGKVYCLSYYLDFHPGGIEIIIDHATRDPPDIRGAFDRYHRW 162

Query: 73  ESAYEILDDNYLVG 86
            SA ++L +  LVG
Sbjct: 163 VSAEKLL-ETCLVG 175

>TDEL0A03110 Chr1 complement(554890..555492) [603 bp, 200 aa] {ON}
           Anc_2.536 YMR073C
          Length = 200

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 41/81 (50%), Gaps = 6/81 (7%)

Query: 11  FSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILK-YAGRDITEVLKDRDVH 69
             +E L KH    DCW  V + ++Y +T + D HPGG + + K  AG+D TE+       
Sbjct: 125 IDRELLQKHKTLDDCWC-VIKGRVYCLTYYFDFHPGGVDILFKTCAGKDGTEMFN----K 179

Query: 70  EHSESAYEILDDNYLVGYLAT 90
            H   +++ L +  LVG   +
Sbjct: 180 YHRWVSFDKLLETCLVGVFVS 200

>TBLA0I01530 Chr9 (334102..334767) [666 bp, 221 aa] {ON} Anc_2.536
           YMR073C
          Length = 221

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 34/53 (64%), Gaps = 2/53 (3%)

Query: 11  FSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYA-GRDITEV 62
            +Q+ LS+H    DCW  V + ++Y+++ ++D HPGG + ++    G+D++ +
Sbjct: 144 INQKILSEHQEVDDCWC-VIKGRVYSISRYMDYHPGGKQILINTCLGKDVSNL 195

>Kpol_478.17 s478 (61375..62829) [1455 bp, 484 aa] {ON}
           (61375..62829) [1455 nt, 485 aa]
          Length = 484

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 47/94 (50%), Gaps = 2/94 (2%)

Query: 8   LQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRD 67
           L ++S++Q  + N + D  + V    ++NV  ++++HPGG   I    G+D T    +  
Sbjct: 382 LPVWSKDQFLE-NLKSDPELVVISGVVHNVKNYINDHPGGKTLIKSALGKDATSAF-NGG 439

Query: 68  VHEHSESAYEILDDNYLVGYLATKEEATKLLTNK 101
           V+ HS +A  +L D  +      KE A KL   +
Sbjct: 440 VYRHSNAAQNVLADFRVALLDDGKESALKLAAKR 473

>Kpol_348.12 s348 complement(21978..22631) [654 bp, 217 aa] {ON}
           complement(21978..22631) [654 nt, 218 aa]
          Length = 217

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 40/68 (58%), Gaps = 7/68 (10%)

Query: 1   MSTKSPTLQL-----FSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYIL-KY 54
           +S   PT +L      +++ ++KH +  DCW  + + K+Y+++ +   HPGG + ++ + 
Sbjct: 128 LSEGVPTFKLMPPLMITKKMVAKHKDIDDCWC-IIRGKVYSISNYFKFHPGGDKILINQC 186

Query: 55  AGRDITEV 62
           +GRD T+ 
Sbjct: 187 SGRDCTKA 194

>TPHA0G03550 Chr7 complement(755688..756344) [657 bp, 218 aa] {ON}
           Anc_2.536 YMR073C
          Length = 218

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 37/58 (63%), Gaps = 5/58 (8%)

Query: 6   PTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILK--YAGRDITE 61
           P L++ S++ +++HN   DCW  + + K+Y +T + + HPGG + ILK   +G D TE
Sbjct: 139 PPLRI-SEKMVAEHNTVDDCWC-IIKGKVYCITNYFEYHPGG-DKILKNFCSGVDATE 193

>NDAI0I01620 Chr9 complement(382761..384086) [1326 bp, 441 aa] {ON}
           Anc_6.106
          Length = 441

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 45/93 (48%), Gaps = 4/93 (4%)

Query: 14  EQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDVHEHSE 73
            +++ +NN K   + +    I++VT +  EHPGG + +    G+D T   +   V+ HS 
Sbjct: 348 NEVNSNNNRK---LVIISGIIHDVTNYTKEHPGGEKLLNSAVGKDGTRAFQG-GVYRHSN 403

