Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0G06688g5.698ON61361332110.0
TDEL0B022305.698ON57456920990.0
Suva_11.3295.698ON60157120790.0
KNAG0C065705.698ON59056720690.0
TBLA0A091205.698ON63355320500.0
YKR093W (PTR2)5.698ON60155720270.0
Kpol_529.285.698ON61053720240.0
Smik_11.3565.698ON60255720200.0
NDAI0E050205.698ON61956420160.0
CAGL0G02453g5.698ON59754020090.0
NCAS0A032205.698ON61160920060.0
KAFR0H00230singletonON59658019970.0
SAKL0E14828g5.698ON59255719930.0
TPHA0O02000singletonON62056319730.0
TPHA0N01960singletonON59152619620.0
TBLA0E01140singletonON61152619430.0
KLLA0E12915g5.698ON65457619410.0
TBLA0B04710singletonON61558619310.0
KAFR0H002405.698ON59157719190.0
Skud_11.3315.698ON39937114650.0
Kwal_47.16930na 1ON6115776813e-80
KLTH0D16544gna 1ON6265766273e-72
Ecym_2823na 2ON6136106044e-69
AGL365Cna 2ON5995456026e-69
AFR228WsingletonON5765804894e-53
ADL156Cna 3ON483171771.0
TBLA0F01600singletonON567110761.3
ZYRO0G18700g1.173ON591188742.4
KAFR0A082603.73ON94562742.8
Suva_2.730na 4ON562127723.6
NDAI0F01930singletonON56467724.5
TDEL0F013502.181ON140112685.4
Skud_4.809na 4ON568128707.6
ADL155C3.53ON486170699.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0G06688g
         (613 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {...  1241   0.0  
TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {O...   813   0.0  
Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093...   805   0.0  
KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON} Anc_5...   801   0.0  
TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa] ...   794   0.0  
YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integ...   785   0.0  
Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}...   784   0.0  
Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093...   782   0.0  
NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON} Anc_5...   781   0.0  
CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly...   778   0.0  
NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {O...   777   0.0  
KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON}      773   0.0  
SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} simi...   772   0.0  
TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {...   764   0.0  
TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {...   760   0.0  
TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {O...   753   0.0  
KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa]...   752   0.0  
TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON}            748   0.0  
KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}...   743   0.0  
Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093...   568   0.0  
Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093...   266   3e-80
KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa]...   246   3e-72
Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar...   237   4e-69
AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON} NOH...   236   6e-69
AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-synteni...   192   4e-53
ADL156C Chr4 complement(416054..417505) [1452 bp, 483 aa] {ON} S...    34   1.0  
TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {O...    34   1.3  
ZYRO0G18700g Chr7 (1542876..1544651) [1776 bp, 591 aa] {ON} simi...    33   2.4  
KAFR0A08260 Chr1 complement(1656030..1658867) [2838 bp, 945 aa] ...    33   2.8  
Suva_2.730 Chr2 (1271371..1273059) [1689 bp, 562 aa] {ON} YDR536...    32   3.6  
NDAI0F01930 Chr6 (467932..469626) [1695 bp, 564 aa] {ON}               32   4.5  
TDEL0F01350 Chr6 (241090..241512) [423 bp, 140 aa] {ON} Anc_2.18...    31   5.4  
Skud_4.809 Chr4 (1427842..1429548) [1707 bp, 568 aa] {ON} YDR536...    32   7.6  
ADL155C Chr4 complement(418382..419842) [1461 bp, 486 aa] {ON} S...    31   9.3  

>ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {ON}
           similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 613

 Score = 1241 bits (3211), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 601/613 (98%), Positives = 601/613 (98%)

Query: 1   MNSASPSITGPEKNKVIIEDKSLEVSGSHERGELDFDEYEVPNDDEPTEEELRSLRHVGG 60
           MNSASPSITGPEKNKVIIEDKSLEVSGSHERGELDFDEYEVPNDDEPTEEELRSLRHVGG
Sbjct: 1   MNSASPSITGPEKNKVIIEDKSLEVSGSHERGELDFDEYEVPNDDEPTEEELRSLRHVGG 60

Query: 61  HIPFRCWLIAIVELSERFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATGLAYFFQFW 120
           HIPFRCWLIAIVELSERFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATGLAYFFQFW
Sbjct: 61  HIPFRCWLIAIVELSERFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATGLAYFFQFW 120

Query: 121 CYVTPVFGGWLADTYWGKYETICVGTGVYVVGIFILFITSLPSVDSKNTALGGFITAIVL 180
           CYVTPVFGGWLADTYWGKYETICVGTGVYVVGIFILFITSLPSVDSKNTALGGFITAIVL
Sbjct: 121 CYVTPVFGGWLADTYWGKYETICVGTGVYVVGIFILFITSLPSVDSKNTALGGFITAIVL 180

Query: 181 IGIATGMIKANLSVLIADQFXXXXXXXXXXXXGERVIEDPNITIQNVFMFFYLMINIGSL 240
           IGIATGMIKANLSVLIADQF            GERVIEDPNITIQNVFMFFYLMINIGSL
Sbjct: 181 IGIATGMIKANLSVLIADQFPKRKPRIKTTKRGERVIEDPNITIQNVFMFFYLMINIGSL 240

Query: 241 SVIATTELEEHKGFWAAYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAKSFRVLGQLI 300
           SVIATTELEEHKGFWAAYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAKSFRVLGQLI
Sbjct: 241 SVIATTELEEHKGFWAAYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAKSFRVLGQLI 300

Query: 301 KHRFDYEAVKPSVHPERDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQMTSTFVSVG 360
           KHRFDYEAVKPSVHPERDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQMTSTFVSVG
Sbjct: 301 KHRFDYEAVKPSVHPERDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQMTSTFVSVG 360

Query: 361 GEMQLHGLPNDFFQAIDSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFGFMWCSASMI 420
           GEMQLHGLPNDFFQAIDSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFGFMWCSASMI
Sbjct: 361 GEMQLHGLPNDFFQAIDSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFGFMWCSASMI 420

Query: 421 WAAVLQHFIYKTGPCYDHPMDCPNGPNNIHIGWQVPAYVLIAFSEIFASITGLEYAYSKA 480
           WAAVLQHFIYKTGPCYDHPMDCPNGPNNIHIGWQVPAYVLIAFSEIFASITGLEYAYSKA
Sbjct: 421 WAAVLQHFIYKTGPCYDHPMDCPNGPNNIHIGWQVPAYVLIAFSEIFASITGLEYAYSKA 480

