Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0G06710gna 1ON58458430150.0
TDEL0B02240na 1ON58458423890.0
TBLA0B05020singletonON5201941252e-06
ZYRO0E00418gsingletonON5002231223e-06
KLLA0F04125gsingletonON4991701181e-05
KLLA0F04257gsingletonON5011651181e-05
TDEL0H00220singletonON4844041101e-04
KLLA0D09779g5.220ON628353980.003
Kwal_33.15600na 2ON489146960.005
KLTH0B00836gna 2ON490146860.086
NCAS0E024407.420ON49556741.9
NDAI0I006406.294ON262106705.6
ZYRO0A10538g5.252ON60894698.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0G06710g
         (584 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0G06710g Chr7 complement(537970..539724) [1755 bp, 584 aa] {...  1165   0.0  
TDEL0B02240 Chr2 complement(405511..407265) [1755 bp, 584 aa] {O...   924   0.0  
TBLA0B05020 Chr2 (1182196..1183758) [1563 bp, 520 aa] {ON}             53   2e-06
ZYRO0E00418g Chr5 (25673..27175) [1503 bp, 500 aa] {ON} conserve...    52   3e-06
KLLA0F04125g Chr6 (392229..393728) [1500 bp, 499 aa] {ON} conser...    50   1e-05
KLLA0F04257g Chr6 complement(404952..406457) [1506 bp, 501 aa] {...    50   1e-05
TDEL0H00220 Chr8 complement(27687..29141) [1455 bp, 484 aa] {ON}       47   1e-04
KLLA0D09779g Chr4 complement(824518..826404) [1887 bp, 628 aa] {...    42   0.003
Kwal_33.15600 s33 complement(1179716..1181185) [1470 bp, 489 aa]...    42   0.005
KLTH0B00836g Chr2 (73357..74829) [1473 bp, 490 aa] {ON} conserve...    38   0.086
NCAS0E02440 Chr5 (477113..478600) [1488 bp, 495 aa] {ON} Anc_7.420     33   1.9  
NDAI0I00640 Chr9 complement(140217..141005) [789 bp, 262 aa] {ON...    32   5.6  
ZYRO0A10538g Chr1 (852296..854122) [1827 bp, 608 aa] {ON} simila...    31   8.2  

>ZYRO0G06710g Chr7 complement(537970..539724) [1755 bp, 584 aa] {ON}
           conserved hypothetical protein
          Length = 584

 Score = 1165 bits (3015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 567/584 (97%), Positives = 567/584 (97%)

Query: 1   MSKLVPIASHSLSPDTSGPYEEGEKGNAYQKTSDNEKGEYVDVSGREIISDEHRKQPRQL 60
           MSKLVPIASHSLSPDTSGPYEEGEKGNAYQKTSDNEKGEYVDVSGREIISDEHRKQPRQL
Sbjct: 1   MSKLVPIASHSLSPDTSGPYEEGEKGNAYQKTSDNEKGEYVDVSGREIISDEHRKQPRQL 60

Query: 61  PLQAYSHYADIQREYERSKDYDGLYAVQREQMYTDANSNLSPTKLDSQRMMRIAKAYSVF 120
           PLQAYSHYADIQREYERSKDYDGLYAVQREQMYTDANSNLSPTKLDSQRMMRIAKAYSVF
Sbjct: 61  PLQAYSHYADIQREYERSKDYDGLYAVQREQMYTDANSNLSPTKLDSQRMMRIAKAYSVF 120

Query: 121 FLITTDILGPSNAPNAISQMGYVPGVILYVVFGIAAACGGWLLNHCFCKVDSNNYPIRTF 180
           FLITTDILGPSNAPNAISQMGYVPGVILYVVFGIAAACGGWLLNHCFCKVDSNNYPIRTF
Sbjct: 121 FLITTDILGPSNAPNAISQMGYVPGVILYVVFGIAAACGGWLLNHCFCKVDSNNYPIRTF 180

Query: 181 SDLASRVVAPWFRYPFGLLQFIQMILNCGLLLLSTAQAVSQMLIVNRGKDNFCFTVDILV 240
           SDLASRVVAPWFRYPFGLLQFIQMILNCGLLLLSTAQAVSQMLIVNRGKDNFCFTVDILV
Sbjct: 181 SDLASRVVAPWFRYPFGLLQFIQMILNCGLLLLSTAQAVSQMLIVNRGKDNFCFTVDILV 240