Query: 74  SAYEILDDNYLVGYLATKEEATKLLTNKKHQVE 106
           SA+ +L D  +      K+ A   +  +  + +
Sbjct: 404 SAHNVLADMRIAILKEKKDSAINFVKRRGEKFD 436

>CAGL0I00418g Chr9 (30058..31530) [1473 bp, 490 aa] {ON} highly
           similar to uniprot|P21147 Saccharomyces cerevisiae
           YGL055w OLE1 stearoyl-CoA desaturase
          Length = 490

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 48/103 (46%), Gaps = 2/103 (1%)

Query: 4   KSPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVL 63
           K   L  +++E+  + N E D  V V    +++V+ ++ EHPGG + +    G+D T+  
Sbjct: 382 KLADLPAWTKEEFLEKNRENDGLVIV-GGIVHDVSGYITEHPGGEKLLKNALGKDATKAF 440

Query: 64  KDRDVHEHSESAYEILDDNYLVGYLATKEEATKLLTNKKHQVE 106
               V+ HS +A+  L    +      KE A +    +  + E
Sbjct: 441 SG-GVYRHSNAAHNTLATMRVAVMKDNKETAMRFAQKRGERAE 482

>KNAG0F03250 Chr6 complement(607667..609136) [1470 bp, 489 aa] {ON}
           Anc_6.106 YGL055W
          Length = 489

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 2/71 (2%)

Query: 34  IYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDVHEHSESAYEILDDNYLVGYLATKEE 93
           I++VT F++EHPGGA  +    G+D T       V+ HS +A+ +L  N  V   + K  
Sbjct: 414 IHDVTGFVEEHPGGAPLLNDALGKDATTAFTG-GVYRHSNAAHNVL-ANMRVAVASEKVN 471

Query: 94  ATKLLTNKKHQ 104
           A  L   ++ +
Sbjct: 472 AAYLFAGRRGE 482

>KAFR0A01890 Chr1 complement(392001..392486) [486 bp, 161 aa] {ON}
           Anc_2.536 YMR073C
          Length = 161

 Score = 37.7 bits (86), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 37/56 (66%), Gaps = 1/56 (1%)

Query: 4   KSPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDI 59
           ++P++ + +++ L +H   K+ +  VY+ K+Y+++ +L+ HPGG E IL    +++
Sbjct: 78  RNPSINI-NKKILQRHQISKEDFWGVYKGKVYSLSRYLEYHPGGIEIILNNCKKNV 132

>Skud_7.226 Chr7 (402118..403647) [1530 bp, 509 aa] {ON} YGL055W
           (REAL)
          Length = 509

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 35/68 (51%), Gaps = 1/68 (1%)

Query: 34  IYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDVHEHSESAYEILDDNYLVGYLATKEE 93
           +++V+ ++ EHPGG   I    G+D T+      V+ HS +A  +L D  +     +K  
Sbjct: 433 VHDVSGYISEHPGGETLIKTALGKDATKAFSG-GVYRHSNAAQNVLADMRVAIIKESKNS 491

Query: 94  ATKLLTNK 101
           A ++ + +
Sbjct: 492 AVRMASKR 499

>YGL055W Chr7 (398628..400160) [1533 bp, 510 aa] {ON}  OLE1Delta(9)
           fatty acid desaturase, required for monounsaturated
           fatty acid synthesis and for normal distribution of
           mitochondria
          Length = 510

 Score = 38.5 bits (88), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 35/68 (51%), Gaps = 1/68 (1%)

Query: 34  IYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDVHEHSESAYEILDDNYLVGYLATKEE 93
           +++V+ ++ EHPGG   I    G+D T+      V+ HS +A  +L D  +     +K  
Sbjct: 434 VHDVSGYISEHPGGETLIKTALGKDATKAFSG-GVYRHSNAAQNVLADMRVAVIKESKNS 492

Query: 94  ATKLLTNK 101
           A ++ + +
Sbjct: 493 AIRMASKR 500

>Smik_7.225 Chr7 (393200..394732) [1533 bp, 510 aa] {ON} YGL055W
           (REAL)
          Length = 510