Query: 481 PTSMKSFIMSIFLLTNAFGSAIGCALSPVDTDPKYLWMFTGLAVASFISGCLFWLTFHHL 540
           PTSMKSFIMSIFLLTNAFGSAIGCALSPVDTDPKYLWMFTGLAVASFISGCLFWLTFHHL
Sbjct: 481 PTSMKSFIMSIFLLTNAFGSAIGCALSPVDTDPKYLWMFTGLAVASFISGCLFWLTFHHL 540

Query: 541 NDTEEEMNAMDYEENQEKIDDGLQKGTSDLEFEPAGADDKLDHIGSHGATGFRHDGELGE 600
           NDTEEEMNAMDYEENQEKIDDGLQKGTSDLEFEPAGADDKLDHIGSHGATGFRHDGELGE
Sbjct: 541 NDTEEEMNAMDYEENQEKIDDGLQKGTSDLEFEPAGADDKLDHIGSHGATGFRHDGELGE 600

Query: 601 EGELSPYMSPKSL 613
           EGELSPYMSPKSL
Sbjct: 601 EGELSPYMSPKSL 613

>TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {ON}
           Anc_5.698 YKR093W
          Length = 574

 Score =  813 bits (2099), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/569 (69%), Positives = 471/569 (82%), Gaps = 12/569 (2%)

Query: 2   NSASPSITGPEKNKVI--IEDKSLEVSGSHERGELDFDEYEVPNDDEPTEEELRSLRHVG 59
            S++  +   EK K +  ++DK +EV  SH   E++        DDEPTEEE+++L+HV 
Sbjct: 6   TSSTDGVDSVEKQKAVEVVDDKLVEVISSHNGLEVE------SYDDEPTEEEMKTLKHVA 59

Query: 60  GHIPFRCWLIAIVELSERFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATGLAYFFQF 119
           G IPFRCWLIA+VELSERF+YYGLS PFQNYMQNG  D PAG+L+LKSQGATGL+YFFQF
Sbjct: 60  GTIPFRCWLIAVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNLKSQGATGLSYFFQF 119

Query: 120 WCYVTPVFGGWLADTYWGKYETICVGTGVYVVGIFILFITSLPSVDSKNTALGGFITAIV 179
           WCYVTP+FGGWL+DTY GKY TIC GTGVYV+GI ILF+TS+PS+ ++N A GGFI AI+
Sbjct: 120 WCYVTPIFGGWLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQNAATGGFIAAII 179

Query: 180 LIGIATGMIKANLSVLIADQFXXXXXXXXXXXXGERVIEDPNITIQNVFMFFYLMINIGS 239
           LIGIATGMIK+N+SVLIADQF            G RVIEDPNIT+QNVFM FYLMINIGS
Sbjct: 180 LIGIATGMIKSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNVFMIFYLMINIGS 239

Query: 240 LSVIATTELEEHKGFWAAYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAKSFRVLGQL 299
           LSVIATTELE H GFWAAYLLPFCFFWIAVIVL VG+ SYV+PPVGDKVI+K F+V+G  
Sbjct: 240 LSVIATTELEAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDKVISKCFKVVGIA 299

Query: 300 IKHRFDYEAVKPSVHPERDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQMTSTFVSV 359
           IK++F++EA KPSV P+R +PW D FV+EI R+L ACKVF+FYP+YWV YGQM +TFVSV
Sbjct: 300 IKNKFNFEAAKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWVCYGQMLNTFVSV 359

Query: 360 GGEMQLHGLPNDFFQAIDSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFGFMWCSASM 419
           GG M+LHGLPNDFFQAIDSIALIVFIPICEY+LYP+IR++TPF+PITKIF+GFM+ +A+M
Sbjct: 360 GGTMELHGLPNDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITKIFWGFMFGAAAM 419

Query: 420 IWAAVLQHFIYKTGPCYDHPMDCPNGPNNIHIGWQVPAYVLIAFSEIFASITGLEYAYSK 479
           +WAAVLQHFIYK+GP Y +PM   N PN+IHI WQVPAYVLIAFSEIFASITGLEYAYSK
Sbjct: 420 VWAAVLQHFIYKSGPWYKYPM-AENTPNHIHIAWQVPAYVLIAFSEIFASITGLEYAYSK 478

Query: 480 APTSMKSFIMSIFLLTNAFGSAIGCALSPVDTDPKYLWMFTGLAVASFISGCLFWLTFHH 539
           AP +MKSFIM+IFLLTNAFGSAIGCALSPV  DP Y+W++ GL VA F +G LFW  F H
Sbjct: 479 APVTMKSFIMAIFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVACFAAGWLFWFCFKH 538

Query: 540 LNDTEEEMNAMDYEENQEKI---DDGLQK 565
            NDTEE MNA+DY+E+   +    DG+++
Sbjct: 539 YNDTEEAMNALDYDEDPTMLKHSKDGIEE 567

>Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093W
           (REAL)
          Length = 601

 Score =  805 bits (2079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/571 (68%), Positives = 455/571 (79%), Gaps = 7/571 (1%)

Query: 12  EKNKVIIEDKSLEVSGSHERGELDFDEYEVPNDDE---PTEEELRSLRHVGGHIPFRCWL 68
           EKN+ +    S  VS         F+    P D+E   PT+EELRSLRHVGG IP RCWL
Sbjct: 26  EKNQTVTLKDSY-VSDDAANSTERFNLSPSPEDNEFEAPTDEELRSLRHVGGKIPMRCWL 84

Query: 69  IAIVELSERFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATGLAYFFQFWCYVTPVFG 128
           IAIVELSERFSYYGLSAPFQNYM+ G +D P G+L L S GATGL+YFFQFWCYVTPVFG
Sbjct: 85  IAIVELSERFSYYGLSAPFQNYMEYGPNDTPKGMLSLNSSGATGLSYFFQFWCYVTPVFG 144

Query: 129 GWLADTYWGKYETICVGTGVYVVGIFILFITSLPSVDSKNTALGGFITAIVLIGIATGMI 188
           G++ADT+WGKY TIC GT +Y+ GIFILFITS+PSV ++++ALGGFI +I+LIGIATGMI
Sbjct: 145 GYIADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSALGGFIASIILIGIATGMI 204

Query: 189 KANLSVLIADQFXXXXXXXXXXXXGERVIEDPNITIQNVFMFFYLMINIGSLSVIATTEL 248
           KANLSVLIADQ             GERVIED NIT+QNVFMFFY MIN+GSLS++ATTEL
Sbjct: 205 KANLSVLIADQLPKRKPFIKVLKSGERVIEDGNITLQNVFMFFYFMINVGSLSLMATTEL 264

Query: 249 EEHKGFWAAYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAKSFRVLGQLIKHRFDYEA 308
           E HKGFWAAYLLPFCFFW+AV+ L  G+K Y++ P+GDKVIAKSF+V   L K++FD+ A
Sbjct: 265 EYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRPIGDKVIAKSFKVCWILTKNKFDFNA 324

Query: 309 VKPSVHPERDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQMTSTFVSVGGEMQLHGL 368
            KPSVHPE+DYPWND FV+EIKRAL ACKVF+FYPIYW  YG M S+F++    M+LHG+
Sbjct: 325 AKPSVHPEKDYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTMISSFITQASMMELHGI 384

Query: 369 PNDFFQAIDSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFGFMWCSASMIWAAVLQHF 428
           PNDF QA DSIALI+FIPI E + YPFIRRYTPFKPITKIFFGFM+ S +M WAAVLQ F
Sbjct: 385 PNDFLQAFDSIALIIFIPIFEKFGYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQSF 444

Query: 429 IYKTGPCYDHPMDCPNGPNNIHIGWQVPAYVLIAFSEIFASITGLEYAYSKAPTSMKSFI 488
           +YK GP Y  P+   N PN++H+ WQ+PAYVLI+FSEIFASITGLEYAYSKAP +MKSFI
Sbjct: 445 VYKAGPWYSEPLG-HNTPNHVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPANMKSFI 503

Query: 489 MSIFLLTNAFGSAIGCALSPVDTDPKYLWMFTGLAVASFISGCLFWLTFHHLNDTEEEMN 548
           MSIFLLTNAFGSAIGCALSPV  DPK+ W+FTGLAVA FISGCLFWL F   NDTEEEMN
Sbjct: 504 MSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYNDTEEEMN 563

Query: 549 AMDYEENQE-KIDDGLQKGTSDLE-FEPAGA 577
           AMDYEE  E  ++   Q   +D+E  EP G+
Sbjct: 564 AMDYEEEDEFDLNPISQPKANDIEILEPMGS 594

>KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON}
           Anc_5.698 YKR093W
          Length = 590

 Score =  801 bits (2069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/567 (68%), Positives = 457/567 (80%), Gaps = 15/567 (2%)

Query: 12  EKNKVIIEDKSLEVSGSHERGELDFDE-YEVPNDDEPTEEELRSLRHVGGHIPFRCWLIA 70
           ++N   IE+ S  V     + E D  E YEVP     TEEELR+L+HVGGHIP RCWLIA
Sbjct: 25  KENSHTIEEDSRIVDDLASQYEDDIPEGYEVP-----TEEELRTLKHVGGHIPMRCWLIA 79

Query: 71  IVELSERFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATGLAYFFQFWCYVTPVFGGW 130
           +VELSERFSYYGLSAPFQNYM NG HD P G+L L S GATGL+YFFQFWCYVTP+FGG+
Sbjct: 80  VVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQLNSDGATGLSYFFQFWCYVTPIFGGY 139

Query: 131 LADTYWGKYETICVGTGVYVVGIFILFITSLPSVDSKNTALGGFITAIVLIGIATGMIKA 190
           +ADT+WGKY TI VGTG+Y+ GIFILF+TS+PS+ +KN  LGGFI AI+LIGIATGMIK+
Sbjct: 140 MADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTKNAGLGGFIVAIILIGIATGMIKS 199

Query: 191 NLSVLIADQFXXXXXXXXXXXXGERVIEDPNITIQNVFMFFYLMINIGSLSVIATTELEE 250
           NLSVLIADQ             GERVIED N+T+QNVFMFFYLMINIGSLSVIAT+ELE 
Sbjct: 200 NLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFFYLMINIGSLSVIATSELEL 259

Query: 251 HKGFWAAYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAKSFRVLGQLIKHRFDYEAVK 310
           H+GFWAAYLLPFCFFWIAV+VL +G+  YV+PP+GDKVI+K F+VL  L K+RF+++A K
Sbjct: 260 HRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISKCFKVLWILTKNRFNFDAPK 319

Query: 311 PSVHPERDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQMTSTFVSVGGEMQLHGLPN 370
           PS++P ++YPW+D FV+EI+RAL ACKVF+FYPIYW  YGQM S FV+ G  M+LHGLPN
Sbjct: 320 PSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQMMSGFVTQGSMMELHGLPN 379

Query: 371 DFFQAIDSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFGFMWCSASMIWAAVLQHFIY 430
           DFFQ IDSIA+IVFIP+CE+ LYPFIR+YTPF+PITKI+FGFM+ S  MIWAAVLQ +IY
Sbjct: 380 DFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFGFMFASGCMIWAAVLQSYIY 439

Query: 431 KTGPCYDHPMDCPNGPNNIHIGWQVPAYVLIAFSEIFASITGLEYAYSKAPTSMKSFIMS 490
           K GP Y  P++  +GPN IH+  QVPAYVL+AFSEIFASITGLEYAYSKAP SMKSFIMS
Sbjct: 440 KAGPHYKWPLE-HDGPNRIHVALQVPAYVLLAFSEIFASITGLEYAYSKAPASMKSFIMS 498

Query: 491 IFLLTNAFGSAIGCALSPVDTDPKYLWMFTGLAVASFISGCLFWLTFHHLNDTEEEMNAM 550
           IFL+TNAFGSAIGCALSPV  DP + W++TGLAVA FISGCLFW+ F   ND EEEMNAM
Sbjct: 499 IFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCLFWVCFRKYNDIEEEMNAM 558

Query: 551 DYEENQEKIDD--------GLQKGTSD 569
           DYE +   +           L+KG+S+
Sbjct: 559 DYEVDATMLKKVPIETDTVALEKGSSE 585

>TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa]
           {ON} Anc_5.698 YKR093W
          Length = 633

 Score =  794 bits (2050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/553 (67%), Positives = 447/553 (80%), Gaps = 13/553 (2%)