Query: 241 WALLCMIAGQISSLGKFAHIANSAVWMNIAICICTMVGVAVGGPYYGIFQQYGKGXXXXX 300
           WALLCMIAGQISSLGKFAHIANSAVWMNIAICICTMVGVAVGGPYYGIFQQYGKG     
Sbjct: 241 WALLCMIAGQISSLGKFAHIANSAVWMNIAICICTMVGVAVGGPYYGIFQQYGKGPPYYY 300

Query: 301 XDTFNPLPIVKHAIAPGSLGDRIAGMNNMVFAWGGATIFCEVMAEMKRPMDFWKGMLCAQ 360
            DTFNPLPIVKHAIAPGSLGDRIAGMNNMVFAWGGATIFCEVMAEMKRPMDFWKGMLCAQ
Sbjct: 301 PDTFNPLPIVKHAIAPGSLGDRIAGMNNMVFAWGGATIFCEVMAEMKRPMDFWKGMLCAQ 360

Query: 361 SLILVVYLFYGLFVYTYNGQFCYVTANQAIASVGLQNAGNVLTIVSGLIAMVLYGNVAIK 420
           SLILVVYLFYGLFVYTYNGQFCYVTANQAIASVGLQNAGNVLTIVSGLIAMVLYGNVAIK
Sbjct: 361 SLILVVYLFYGLFVYTYNGQFCYVTANQAIASVGLQNAGNVLTIVSGLIAMVLYGNVAIK 420

Query: 421 VIYQGFLVADLGFPHLTTRKGTIAWGLFVIAYWAVAYILGTAIPSISALVQIVGAFCILN 480
           VIYQGFLVADLGFPHLTTRKGTIAWGLFVIAYWAVAYILGTAIPSISALVQIVGAFCILN
Sbjct: 421 VIYQGFLVADLGFPHLTTRKGTIAWGLFVIAYWAVAYILGTAIPSISALVQIVGAFCILN 480

Query: 481 FSYTFPFLFGFCLLCRQDASLADKFDLKTLTVEKADSYLRNLSRWKRAIAHGGTRRILIK 540
           FSYTFPFLFGFCLLCRQDASLADKFDLKTLTVEKADSYLRNLSRWKRAIAHGGTRRILIK
Sbjct: 481 FSYTFPFLFGFCLLCRQDASLADKFDLKTLTVEKADSYLRNLSRWKRAIAHGGTRRILIK 540

Query: 541 CXXXXXXXXXXXTCGLCSYSAITGAIQAYQTNTAHAFTCTSPVG 584
           C           TCGLCSYSAITGAIQAYQTNTAHAFTCTSPVG
Sbjct: 541 CSLFLLFLASLATCGLCSYSAITGAIQAYQTNTAHAFTCTSPVG 584

>TDEL0B02240 Chr2 complement(405511..407265) [1755 bp, 584 aa] {ON} 
          Length = 584

 Score =  924 bits (2389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/584 (74%), Positives = 497/584 (85%)

Query: 1   MSKLVPIASHSLSPDTSGPYEEGEKGNAYQKTSDNEKGEYVDVSGREIISDEHRKQPRQL 60
           M+ L+PIAS  LS +T   Y E +K + YQ + + EKGE+VD  GREI+++E  K   +L
Sbjct: 1   MTSLIPIASPGLSANTERAYTEIKKDHIYQDSVEQEKGEFVDEFGREILANESEKFGHKL 60

Query: 61  PLQAYSHYADIQREYERSKDYDGLYAVQREQMYTDANSNLSPTKLDSQRMMRIAKAYSVF 120
           PLQAY++YADIQREYERS D DGLYA QREQ+YTD+ SNLS +KLDSQR++RI KAYSVF
Sbjct: 61  PLQAYTYYADIQREYERSNDQDGLYAAQREQIYTDSFSNLSHSKLDSQRLLRITKAYSVF 120