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 35/68 (51%), Gaps = 1/68 (1%)

Query: 34  IYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDVHEHSESAYEILDDNYLVGYLATKEE 93
           +++V+ ++ EHPGG   I    G+D T+      V+ HS +A  +L D  +     +K  
Sbjct: 434 VHDVSGYISEHPGGETLIKTALGKDATKAFSG-GVYRHSNAAQNVLADMRVAIIKESKNS 492

Query: 94  ATKLLTNK 101
           A ++ + +
Sbjct: 493 AIRMASKR 500

>TBLA0C06220 Chr3 (1507690..1509174) [1485 bp, 494 aa] {ON} 
          Length = 494

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 29/46 (63%), Gaps = 1/46 (2%)

Query: 34  IYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDVHEHSESAYEIL 79
           ++++T ++D HPGG + I +  G+D T V  +  V+ HS +A  +L
Sbjct: 415 VHDITNYIDRHPGGQKLIKEARGKDATSVF-NGGVYNHSNAANNVL 459

>KLLA0E18459g Chr5 (1641507..1641953) [447 bp, 148 aa] {ON} similar
           to uniprot|Q59TA9 Candida albicans CaO19 Potential
           heme/steroid binding protein and some similarites with
           YMR073C uniprot|Q04772 Saccharomyces cerevisiae YMR073C
           Hypothetical ORF
          Length = 148

 Score = 35.4 bits (80), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 5/71 (7%)

Query: 23  KDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDVHEHSESAYEILDDN 82
           KD +  V  RK+Y +  +L  HPGG   + + AG+D+T +        H    YE L + 
Sbjct: 81  KDNFWCVINRKVYCIKAYLSYHPGGEVILKQCAGKDVTSLFN----KYHRWVNYERLLET 136

Query: 83  YLVG-YLATKE 92
             +G Y+ + E
Sbjct: 137 CFIGMYVGSAE 147

>AAR153C Chr1 complement(619953..621389) [1437 bp, 478 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL055W
           (OLE1)
          Length = 478

 Score = 36.6 bits (83), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 1/73 (1%)

Query: 34  IYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDVHEHSESAYEILDDNYLVGYLATKEE 93
           +++V+ ++ EHPGG   I    G+D T       V+ HS +A+ IL    +      ++ 
Sbjct: 403 VHDVSGYITEHPGGETLIQAALGKDATRAFNG-GVYMHSNAAHNILATMRVAVVKEGQDA 461

Query: 94  ATKLLTNKKHQVE 106
           AT+    +   +E
Sbjct: 462 ATRFAARRGEALE 474

>TDEL0E03250 Chr5 complement(612008..613618) [1611 bp, 536 aa] {ON} 
          Length = 536

 Score = 36.6 bits (83), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 46/90 (51%), Gaps = 3/90 (3%)

Query: 5   SPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLK 64
           S T Q F++    ++ N K   V V +  +++VT F+  HPGG   +    G+D T+   
Sbjct: 413 SMTPQQFTELAKQQYANNKRALV-VIEGIVHDVTPFIHSHPGGTALVKISIGKDATQAF- 470

Query: 65  DRDVHEHSESAYEILDDNYLVGYLATKEEA 94
           +  V+ HS++A  +L     +  L++ E+ 
Sbjct: 471 NGAVYLHSQAARNLL-ATMRIAMLSSSEQV 499

>AAL078W Chr1 (209600..211378) [1779 bp, 592 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGL055W
          Length = 592

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 5/76 (6%)

Query: 8   LQLFSQEQLS----KHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVL 63
           L + + EQ +    K   EK+  +   +  I++VT F+ +HPGG   ++   G+D T   
Sbjct: 466 LPMITPEQFATVARKDYEEKEKALVAIEGIIHDVTPFMHDHPGGMALVVASVGKDATPAF 525

Query: 64  KDRDVHEHSESAYEIL 79
            +  V+ HS +A  +L
Sbjct: 526 -NGAVYAHSTAARNLL 540

>NCAS0D03250 Chr4 (608476..609969) [1494 bp, 497 aa] {ON} Anc_6.106
          Length = 497