Query: 52  LRSLRHVGGHIPFRCWLIAIVELSERFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGAT 111
           LR+L+HVGG IP RCWL+A++EL+ERFSYYGLSAPFQNYMQNG +D+P G L L S GAT
Sbjct: 88  LRTLKHVGGKIPLRCWLMAVIELAERFSYYGLSAPFQNYMQNGPNDSPPGALSLDSSGAT 147

Query: 112 GLAYFFQFWCYVTPVFGGWLADTYWGKYETICVGTGVYVVGIFILFITSLPSVDSKNTAL 171
           GL+YFFQFWCY+TPVF G++ADTYWGK+ TIC+GTG+Y+VGIFILFITSLPS+ S NTA+
Sbjct: 148 GLSYFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAM 207

Query: 172 GGFITAIVLIGIATGMIKANLSVLIADQFXXXXXXXXXXXXGERVIEDPNITIQNVFMFF 231
           GGFI  ++L+GIATGMIKANLSV+IA+Q             G RVIEDP+ITIQNVFM F
Sbjct: 208 GGFIVTLILVGIATGMIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFMTF 267

Query: 232 YLMINIGSLSVIATTELEEHKGFWAAYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAK 291
           Y MINIGSLSVIATTELE HKGFWAAYLLPFCFFW+AVIVL VG K+Y++ PVGDKVI+K
Sbjct: 268 YFMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWVAVIVLIVGNKTYIKTPVGDKVISK 327

Query: 292 SFRVLGQLIKHRFDYEAVKPSVHPERDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQ 351
            F+VL  L+++RF+ ++ KP+ +P+++YPW+D FV+EI RAL+ACKVF+FYPIYWV YGQ
Sbjct: 328 CFKVLRILMRNRFNPDSAKPAFNPDKNYPWSDKFVDEIMRALQACKVFVFYPIYWVCYGQ 387

Query: 352 MTSTFVSVGGEMQLHGLPNDFFQAIDSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFG 411
           M + FVS GG M+LHGLPNDFFQAIDSIALIVFIPICE ++YPFIR+YTPFKPITKIF+G
Sbjct: 388 MLNNFVSQGGTMELHGLPNDFFQAIDSIALIVFIPICERFVYPFIRKYTPFKPITKIFWG 447

Query: 412 FMWCSASMIWAAVLQHFIYKTGPCYDHPMDCPNGPNNIHIGWQVPAYVLIAFSEIFASIT 471
           F + + SM WA VLQHFIYK  PCYDHP  C NGPN+IH+  QVPAY L+A SEIFASIT
Sbjct: 448 FTFGALSMTWACVLQHFIYKAAPCYDHPSKCDNGPNHIHVALQVPAYCLLALSEIFASIT 507

Query: 472 GLEYAYSKAPTSMKSFIMSIFLLTNAFGSAIGCALSPVDTDPKYLWMFTGLAVASFISGC 531
           GLEYAYSKAP SMK+FIMSIFL+TNAFG+AIGCALSPV  DPKY+W++ GLAVA F+ GC
Sbjct: 508 GLEYAYSKAPASMKAFIMSIFLVTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACFVGGC 567

Query: 532 LFWLTFHHLNDTEEEMNAMDYEENQEKIDDGLQKGTSDLEFEPAGADDKLDHIGSHGATG 591
           LFW+ F   ND EEE+N +D+EE           G   LE + AG  + +  I S  ++ 
Sbjct: 568 LFWIIFKKYNDMEEELNNLDFEE-----------GDDMLETKHAGDIEMIQPISSRRSS- 615

Query: 592 FRHDGELGEEGEL 604
                EL +EG +
Sbjct: 616 -LKSNELVDEGSI 627

>YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integral
           membrane peptide transporter, mediates transport of di-
           and tri-peptides; conserved protein that contains 12
           transmembrane domains; PTR2 expression is regulated by
           the N-end rule pathway via repression by Cup9p
          Length = 601

 Score =  785 bits (2027), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/557 (69%), Positives = 451/557 (80%), Gaps = 10/557 (1%)

Query: 6   PSITGPEKNKVIIEDK--SLEVSGSHERGELDFDEYEVPNDDE---PTEEELRSLRHVGG 60
           P I   +   V ++D   S +V+ S ER  L       P D++   PTEEE+++LRHVGG
Sbjct: 21  PVIEEEKTQAVTLKDSYVSDDVANSTERYNLS----PSPEDEDFEGPTEEEMQTLRHVGG 76

Query: 61  HIPFRCWLIAIVELSERFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATGLAYFFQFW 120
            IP RCWLIAIVELSERFSYYGLSAPFQNYM+ G +D+P GVL L SQGATGL+YFFQFW
Sbjct: 77  KIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLSLNSQGATGLSYFFQFW 136

Query: 121 CYVTPVFGGWLADTYWGKYETICVGTGVYVVGIFILFITSLPSVDSKNTALGGFITAIVL 180
           CYVTPVFGG++ADT+WGKY TIC GT +Y+ GIFILFITS+PSV ++++A+GGFI AI+L
Sbjct: 137 CYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSAIGGFIAAIIL 196

Query: 181 IGIATGMIKANLSVLIADQFXXXXXXXXXXXXGERVIEDPNITIQNVFMFFYLMINIGSL 240
           IGIATGMIKANLSVLIADQ             GERVI D NIT+QNVFMFFY MIN+GSL
Sbjct: 197 IGIATGMIKANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITLQNVFMFFYFMINVGSL 256

Query: 241 SVIATTELEEHKGFWAAYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAKSFRVLGQLI 300
           S++ATTELE HKGFWAAYLLPFCFFWIAV+ L  G+K Y++ P+GDKVIAKSF+V   L 
Sbjct: 257 SLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVIAKSFKVCWILT 316

Query: 301 KHRFDYEAVKPSVHPERDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQMTSTFVSVG 360
           K++FD+ A KPSVHPE++YPWND FV+EIKRAL ACKVF+FYPIYW  YG M S+F++  
Sbjct: 317 KNKFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQA 376

Query: 361 GEMQLHGLPNDFFQAIDSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFGFMWCSASMI 420
             M+LHG+PNDF QA DSIALI+FIPI E ++YPFIRRYTP KPITKIFFGFM+ S +M 
Sbjct: 377 SMMELHGIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKPITKIFFGFMFGSFAMT 436

Query: 421 WAAVLQHFIYKTGPCYDHPMDCPNGPNNIHIGWQVPAYVLIAFSEIFASITGLEYAYSKA 480
           WAAVLQ F+YK GP Y+ P+   N PN++H+ WQ+PAYVLI+FSEIFASITGLEYAYSKA
Sbjct: 437 WAAVLQSFVYKAGPWYNEPLG-HNTPNHVHVCWQIPAYVLISFSEIFASITGLEYAYSKA 495

Query: 481 PTSMKSFIMSIFLLTNAFGSAIGCALSPVDTDPKYLWMFTGLAVASFISGCLFWLTFHHL 540
           P SMKSFIMSIFLLTNAFGSAIGCALSPV  DPK+ W+FTGLAVA FISGCLFWL F   
Sbjct: 496 PASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKY 555

Query: 541 NDTEEEMNAMDYEENQE 557
           NDTEEEMNAMDYEE  E
Sbjct: 556 NDTEEEMNAMDYEEEDE 572

>Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}
           complement(82303..84135) [1833 nt, 611 aa]
          Length = 610

 Score =  784 bits (2024), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/537 (67%), Positives = 440/537 (81%), Gaps = 7/537 (1%)

Query: 19  EDKSLEVSGSHERGELDFDEYEVPNDD---EPTEEELRSLRHVGGHIPFRCWLIAIVELS 75
           +  SL+ S   E  ++  D+ E  ++    EPTEEE+++L+HV G IP RCWLIA+VELS
Sbjct: 37  DSTSLQNSDQLEITKVGDDDIEYDDNQDFVEPTEEEMKTLKHVSGKIPMRCWLIAVVELS 96

Query: 76  ERFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATGLAYFFQFWCYVTPVFGGWLADTY 135
           ERFSYYGL+APFQNYM NG +D P GVL L +QGA+ L+YFFQFWCY+TP+FGG++ADTY
Sbjct: 97  ERFSYYGLAAPFQNYMANGPNDTPKGVLMLDTQGASALSYFFQFWCYITPIFGGYMADTY 156

Query: 136 WGKYETICVGTGVYVVGIFILFITSLPSVDSKNTALGGFITAIVLIGIATGMIKANLSVL 195
           WGKY TIC GTG+YVVGIF+LFITSLPS+D++ TALGG++TAI+LIGIATGMIKAN+SVL
Sbjct: 157 WGKYNTICAGTGIYVVGIFLLFITSLPSIDTRETALGGYVTAIILIGIATGMIKANISVL 216

Query: 196 IADQFXXXXXXXXXXXXGERVIEDPNITIQNVFMFFYLMINIGSLSVIATTELEEHKGFW 255
           IA+Q             G+RVIEDPNIT QNVFMFFY+MIN+GSLS++ATTELE HKGFW
Sbjct: 217 IAEQIPRTKPRVITQKGGKRVIEDPNITTQNVFMFFYMMINVGSLSLMATTELESHKGFW 276

Query: 256 AAYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAKSFRVLGQLIKHRFDYEAVKPSVHP 315
           AAYLLPFCFFWIAV+VL +GR  Y+  PVGDK+I+KSF+V+  L+K++ +++A KPS++P
Sbjct: 277 AAYLLPFCFFWIAVVVLVIGRNQYIMVPVGDKMISKSFKVMWILVKNKLNFDAAKPSMNP 336

Query: 316 ERDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQMTSTFVSVGGEMQLHGLPNDFFQA 375
           E++YPWND FVEEI+RAL+ACKVF+FYPIYW  YGQM + FV+  G M+LH LPNDF QA
Sbjct: 337 EKNYPWNDKFVEEIRRALRACKVFVFYPIYWCVYGQMINNFVTQAGTMELHNLPNDFLQA 396

Query: 376 IDSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFGFMWCSASMIWAAVLQHFIYKTGPC 435
            DSIA+IVFIPI E ++YPF+RR+TPF+PITKIF+GFM+ S +MIWAAVLQ FIYK GPC
Sbjct: 397 FDSIAIIVFIPIFERFIYPFVRRFTPFRPITKIFWGFMFGSGAMIWAAVLQSFIYKAGPC 456

Query: 436 YDHPMDC----PNGPNNIHIGWQVPAYVLIAFSEIFASITGLEYAYSKAPTSMKSFIMSI 491
           Y+ PM C     N PN +H+ WQVPAYVLIA SEI AS+TGLEYAYS AP SMKSFIMSI
Sbjct: 457 YNMPMKCAPEYANTPNQVHVAWQVPAYVLIAISEILASVTGLEYAYSNAPASMKSFIMSI 516

Query: 492 FLLTNAFGSAIGCALSPVDTDPKYLWMFTGLAVASFISGCLFWLTFHHLNDTEEEMN 548
           FL+TNAFGSAIG A+SP   DPKY W FTGLAVA FI+GCLFW+ F   N+TE+ MN
Sbjct: 517 FLVTNAFGSAIGIAISPTAQDPKYTWTFTGLAVACFIAGCLFWICFRSYNNTEDAMN 573

>Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093W
           (REAL)
          Length = 602

 Score =  782 bits (2020), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/557 (69%), Positives = 451/557 (80%), Gaps = 10/557 (1%)

Query: 6   PSITGPEKNKVIIEDK--SLEVSGSHERGELDFDEYEVPNDDE---PTEEELRSLRHVGG 60
           P I   + + V ++D   S +V+ S E+  L       P D++   PTEEE ++LRHVGG
Sbjct: 21  PVIEEEKTHAVTLKDSYVSDDVANSTEQYNLS----HSPEDEDFEAPTEEETKTLRHVGG 76

Query: 61  HIPFRCWLIAIVELSERFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATGLAYFFQFW 120
            IP RCWLIAIVELSERFSYYGLSAPFQNYM+ G +D+P GVL L SQGATGL+YFFQFW
Sbjct: 77  KIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLGLNSQGATGLSYFFQFW 136

Query: 121 CYVTPVFGGWLADTYWGKYETICVGTGVYVVGIFILFITSLPSVDSKNTALGGFITAIVL 180
           CYVTPVFGG++ADT+WGKY TIC GT +Y+ GIFILFITS+PSV ++++A+GGFI AI+L
Sbjct: 137 CYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSAIGGFIAAIIL 196

Query: 181 IGIATGMIKANLSVLIADQFXXXXXXXXXXXXGERVIEDPNITIQNVFMFFYLMINIGSL 240
           IGIATGMIKAN+SVLIADQ             GERVI D NIT+QNVFMFFY MIN+GSL
Sbjct: 197 IGIATGMIKANISVLIADQLPKRKPFIKVLKSGERVIVDSNITLQNVFMFFYFMINVGSL 256