Query: 121 FLITTDILGPSNAPNAISQMGYVPGVILYVVFGIAAACGGWLLNHCFCKVDSNNYPIRTF 180
           FLITTDILGPSNAP A++QMG+VPGVILYV+FG+ AA GGWLLN+CFCKVDSNNYPIRT+
Sbjct: 121 FLITTDILGPSNAPYAVAQMGWVPGVILYVLFGVVAAFGGWLLNYCFCKVDSNNYPIRTY 180

Query: 181 SDLASRVVAPWFRYPFGLLQFIQMILNCGLLLLSTAQAVSQMLIVNRGKDNFCFTVDILV 240
           SDLA RVVAPWFRYPF +LQFIQMILNCG +LLSTAQAVSQMLIVN+G+D FCFTVDILV
Sbjct: 181 SDLAGRVVAPWFRYPFAILQFIQMILNCGAILLSTAQAVSQMLIVNKGRDPFCFTVDILV 240

Query: 241 WALLCMIAGQISSLGKFAHIANSAVWMNIAICICTMVGVAVGGPYYGIFQQYGKGXXXXX 300
           WALLCMI GQI SLG+FAHIAN+AVWMNIA+CI TMVGVAVGGPYYGIFQQYG+G     
Sbjct: 241 WALLCMILGQIRSLGRFAHIANTAVWMNIAVCIITMVGVAVGGPYYGIFQQYGQGPPYFQ 300

Query: 301 XDTFNPLPIVKHAIAPGSLGDRIAGMNNMVFAWGGATIFCEVMAEMKRPMDFWKGMLCAQ 360
             TFNPLPI +HAI PG++ D+IAGMNNMVFAWGGATIFCEVMAEMKRPMDFWKGMLCAQ
Sbjct: 301 SGTFNPLPITQHAITPGTISDKIAGMNNMVFAWGGATIFCEVMAEMKRPMDFWKGMLCAQ 360

Query: 361 SLILVVYLFYGLFVYTYNGQFCYVTANQAIASVGLQNAGNVLTIVSGLIAMVLYGNVAIK 420
           SLI+VVYLFYGLFVY YNGQF YV ANQAI S GLQNAGNVLTI++G+IA VLYGN+ IK
Sbjct: 361 SLIMVVYLFYGLFVYAYNGQFSYVNANQAIGSKGLQNAGNVLTIITGIIATVLYGNIGIK 420

Query: 421 VIYQGFLVADLGFPHLTTRKGTIAWGLFVIAYWAVAYILGTAIPSISALVQIVGAFCILN 480
           V+YQGFL+ D  FP L++RKG +AWG FVI +WA+AYILGTAIPS+SA+V I+G+FCILN
Sbjct: 421 VLYQGFLITDFNFPSLSSRKGAVAWGGFVIIFWAIAYILGTAIPSVSAIVGIIGSFCILN 480

Query: 481 FSYTFPFLFGFCLLCRQDASLADKFDLKTLTVEKADSYLRNLSRWKRAIAHGGTRRILIK 540
           FSYTFPFLF FCLLCRQDA+L D FD KTL+VEKADSY RN SRWKR+I HGGT R+ +K
Sbjct: 481 FSYTFPFLFCFCLLCRQDAALNDTFDQKTLSVEKADSYWRNWSRWKRSIGHGGTFRVTLK 540

Query: 541 CXXXXXXXXXXXTCGLCSYSAITGAIQAYQTNTAHAFTCTSPVG 584
                       TCGLCSYSAITGAI+ YQTNTA  FTC SPVG
Sbjct: 541 VSLLLLFLASLATCGLCSYSAITGAIEVYQTNTAQPFTCNSPVG 584

>TBLA0B05020 Chr2 (1182196..1183758) [1563 bp, 520 aa] {ON} 
          Length = 520

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 87/194 (44%), Gaps = 17/194 (8%)

Query: 304 FNPLPIVKHAIAP---GSLGDRIAGMNNMVFAWGGATIFCEVMAEMKRPMDFWKGMLCAQ 360
           +N  P VK+ + P    +  D +    N+V+++ G   + + ++EM+ P +F K +    
Sbjct: 258 YNGTP-VKYTLFPEKGTTYVDAMCACLNIVYSFVGQITYPQFISEMRNPKEFRKVLWLVT 316