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 8/73 (10%)

Query: 9   QLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDV 68
           +   Q QL+K+       + V    I++++ ++ EHPGG   I +  G+D T   +   V
Sbjct: 403 EFVEQAQLNKN-------LVVISGIIHDISNYIPEHPGGESLIKQALGKDATRAFQG-GV 454

Query: 69  HEHSESAYEILDD 81
           + HS +A  +L +
Sbjct: 455 YRHSTAAQNVLSE 467

>Ecym_3080 Chr3 (149461..150900) [1440 bp, 479 aa] {ON} similar to
           Ashbya gossypii AAR153C
          Length = 479

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 36/68 (52%), Gaps = 1/68 (1%)

Query: 34  IYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDVHEHSESAYEILDDNYLVGYLATKEE 93
           +++VT ++ EHPGG   I    G+D T+   +  V+ HS +A+ IL    +      ++ 
Sbjct: 404 VHDVTGYITEHPGGETLIRASLGKDATKAF-NGGVYLHSNAAHNILATMRVAVVKDGQDA 462

Query: 94  ATKLLTNK 101
           A++ +  +
Sbjct: 463 ASRFVARR 470

>SAKL0A07326g Chr1 (648420..649862) [1443 bp, 480 aa] {ON}
           uniprot|Q9HFB2 Saccharomyces kluyveri Sk Delta 9- fatty
           acid desaturase
          Length = 480

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 29/46 (63%), Gaps = 1/46 (2%)

Query: 34  IYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDVHEHSESAYEIL 79
           +++V+ ++ EHPGG   I   AG+D T+   +  V+ HS +A+ +L
Sbjct: 404 VHDVSGYITEHPGGETLIQAAAGKDATKAF-NGGVYLHSNAAHNVL 448

>TPHA0B02700 Chr2 (620423..621889) [1467 bp, 488 aa] {ON} Anc_6.106
           YGL055W
          Length = 488

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 34/68 (50%), Gaps = 1/68 (1%)

Query: 34  IYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDVHEHSESAYEILDDNYLVGYLATKEE 93
           +++V  ++ EHPGG   I    G+D T    +  V+ HS +A  +L +  +   + ++E 
Sbjct: 411 VHDVKGYITEHPGGQLLIKSALGKDATSAF-NGGVYRHSNAATNVLANLRVAVIVESEES 469

Query: 94  ATKLLTNK 101
           A K    +
Sbjct: 470 ALKFAARR 477

>Skud_13.229 Chr13 complement(386598..387203) [606 bp, 201 aa] {ON}
           YMR073C (REAL)
          Length = 201

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 6   PTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRD 58
           P L++ ++E + +H   +D    V   K+Y+++ +L  HPGG + +LK  G +
Sbjct: 121 PPLRI-NKEIVKRHCKGEDELWCVINSKVYDISSYLKFHPGGTKILLKNCGSE 172

>SAKL0G10274g Chr7 complement(874738..876306) [1569 bp, 522 aa] {ON}
           weakly similar to uniprot|P21147 Saccharomyces
           cerevisiae YGL055W OLE1 Fatty acid desaturase required
           for monounsaturated fatty acid synthesis and for normal
           distribution of mitochondria
          Length = 522

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 49/109 (44%), Gaps = 8/109 (7%)

Query: 11  FSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDVHE 70
           F++   S++   K   V++ +  +++VT F+ +HPGG   +    G+D T    +  V+ 
Sbjct: 397 FAKLAQSEYRTNKRALVAI-EGIVHDVTPFIYDHPGGVTLVETSIGKDATAAF-NGAVYS 454

Query: 71  HSESAYEILDDNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDS 119
           HS +A  +L    +        E  + +  K      HL + NN   DS
Sbjct: 455 HSRAARNLLATMRIAVLRRGPMEVQQTVWEK------HLLESNNFKSDS 497

>ZYRO0C05016g Chr3 (394581..396032) [1452 bp, 483 aa] {ON} similar
           to uniprot|P21147 Saccharomyces cerevisiae YGL055W OLE1
           Fatty acid desaturase required for monounsaturated fatty
           acid synthesis and for normal distribution of
           mitochondria
          Length = 483