Query: 241 SVIATTELEEHKGFWAAYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAKSFRVLGQLI 300
           S++ATTELE HKGFWAAYLLPFCFFWIAV+ L  G+K Y++ P+GDKV+AKSFRV   L 
Sbjct: 257 SLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVVAKSFRVCWILT 316

Query: 301 KHRFDYEAVKPSVHPERDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQMTSTFVSVG 360
           K++FD+ A KPSVHPE +YPWND FV+EIKRAL ACKVF+FYPIYW  YG M S+F++  
Sbjct: 317 KNKFDFNAAKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTMISSFITQA 376

Query: 361 GEMQLHGLPNDFFQAIDSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFGFMWCSASMI 420
             M+LHG+PNDF QA DSIALIVFIPI E ++YPFIRRYTP KPITKIFFGFM+ S +M 
Sbjct: 377 SMMELHGIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLKPITKIFFGFMFGSFAMT 436

Query: 421 WAAVLQHFIYKTGPCYDHPMDCPNGPNNIHIGWQVPAYVLIAFSEIFASITGLEYAYSKA 480
           WAAVLQ F+YK GP Y+ P+   N PN+IH+ WQ+PAYVLI+FSEIFASITGLEYAYSKA
Sbjct: 437 WAAVLQSFVYKAGPWYNEPLG-HNTPNHIHVCWQIPAYVLISFSEIFASITGLEYAYSKA 495

Query: 481 PTSMKSFIMSIFLLTNAFGSAIGCALSPVDTDPKYLWMFTGLAVASFISGCLFWLTFHHL 540
           P SMKSFIMSIFLLTNAFGSAIGCALSPV  DPK+ W+FTGLAVA FISGCLFWL F   
Sbjct: 496 PASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKY 555

Query: 541 NDTEEEMNAMDYEENQE 557
           NDTEEEMNAMDYEE+ E
Sbjct: 556 NDTEEEMNAMDYEEDDE 572

>NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON}
           Anc_5.698
          Length = 619

 Score =  781 bits (2016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/564 (66%), Positives = 441/564 (78%), Gaps = 4/564 (0%)

Query: 18  IEDKSLEVSGSHERGELDFDEYEVPNDDEPTEEELRSLRHVGGHIPFRCWLIAIVELSER 77
           +E  +L  S +    + D DE E    +EPT+EEL +L+ VGG IP RCWLI +VEL+ER
Sbjct: 47  VETYNLSNSANDSTNDFDDDEME-EGYEEPTDEELNTLKRVGGKIPLRCWLIGVVELAER 105

Query: 78  FSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATGLAYFFQFWCYVTPVFGGWLADTYWG 137
           FSYYGLSAPFQNYMQNG +D+P GVL L S GATGL+YFFQFWCYVTPVFGG++ADTYWG
Sbjct: 106 FSYYGLSAPFQNYMQNGPNDSPKGVLMLNSSGATGLSYFFQFWCYVTPVFGGFVADTYWG 165

Query: 138 KYETICVGTGVYVVGIFILFITSLPSVDSKNTALGGFITAIVLIGIATGMIKANLSVLIA 197
           KY +I VGTG Y+VGIFILFIT++PS+ S+N +LGGFI +I+LIGI TG IKANLSVLIA
Sbjct: 166 KYNSISVGTGFYIVGIFILFITAIPSIASQNASLGGFIVSIILIGIGTGFIKANLSVLIA 225

Query: 198 DQFXXXXXXXXXXXXGERVIEDPNITIQNVFMFFYLMINIGSLSVIATTELEEHKGFWAA 257
           DQ             GERVIEDPNIT+QNVFM FYLMINIGS+SV+ATTELE HKGFWAA
Sbjct: 226 DQLPKRKPRVKILKSGERVIEDPNITLQNVFMVFYLMINIGSMSVMATTELESHKGFWAA 285

Query: 258 YLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAKSFRVLGQLIKHRFDYEAVKPSVHPER 317
           YLLPFCFFWIAV++L  GRK YV+  +GD V+ KSF+V   + K++ DY A KPS HPER
Sbjct: 286 YLLPFCFFWIAVVILVFGRKYYVKEKMGDNVVQKSFKVCWIVAKNKLDYNAAKPSYHPER 345

Query: 318 DYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQMTSTFVSVGGEMQLHGLPNDFFQAID 377
           +YPWND FV+E+KR + ACKVF+FYPIYWV YG M STFV+ G  M+LHG+PNDF Q  D
Sbjct: 346 NYPWNDRFVDEMKRTIAACKVFVFYPIYWVQYGSMISTFVTQGSTMELHGIPNDFLQVFD 405

Query: 378 SIALIVFIPICEYWLYPFIRRYTPFKPITKIFFGFMWCSASMIWAAVLQHFIYKTGPCYD 437
           SIALI+FIPI E ++YPFIRR+TP +PITKI  GF     +M WAAVLQHFIY TGPCYD
Sbjct: 406 SIALIIFIPIFENFVYPFIRRFTPIRPITKITIGFFVGGCAMTWAAVLQHFIYNTGPCYD 465

Query: 438 HPMDCPNGPNNIHIGWQVPAYVLIAFSEIFASITGLEYAYSKAPTSMKSFIMSIFLLTNA 497
           HP+ C + PN IH+ WQ+PAYVLIAFSEIFASITGLEYAYSKAP SMKSF+MSIFLLTNA
Sbjct: 466 HPLSC-DTPNKIHVAWQIPAYVLIAFSEIFASITGLEYAYSKAPPSMKSFVMSIFLLTNA 524

Query: 498 FGSAIGCALSPVDTDPKYLWMFTGLAVASFISGCLFWLTFHHLNDTEEEMNAMDYE-ENQ 556
           FGS +G ALS V  DPK++W+F GLAV+  ++G LFWL F  LN TEEEMNAMDY+ E  
Sbjct: 525 FGSILGIALSSVTVDPKFVWLFGGLAVSCGVTGILFWLCFRGLNATEEEMNAMDYDAEID 584

Query: 557 EKIDDGLQKGTSDLEFEPAGADDK 580
           E+    L  G  DLE  P G D+ 
Sbjct: 585 EQSKRHLSSGADDLEILP-GPDNN 607

>CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093w PTR2
          Length = 597

 Score =  778 bits (2009), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/540 (70%), Positives = 444/540 (82%), Gaps = 2/540 (0%)