Query: 361 SLILVVYLFYGLFVYTYNGQFCYVTANQAIASVGLQNAGNVLTIVSGLIAMV----LYGN 416
           +  ++V+   G  +Y Y G   Y+TA    A   L+    ++     +  MV    LY N
Sbjct: 317 ACEVIVFSLAGSIIYVYVGN-QYMTAP---AFGSLERTYKIIAFTFAVPTMVFAGALYSN 372

Query: 417 VAIK-VIYQGFLVADLGFPHLTTRKGTIAWGLFVIAYWAVAYILGTAIPSISALVQIVGA 475
           V+ K V +  F   +       T    I W L V+  W +A+I+   IP  S LV ++ A
Sbjct: 373 VSAKLVFFTIFQNKNEKMLQFKTASSWIYWSLLVLLTWILAFIIAEVIPFFSDLVSLLSA 432

Query: 476 FCILNFSYTFPFLF 489
                F   F F+F
Sbjct: 433 L----FDCWFGFIF 442

>ZYRO0E00418g Chr5 (25673..27175) [1503 bp, 500 aa] {ON} conserved
           hypothetical protein
          Length = 500

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/223 (22%), Positives = 101/223 (45%), Gaps = 15/223 (6%)

Query: 304 FNPLPIVKHAIAPGSLGDRIAGMN---NMVFAWGGATIFCEVMAEMKRPMDFWKGMLCAQ 360
           ++  P+V  A  P      ++GM    N+++ + G   + + +AEMK P DF K +    
Sbjct: 242 YDGTPVVYKAF-PVKGTTYVSGMGAFLNIIYTFVGQVTYPQFIAEMKNPKDFKKVLWVVC 300

Query: 361 SLILVVYLFYGLFVYTYNGQFCYVTANQAIASVGLQNAGNVLT----IVSGLIAMVLYGN 416
              +V+Y   G  VY Y G+        A A   L  A  +++    + + + A  LY N
Sbjct: 301 ISQIVLYGLVGSIVYVYVGE----KYMSAPAYGSLIRAFKIISFSFCVPTIVYAGALYAN 356

Query: 417 VAIKVIYQGFLVADLGFPHLTTRKGTIAWGLFVIAYWAVAYILGTAIPSISALVQIVGAF 476
           V+ K ++  F     G+ +  + K  + W + ++  WAVA+++   IP  S L+ ++ + 
Sbjct: 357 VSAKFLFFTFFENKPGYVYSYSLKSWLVWFVILVVLWAVAFVIAEVIPFFSDLLSLMSSL 416

Query: 477 CILNFSYTFPFLFGFCLLCRQDASLADKFDLKTLTVEKADSYL 519
               F + F   +G   +  +     + F  + LT ++  +++
Sbjct: 417 FDCWFGFVF---WGLAYIRLRKHEYGEAFSFRNLTFKQKINFI 456

>KLLA0F04125g Chr6 (392229..393728) [1500 bp, 499 aa] {ON} conserved
           hypothetical protein
          Length = 499

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 81/170 (47%), Gaps = 11/170 (6%)

Query: 321 DRIAGMNNMVFAWGGATIFCEVMAEMKRPMDFWKGMLCAQSLILVVYLFYGLFVYTYNGQ 380
           D +    N+V+ + G   + + ++EMKRP +F K +    +L L+++   G  +Y Y G 
Sbjct: 261 DAMGAFLNIVYTFVGQITYPQFISEMKRPREFKKVLWIVTALELIIFSLAGALIYVYVGN 320

Query: 381 FCYVTANQAIASVGLQNAGNVLTIVSGLIAMV----LYGNVAIK-VIYQGFLVADLGFPH 435
             Y+TA    A   L     +++    +  +V    LY N++ + V +  F  ++  + H
Sbjct: 321 -EYMTAP---AYGSLTKTYKIISFSFAIPTIVFVGSLYSNISSRFVFFNVFRNSEHLYSH 376

Query: 436 LTTRKGTIAWGLFVIAYWAVAYILGTAIPSISALVQIVGAFCILNFSYTF 485
             T+ G +AW   ++  W  A+++   IP  S L+ ++ +     F Y F
Sbjct: 377 --TKVGWLAWIGLLLLTWVGAFVIAEVIPFFSDLLSLMCSLFDCWFGYVF 424