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 47/90 (52%), Gaps = 5/90 (5%)

Query: 13  QEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYA-GRDITEVLKDRDVHEH 71
           QE L++    K   + V    +++V+ +L EHPGG E +LK A G+D T+   +  V+ H
Sbjct: 388 QEYLNQCEGRKG--LVVISGIVHDVSGYLTEHPGG-ETLLKAALGKDATKAF-NGGVYRH 443

Query: 72  SESAYEILDDNYLVGYLATKEEATKLLTNK 101
           S +A+ +L    +      +++A +    +
Sbjct: 444 SNAAHNVLATMRVAVVKEGEQQAIRFAARR 473

>Suva_13.250 Chr13 complement(393510..394115) [606 bp, 201 aa] {ON}
           YMR073C (REAL)
          Length = 201

 Score = 33.9 bits (76), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 6   PTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRD 58
           P L++ ++E + KH   +D +  V   K+Y+++ +L  HPGG++ +L++   D
Sbjct: 121 PPLRI-NREIVKKHCKGEDEFWCVINGKVYDISGYLKFHPGGSKIVLRHRDSD 172

>Kwal_23.5693 s23 (1277807..1279348) [1542 bp, 513 aa] {ON} YGL055W
           (OLE1) - delta-9-fatty acid desaturase [contig 11] FULL
          Length = 513

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 28/46 (60%), Gaps = 1/46 (2%)

Query: 34  IYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDVHEHSESAYEIL 79
           +++VT F+ +HPGG   +    G+D T+   +  V+ HS++A  +L
Sbjct: 410 VHDVTPFIHDHPGGVALVETSIGKDATQAF-NGAVYSHSQAARNLL 454

>KLTH0H06798g Chr8 (596966..598432) [1467 bp, 488 aa] {ON}
           uniprot|P79047 Delta 9-fatty acid desaturase
          Length = 488

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 35/73 (47%), Gaps = 1/73 (1%)

Query: 34  IYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDVHEHSESAYEILDDNYLVGYLATKEE 93
           +++V+ ++ EHPGG   I    G+D T+   +  V+ HS +A+ +L    +       + 
Sbjct: 412 VHDVSNYITEHPGGETLIQAALGKDATKAF-NGGVYLHSNAAHNVLATMRVAVVKEGVDA 470

Query: 94  ATKLLTNKKHQVE 106
           A K    +   +E
Sbjct: 471 AAKFAARRGESLE 483

>Smik_13.252 Chr13 complement(396365..396970) [606 bp, 201 aa] {ON}
           YMR073C (REAL)
          Length = 201

 Score = 33.5 bits (75), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 25/43 (58%)

Query: 16  LSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRD 58
           + KH  ++D    V   K+Y+++ +L  HPGG + +L++   D
Sbjct: 130 VKKHCKDEDELWCVINNKVYDISSYLKFHPGGTDILLRHRNSD 172

>KLLA0C05566g Chr3 complement(497877..499310) [1434 bp, 477 aa] {ON}
           similar to uniprot|P21147 Saccharomyces cerevisiae
           YGL055W OLE1 Fatty acid desaturase required for
           monounsaturated fatty acid synthesis and for normal
           distribution of mitochondria
          Length = 477

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 1/73 (1%)

Query: 34  IYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDVHEHSESAYEILDDNYLVGYLATKEE 93
           +++V+ ++ EHPGG   I    G+D T+   +  V+ HS +A+ IL    +       ++
Sbjct: 404 VHDVSGYITEHPGGETLIQASLGKDATKAF-NGGVYLHSNAAHNILATMRIAVVKDNVDQ 462

Query: 94  ATKLLTNKKHQVE 106
           A K    +    E
Sbjct: 463 AAKFAARRGEVYE 475

>ZYRO0E01496g Chr5 complement(108148..110756,110823..110847) [2634
           bp, 877 aa] {ON} similar to uniprot|P37296 Saccharomyces
           cerevisiae YMR054W STV1 Subunit of vacuolar-ATPase V0
           domain one of two isoforms (Stv1p and Vph1p) Stv1p is
           located in V- ATPase complexes of the Golgi and
           endosomes while Vph1p is located in V-ATPase complexes
           of the vacuole
          Length = 877