Query: 18  IEDKSLE-VSGSHERGELDFDEYEVPNDDEPTEEELRSLRHVGGHIPFRCWLIAIVELSE 76
           IED+ +  +       E +F   E  + + PTEEEL++LRHV GHIP RCWLIAIVELSE
Sbjct: 35  IEDQEIHHLDRDKSNAESNFALGEDDDFEAPTEEELKTLRHVAGHIPLRCWLIAIVELSE 94

Query: 77  RFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATGLAYFFQFWCYVTPVFGGWLADTYW 136
           RFSYYGLSAPFQNYMQNG +DNP G+L LKSQGATGL+YFFQFWCYVTPVFGGW++DTYW
Sbjct: 95  RFSYYGLSAPFQNYMQNGPNDNPKGLLGLKSQGATGLSYFFQFWCYVTPVFGGWVSDTYW 154

Query: 137 GKYETICVGTGVYVVGIFILFITSLPSVDSKNTALGGFITAIVLIGIATGMIKANLSVLI 196
           GKY TICVGT +YV GIFILFITS+P V + + ALGGFI AI+LIGIATGMIK+NLSVLI
Sbjct: 155 GKYNTICVGTFIYVCGIFILFITSIPGVTNSDGALGGFIAAIILIGIATGMIKSNLSVLI 214

Query: 197 ADQFXXXXXXXXXXXXGERVIEDPNITIQNVFMFFYLMINIGSLSVIATTELEEHKGFWA 256
           ADQ             GERVIEDPN+T+QNVFMFFY  IN+GSLSV+ATTELE HKGFWA
Sbjct: 215 ADQLPNKKPRVVITKKGERVIEDPNLTLQNVFMFFYFTINVGSLSVMATTELEYHKGFWA 274

Query: 257 AYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAKSFRVLGQLIKHRFDYEAVKPSVHPE 316
           AYLLPFCFFW+AV VL  GR  Y++PPVGDKVI+KSF+VL  L K++F+ EA KPS +P+
Sbjct: 275 AYLLPFCFFWVAVAVLVFGRNQYIKPPVGDKVISKSFKVLYILSKNKFNAEAAKPSFNPD 334

Query: 317 RDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQMTSTFVSVGGEMQLHGLPNDFFQAI 376
           +++PW+D FV+EIKRAL+ACKVF+FYP+YWV YG M + FV+ GG M+LH LPNDF QA 
Sbjct: 335 KNFPWSDKFVDEIKRALQACKVFVFYPVYWVCYGTMLNNFVTQGGTMELHNLPNDFLQAF 394

Query: 377 DSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFGFMWCSASMIWAAVLQHFIYKTGPCY 436
           DSIALI+FIPI E ++YPFIRRYTP +PITKIFFGFM  S +M+WAAVLQHFIY  GP Y
Sbjct: 395 DSIALIIFIPIFERFVYPFIRRYTPLRPITKIFFGFMVGSGAMVWAAVLQHFIYTKGPWY 454

Query: 437 DHPMDCPNGPNNIHIGWQVPAYVLIAFSEIFASITGLEYAYSKAPTSMKSFIMSIFLLTN 496
           DHP+D  + PN+IH+ WQ+PAYVLIA SEIFASITGLEYAYSKAP SMKSFIMSIFLLTN
Sbjct: 455 DHPLD-HDTPNHIHVAWQIPAYVLIAISEIFASITGLEYAYSKAPESMKSFIMSIFLLTN 513

Query: 497 AFGSAIGCALSPVDTDPKYLWMFTGLAVASFISGCLFWLTFHHLNDTEEEMNAMDYEENQ 556
           AFGSAIGCALSPV  DPK++W +TGLA A FI+G +FW  +  LND EE MNA+DYE ++
Sbjct: 514 AFGSAIGCALSPVSVDPKFVWFYTGLACACFIAGWVFWFIYSGLNDEEEAMNALDYEHDE 573

>NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {ON}
           Anc_5.698
          Length = 611

 Score =  777 bits (2006), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/609 (63%), Positives = 462/609 (75%), Gaps = 30/609 (4%)

Query: 12  EKNKVIIEDKSLE---------VSGSHERGELDFDEYEVPNDDE-------PTEEELRSL 55
           EK  V I +K+ E          +GS E    + + Y + +D+E       PTEE++ +L
Sbjct: 17  EKETVDISEKAQEKTQEITLKETTGSSEEVHDELETYHIHHDEECEPGYEIPTEEDMETL 76

Query: 56  RHVGGHIPFRCWLIAIVELSERFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATGLAY 115
           RHV G IP RCWLIA+VEL+ERFSYYGLSAPFQNYM+NG +D PAGVL+L S GATGL+Y
Sbjct: 77  RHVSGKIPLRCWLIALVELAERFSYYGLSAPFQNYMENGPNDTPAGVLELNSSGATGLSY 136

Query: 116 FFQFWCYVTPVFGGWLADTYWGKYETICVGTGVYVVGIFILFITSLPSVDSKNTALGGFI 175
           FFQFWCYVTPVFGG++ADTYWGKY TICVGTG+Y+ GIFILFITS+PS+ SK+T+LGGFI
Sbjct: 137 FFQFWCYVTPVFGGFMADTYWGKYNTICVGTGIYLAGIFILFITSIPSIASKDTSLGGFI 196

Query: 176 TAIVLIGIATGMIKANLSVLIADQFXXXXXXXXXXXXGERVIEDPNITIQNVFMFFYLMI 235
            AI+LIGIATGMIKANLSVLIADQ             GERV+EDPNIT+QNVFM+FYLM+
Sbjct: 197 AAIILIGIATGMIKANLSVLIADQLPKRKPRVKTLKSGERVVEDPNITLQNVFMWFYLMV 256

Query: 236 NIGSLSVIATTELEEHKGFWAAYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAKSFRV 295
           N+GSLSVIATTELEEHK FWAA+LLPFCFFWIAV+VL  GR  YV+    +K I KSF++
Sbjct: 257 NVGSLSVIATTELEEHKNFWAAFLLPFCFFWIAVVVLVGGRNQYVKEGKREKSIQKSFKI 316

Query: 296 LGQLIKHRFDYEAVKPSVHPERDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQMTST 355
           L  + K++FD  + KPS HPE++YPW D FV+E  RAL ACKVF+FYPIYWV YG M ST
Sbjct: 317 LWIVSKNKFDLTSAKPSYHPEKNYPWTDKFVDECSRALSACKVFLFYPIYWVIYGTMIST 376