>KLLA0F04257g Chr6 complement(404952..406457) [1506 bp, 501 aa] {ON}
           conserved hypothetical protein
          Length = 501

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 71/165 (43%), Gaps = 1/165 (0%)

Query: 321 DRIAGMNNMVFAWGGATIFCEVMAEMKRPMDFWKGMLCAQSLILVVYLFYGLFVYTYNGQ 380
           D +    N+V+ +     + + ++EMKRP DF K  L   ++ +V+Y   G  +Y Y G 
Sbjct: 263 DAMGAFLNIVYVFAAQVTYPQFISEMKRPRDFKKVFLLVTAIEVVIYSITGAVMYYYIGN 322

Query: 381 FCYVTANQAIASVGLQNAGNVLTIVSGLIAMVLYGNVAIKVIYQGFLVADLGFPHLTTRK 440
               T      +   +       + + +    LY N+  + I+   +  +    H  T  
Sbjct: 323 EYMTTPAYGSLTRKYKIIAYSFAVPTIIFVGSLYSNITTRFIFFK-VFKNSEHMHSHTTI 381

Query: 441 GTIAWGLFVIAYWAVAYILGTAIPSISALVQIVGAFCILNFSYTF 485
           G ++W   ++  W VA+I+   IP  S L+ ++ +     F + F
Sbjct: 382 GWLSWIGIIVLTWIVAFIVAEVIPFFSDLLSLMCSLFACWFGFVF 426

>TDEL0H00220 Chr8 complement(27687..29141) [1455 bp, 484 aa] {ON} 
          Length = 484

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 85/404 (21%), Positives = 160/404 (39%), Gaps = 42/404 (10%)

Query: 73  REYERSKDYDGLYAVQREQMYTDANSNLSPTKLDSQRMMRIAKAYSV-----FFLITTDI 127
            E E  +D + +  V +  +  DA +  S    D +   +  +  S        L    +
Sbjct: 18  EEGEEFRDPENVSLVDKNGL-ADATTVTSSCNADEEEFNQNFRTCSWQHTAGLMLSEYIV 76

Query: 128 LGPSNAPNAISQMGYVPGVILYVVFGIAAACGGWLLNHCFCKVDSNNYP-IRTFSDLASR 186
           L   + P + S +G VPG+IL V   +     G ++   FC+     +P +R   D+   
Sbjct: 77  LAIMSFPWSYSVLGLVPGLILTVFVAVTVLYTGLIITD-FCE----RFPHLRNVCDIGQY 131

Query: 187 VVA--PWFRYPFGLLQFIQMILNCGLLLLSTAQAVSQMLIVNRGKDNFCFTVDILVWALL 244
           ++    W  Y           L  GL +L  A+ ++   + N    +  FT  +   +++
Sbjct: 132 LLGGGRWAWYATAFCFLANNTLIQGLHVLVGAKYLNT--VTNHSICSVGFTAIVAGISMI 189

Query: 245 CMIAGQISSLGKFAHIANSAVWMNIAICICTMVGVAVGGPYYGIFQQYGKGXXXXXXDTF 304
             +    S++    +   SA  M IA+ +  +     G P                 D F
Sbjct: 190 FSLPRTFSAMSWVGYF--SAATMFIAVVLAMVFAGVQGHP-----------------DKF 230

Query: 305 NPLPIVKHAI-APG-SLGDRIAGMNNMVFAWGGATIFCEVMAEMKRPMDFWKGMLCAQSL 362
           +  P+V  A  A G S  D ++   N+V+ + G   + + ++EMK P +F K +    + 
Sbjct: 231 DGTPVVFRAFPAEGTSFVDGMSAFLNIVYTFVGQITYPQFISEMKNPREFKKVLWIVTTC 290

Query: 363 ILVVYLFYGLFVYTYNGQFCYVTANQAIASV--GLQNAGNVLTIVSGLIAMVLYGNVAIK 420
            ++++   G  +Y Y G   Y+T   A  S+    +       I + +    LY N++ K
Sbjct: 291 EVIIFALAGSIMYVYVGN-AYMTG-PAFGSLIRKYKIISFSFAIPTIIFVGALYANISAK 348