 Score = 33.9 bits (76), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 63/136 (46%), Gaps = 19/136 (13%)

Query: 34  IYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDVHE---HSESAYEILDDNYLVGYLAT 90
           I+ VT FL  HPG    +    GR+  E+   RDV E   + +   E L D +      +
Sbjct: 154 IFEVTRFLQSHPG----LFGRMGREEREL---RDVDEFRLNLDELSETLSDTF------S 200

Query: 91  KEEATKLLTNKKHQVEVHLTDQNNSDFDSTTFVPELPAEEKLNIATDYGRDYKKHKFLDL 150
            E+ T+  T+++ Q +  L DQ   +F++   + E+   ++  IA    RD  +     L
Sbjct: 201 FEDGTE-PTDEQQQQQEALNDQ--MEFEADQNLLEIGFHDRFMIAGSIRRDKVEVLNRIL 257

Query: 151 NRALLPQVMFGNFSKD 166
            R L   ++F NF+ D
Sbjct: 258 WRLLRGNLIFQNFAID 273

>KLTH0G06358g Chr7 complement(503325..504866) [1542 bp, 513 aa] {ON}
           weakly similar to uniprot|P21147 Saccharomyces
           cerevisiae YGL055W OLE1 Fatty acid desaturase required
           for monounsaturated fatty acid synthesis and for normal
           distribution of mitochondria
          Length = 513

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 28/46 (60%), Gaps = 1/46 (2%)

Query: 34  IYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDVHEHSESAYEIL 79
           +++VT F+ +HPGG   +    G+D T+   +  V+ HS++A  +L
Sbjct: 410 VHDVTPFIHDHPGGVALVETSIGKDATQAF-NGAVYLHSQAARNLL 454

>Ecym_7251 Chr7 (530372..530959) [588 bp, 195 aa] {ON} similar to
           Saccharomyces cerevisiae YMR073C
          Length = 195

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 25/38 (65%), Gaps = 1/38 (2%)

Query: 28  SVYQRKIYNVTEFLDEHPGGAEYILKYA-GRDITEVLK 64
            V + ++Y +T++LD HPGG + ++K   G+D T + +
Sbjct: 136 CVLKGRVYCITDYLDFHPGGVQILVKNCRGKDATRLFE 173

>TDEL0G03650 Chr7 (673347..674798) [1452 bp, 483 aa] {ON} Anc_6.106
           YGL055W
          Length = 483

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 28/46 (60%), Gaps = 1/46 (2%)

Query: 34  IYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDVHEHSESAYEIL 79
           +++V+ ++ EHPGG   +    G+D T+   +  V+ HS +A+ +L
Sbjct: 407 VHDVSGYITEHPGGETLLQAALGKDATKAF-NGGVYRHSNAAHNVL 451

>KLLA0C10692g Chr3 complement(916718..918280) [1563 bp, 520 aa] {ON}
           weakly similar to uniprot|P21147 Saccharomyces
           cerevisiae YGL055W OLE1 Fatty acid desaturase required
           for monounsaturated fatty acid synthesis and for normal
           distribution of mitochondria
          Length = 520

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 40/83 (48%), Gaps = 3/83 (3%)

Query: 34  IYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDVHEHSESAYEILDDNYLVGYLATKEE 93
           +++VT F+ +HPGG   +    G+D T+   +  V+ HS +A  +L    +   + T + 
Sbjct: 417 VHDVTPFIYDHPGGVTLVETSIGKDATQAF-NGAVYRHSNAARNLLATMRVA--VITDQS 473

Query: 94  ATKLLTNKKHQVEVHLTDQNNSD 116
           +    T  +     + T +NN D
Sbjct: 474 SNIQRTTWEENSIANATHRNNMD 496

>Ecym_3180 Chr3 (344929..346794) [1866 bp, 621 aa] {ON} similar to
           Ashbya gossypii AAL078W
          Length = 621