Query: 421 VIYQGFLVADLGFPHLTTRKGTIAWGLFVIAYWAVAYILGTAIP 464
           ++Y   +  +    +  T    I W L +   W +A+I+   IP
Sbjct: 349 LVYDQ-IFKNTRHRYSWTSTSWIFWTLVLFMTWVMAFIIAEVIP 391

>KLLA0D09779g Chr4 complement(824518..826404) [1887 bp, 628 aa] {ON}
           similar to uniprot|P47082 Saccharomyces cerevisiae
           YJR001W AVT1 Vacuolar transporter imports large neutral
           amino acids into the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 628

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 77/353 (21%), Positives = 136/353 (38%), Gaps = 66/353 (18%)

Query: 43  VSGREIISDEHRKQPRQLPLQAYSHYADIQREYERSKDYDGLYAV----------QREQM 92
           VS +  I+D +    R+  +QA + Y + +   + S   DGL +V            E  
Sbjct: 143 VSIKPSIADLYGAMSRRSSIQAGTPYGNFENPIDES---DGLQSVFSHDSMGPHHLTEYS 199

Query: 93  YTDANSNLSPTKLDSQRMMRI-AKAYSVFFLITTDILGPSNAPNAISQM----------- 140
           + D+ + + P + D+  + ++  KA  V  +I      P    N+I+ +           
Sbjct: 200 FDDSGNAVGP-EADAIILKQVETKAGKVITVIAGQSTAPQTIFNSINVLIGIGLLALPLG 258

Query: 141 ----GYVPGVILYVVFGIAAACGGWLLNHCFCKVDSNNYPIRTFSDLASRVVAPWFRYPF 196
               G+V GV +  +F  A  C   L++ C     S    I T+ DLA     P  R   
Sbjct: 259 LRYAGWVLGVPILFIFAFATFCSAQLISRCLDADPS----ISTYGDLAYAAFGPKGRALI 314

Query: 197 GLLQFIQMILNCGLLLL----STAQAVSQMLIVNRGKDNFCFTVDILVWALLCMIAGQIS 252
             L F   +L CG+ L+     +  A+     VN  K    F V   ++  L +++  IS
Sbjct: 315 SFL-FAMDLLACGVALIILFGDSLNALFPEYSVNFFKFVAFFAVTPPIFLPLSVLS-NIS 372

Query: 253 SLGKFAHIANSAVWMNIAICICTMVGVAVGGPYYGIFQQYGKGXXXXXXDTFNPLPIVKH 312
            LG                 I + +G A+   + G+ +QY  G       T         
Sbjct: 373 LLG-----------------IISTIGTALLVVFCGLLKQYSPGSLLQPEAT--------- 406

Query: 313 AIAPGSLGDRIAGMNNMVFAWGGATIFCEVMAEMKRPMDFWKGMLCAQSLILV 365
           ++ P S  +    +  +   WGG  +F  + ++M+ P  F + +    S+ +V
Sbjct: 407 SMWPNSFKEFCLSLGLLSACWGGHAVFPNLKSDMRHPEKFTRCLKTTYSITIV 459

>Kwal_33.15600 s33 complement(1179716..1181185) [1470 bp, 489 aa]
           {ON} [contig 290] FULL
          Length = 489

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 64/146 (43%), Gaps = 19/146 (13%)

Query: 328 NMVFAWGGATIFCEVMAEMKRPMDFWKGMLCAQSLILVVYLFYGLFVYTYNGQFCYVTAN 387
           N+V+ + G   + + ++EMKRP +F K +       ++++   G+ +Y Y G       N
Sbjct: 258 NIVYTFVGQITYPQFISEMKRPREFRKVLYIVTLCQVIIFTLAGVIIYVYVG-------N 310

Query: 388 QAIASVGLQNAGNVLTIVSGLIAM-------VLYGNVAIKVIYQGFLVADLGFPHL--TT 438
           + + +    + G    I+S   A+        LY NV+ ++++  F        HL   T
Sbjct: 311 EYMTAPAFGSLGRTFKIISFTFAVPTIIFAGSLYSNVSGRLLFFTFFKRS---KHLYSHT 367

Query: 439 RKGTIAWGLFVIAYWAVAYILGTAIP 464
             G + W   +   W  A+I+   +P
Sbjct: 368 TIGWLTWTGILFLTWVGAFIIAEVVP 393

>KLTH0B00836g Chr2 (73357..74829) [1473 bp, 490 aa] {ON} conserved
           hypothetical protein
          Length = 490

 Score = 37.7 bits (86), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 65/146 (44%), Gaps = 19/146 (13%)

Query: 328 NMVFAWGGATIFCEVMAEMKRPMDFWKGMLCAQSLILVVYLFYGLFVYTYNGQFCYVTAN 387
           N+V+ + G   + + ++EM+RP +F K +    +  +V++   G+ +Y Y G       N
Sbjct: 259 NIVYTFVGQITYPQFISEMQRPAEFRKVLYIVTTCEIVIFTLAGVIIYVYVG-------N 311

Query: 388 QAIASVGLQNAGNVLTIVSG-------LIAMVLYGNVAIKVIYQGFLVADLGFPHL--TT 438
           + +++    +      I++        + A  LY NV+ ++++  F        HL   T
Sbjct: 312 EYMSAPAFGSLTRTFKIIAFSFAVPTIIFAGSLYSNVSGRLLFFTFFKRS---KHLYSHT 368

Query: 439 RKGTIAWGLFVIAYWAVAYILGTAIP 464
             G + W   +   W  A+I+   +P
Sbjct: 369 TVGWLTWIGILALTWVGAFIIAEVVP 394

>NCAS0E02440 Chr5 (477113..478600) [1488 bp, 495 aa] {ON} Anc_7.420
          Length = 495

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 31/56 (55%)

Query: 454 AVAYILGTAIPSISALVQIVGAFCILNFSYTFPFLFGFCLLCRQDASLADKFDLKT 509
           A AY +  ++ S++ ++ IVGA    + S+  P LFGF L+  +     ++  LKT
Sbjct: 408 ACAYTVAISVTSLAHVLAIVGATGSTSISFILPGLFGFTLIGSEYTEADEEIPLKT 463

>NDAI0I00640 Chr9 complement(140217..141005) [789 bp, 262 aa] {ON}
           Anc_6.294 YMR200W
          Length = 262

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 23/106 (21%), Positives = 41/106 (38%), Gaps = 14/106 (13%)

Query: 41  VDVSGREIISDEHRKQPRQLPLQAYSHYADIQREYERSKDYDGLYAVQREQMYTDANSNL 100
           ++V GR++ SD          +  Y+ Y   +  +  S   D  + V   Q+Y       
Sbjct: 113 IEVDGRQLFSDPCNDDG----ISTYTRYNQTETFHSFSVQIDSYHGVWSLQLY------- 161

Query: 101 SPTKLDSQRMMRIAKAYSVFFLITTDILGPSNAPNAISQMGYVPGV 146
              + D   M  +  AY    ++ T+ L P++  N +   G V G 
Sbjct: 162 ---QFDQSPMQPLYLAYKPPMMLPTETLNPTDTSNTVENTGTVDGA 204

>ZYRO0A10538g Chr1 (852296..854122) [1827 bp, 608 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146W AVT3
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 608

 Score = 31.2 bits (69), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 38/94 (40%), Gaps = 13/94 (13%)

Query: 309 IVKHAIAPGSL-----GDRIAGMNNMVFAWGGATIFCEVMAEMKRPMDFWKGMLCAQSLI 363
           I KH IA  S+      D    +   +F + G  +   +   MK+P  F+  +    S++
Sbjct: 382 IAKHGIATDSVLFFNRSDWSLFIGTAIFTFEGIGLLIPIQESMKKPEHFYPSLGFVMSIV 441

Query: 364 LVVYLFYGLFVYTYNGQFCYVTANQAIASVGLQN 397
                    F++  +G  CY+     + +V L N
Sbjct: 442 T--------FIFVSSGLLCYLAFGAKVETVVLLN 467

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.139    0.435 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,627,750
Number of extensions: 2298883
Number of successful extensions: 7157
Number of sequences better than 10.0: 44
Number of HSP's gapped: 7371
Number of HSP's successfully gapped: 44
Length of query: 584
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 469
Effective length of database: 40,294,809
Effective search space: 18898265421
Effective search space used: 18898265421
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)