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 29  VYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDVHEHSESAYEIL 79
           V +  +++VT F+ +HPGG   ++   G+D T    +  V+ HS +A  +L
Sbjct: 519 VIEDIVHDVTPFIHDHPGGVALVVCAIGKDATPAF-NGAVYAHSTAARNLL 568

>YMR073C Chr13 complement(412268..412873) [606 bp, 201 aa] {ON}
           IRC21Putative protein of unknown function; may be
           involved in resistance to carboplatin and cisplatin;
           null mutant displays increase in spontaneous Rad52p
           foci; contains a lipid-binding domain and binds
           cardiolipin in a large-scale study
          Length = 201

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 6   PTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRD 58
           P L++ +++ + KH   +D    V   K+Y+++ +L  HPGG + ++K+   D
Sbjct: 121 PPLRI-NRKIVKKHCKGEDELWCVINGKVYDISSYLKFHPGGTDILIKHRNSD 172

>ZYRO0G16742g Chr7 (1373818..1375449) [1632 bp, 543 aa] {ON} weakly
           similar to uniprot|P21147 Saccharomyces cerevisiae
           YGL055W OLE1 Fatty acid desaturase required for
           monounsaturated fatty acid synthesis and for normal
           distribution of mitochondria
          Length = 543

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 37/74 (50%), Gaps = 2/74 (2%)

Query: 29  VYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDVHEHSESAYEILDDNYLVGYL 88
           V +  +++VT F+ +HPGG   +    G+D T    +  V+ HS++A  +L     +  L
Sbjct: 443 VIEGIVHDVTPFIHDHPGGTALVQLSVGKDATHAF-NGAVYFHSKAARNLL-ATMRIAKL 500

Query: 89  ATKEEATKLLTNKK 102
           ++ E     +  ++
Sbjct: 501 SSSERVQNTVWERR 514

>TPHA0I01580 Chr9 complement(358279..362019) [3741 bp, 1246 aa] {ON}
           Anc_8.599 YPL110C
          Length = 1246

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 39/91 (42%), Gaps = 15/91 (16%)

Query: 222 KLFS-TFLFCLGI-----FVWTLIEYCLHRFLFHLDEWLPDNNAALTLHFLLHG---VHH 272
           KLFS T LF   +         LIEY  H ++F    W P   A      +LHG   +  
Sbjct: 571 KLFSWTPLFIAAVENNLEIAKLLIEYGAHVYVFDESGWTPLEQA------VLHGNLELAD 624

Query: 273 YLPMDRYRLVMPPTLGIVLMAPIYKTVFGLL 303
           YL +D Y  +M P  G  +   + + ++  L
Sbjct: 625 YLKLDGYDNIMKPEFGANIRDKLNEGIYNTL 655

>Kwal_14.1845 s14 (491597..492463) [867 bp, 288 aa] {ON} YGL055W
           (OLE1) - 1:1 [contig 236] PARTIAL
          Length = 288

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 34  IYNVTEFLDEHPGGAEYILKYAGRDITEVLKDRDVHEHSESAYEIL 79
           +++V+ ++ EHPGG   I     +D T+   +  V+ HS +A+ +L
Sbjct: 212 VHDVSNYITEHPGGETLIKAALNKDATKAF-NGGVYLHSNAAHNVL 256

>Ecym_2214 Chr2 (422005..423600) [1596 bp, 531 aa] {ON} similar to
          Ashbya gossypii AFL079W
          Length = 531

 Score = 30.4 bits (67), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 20/34 (58%)

Query: 27 VSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDIT 60
          + +Y+  + NV +++  HPGG + I    GRD T
Sbjct: 20 IVIYRNLVLNVDKWIKYHPGGDKAIFHMIGRDAT 53

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.141    0.452 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,537,276
Number of extensions: 1983058
Number of successful extensions: 5006
Number of sequences better than 10.0: 138
Number of HSP's gapped: 5097
Number of HSP's successfully gapped: 138
Length of query: 384
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 273
Effective length of database: 40,753,473
Effective search space: 11125698129
Effective search space used: 11125698129
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 67 (30.4 bits)