Query: 356 FVSVGGEMQLHGLPNDFFQAIDSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFGFMWC 415
           FV+ G  M+LHGLPND FQAIDS ALI+FIPICE ++YPFIRR+TPFKPITKIFFGFM+ 
Sbjct: 377 FVTQGSMMELHGLPNDIFQAIDSFALIIFIPICERFIYPFIRRFTPFKPITKIFFGFMFA 436

Query: 416 SASMIWAAVLQHFIYKTGPCYDHPMDCPNGPNNIHIGWQVPAYVLIAFSEIFASITGLEY 475
           + +M+W+ VLQ FIYK GP YDHP++   GPN IH+GWQVPAYVLIAFSEI ASITGLEY
Sbjct: 437 TGAMVWSCVLQSFIYKAGPYYDHPLN-GGGPNRIHVGWQVPAYVLIAFSEILASITGLEY 495

Query: 476 AYSKAPTSMKSFIMSIFLLTNAFGSAIGCALSPVDTDPKYLWMFTGLAVASFISGCLFWL 535
           AYSKAP SMKSFIMS+FL +NA GS +G ALSPV  DPK+ W+F GL VA FI GC+FW+
Sbjct: 496 AYSKAPMSMKSFIMSLFLFSNAGGSILGIALSPVSVDPKFTWLFGGLGVACFIGGCIFWI 555

Query: 536 TFHHLNDTEEEMNAMDYEENQEKIDDGLQKGTSDLEFEPAGADDKLDHIGSHGATGFRHD 595
            F   NDTEEEMNAMDYE+ ++             E E AGA+D    + S  +   R  
Sbjct: 556 IFRKYNDTEEEMNAMDYEDEEDL-----------REMESAGANDL--ELNSTQSLTQRRT 602

Query: 596 GELGEEGEL 604
           GE  EE  +
Sbjct: 603 GESSEEKNI 611

>KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON} 
          Length = 596

 Score =  773 bits (1997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/580 (65%), Positives = 445/580 (76%), Gaps = 26/580 (4%)

Query: 7   SITGPEKNKVIIEDKSLEVSGSHERGELDFDEYEVPNDDE---------------PTEEE 51
           S+   EKN + ++  ++    S E   LD + Y++ ND+E               PTEEE
Sbjct: 14  SVITDEKNNIDLKKTTV----SSEDQILDTESYKLQNDNEFDPEHPDYQEEGYEMPTEEE 69

Query: 52  LRSLRHVGGHIPFRCWLIAIVELSERFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGAT 111
           LR+LRHV G IPFRC+LIA+VELSERFSYYGLSAPFQNYM N   D+P GVL L S GAT
Sbjct: 70  LRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVLQLNSDGAT 129

Query: 112 GLAYFFQFWCYVTPVFGGWLADTYWGKYETICVGTGVYVVGIFILFITSLPSVDSKNTAL 171
           GL+YFFQFWCY+TPV GG+LADT WG+Y TI VGTG+Y+VGIF+LFITS  S+  KN AL
Sbjct: 130 GLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAGKNGAL 189

Query: 172 GGFITAIVLIGIATGMIKANLSVLIADQFXXXXXXXXXXXXGERVIEDPNITIQNVFMFF 231
           GGFI A++LIGI TG IKANLSVLIADQ             GERVIED +ITIQNVFMFF
Sbjct: 190 GGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQNVFMFF 249

Query: 232 YLMINIGSLSVIATTELEEHKGFWAAYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAK 291
           YLMINIGSLSVIATTELE+H GFWAAYLLPFCFFWIAVIVL +GR+SY   P  D+VI K
Sbjct: 250 YLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTSDRVIEK 309

Query: 292 SFRVLGQLIKHRFDYEAVKPSVHPERDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQ 351
           SF+    L K++F++ AV P+ +PE  + W+D FVEEI+ AL ACKVF+FYPIYW  YGQ
Sbjct: 310 SFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYPIYWTCYGQ 369

Query: 352 MTSTFVSVGGEMQLHGLPNDFFQAIDSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFG 411
           MT+ FV++G  +QLHGLPND FQAIDSIALIVFIPICE + YPFIRR+TPF+PITKI +G
Sbjct: 370 MTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFRPITKITYG 429

Query: 412 FMWCSASMIWAAVLQHFIYKTGPCYDHPMDCPNGPNNIHIGWQVPAYVLIAFSEIFASIT 471
           F   SASM+WA VLQ+FIYKTGP Y HP+   +GPNN+H+ WQVPAYVLIAFSEIFASIT
Sbjct: 430 FWLASASMVWACVLQYFIYKTGPNYKHPL--ADGPNNVHVAWQVPAYVLIAFSEIFASIT 487

Query: 472 GLEYAYSKAPTSMKSFIMSIFLLTNAFGSAIGCALSPVDTDPKYLWMFTGLAVASFISGC 531
           GLEYAYSKAP SMKSFIM++FL  NAFGSAIGCALSPV  DP Y W++ GLAV +FI+GC
Sbjct: 488 GLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTAFITGC 547

Query: 532 LFWLTFHHLNDTEEEMNAMDYEENQEKIDDGLQKGTSDLE 571
            FW  F H ND E+EMNA++YE+     +D + +   D+E
Sbjct: 548 AFWFCFRHYNDIEDEMNALNYED-----EDIITENNQDIE 582

>SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} similar
           to uniprot|P32901 Saccharomyces cerevisiae YKR093W PTR2
           Functions in transport of small peptides into the cell
           Peptide transporter
          Length = 592

 Score =  772 bits (1993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/557 (68%), Positives = 454/557 (81%), Gaps = 15/557 (2%)

Query: 34  LDFDEYEVPNDD---EPTEEELRSLRHVGGHIPFRCWLIAIVELSERFSYYGLSAPFQNY 90
           LD ++Y   + D   EPT+EE+++LRHV   IP RCWL+A+VEL+ERFSYYGLSAPFQNY
Sbjct: 38  LDKNQYINADSDHGREPTDEEMKTLRHVSEQIPVRCWLVAVVELAERFSYYGLSAPFQNY 97

Query: 91  MQNGKHDNPAGVLDLKSQGATGLAYFFQFWCYVTPVFGGWLADTYWGKYETICVGTGVYV 150
           MQNG +D P G+L+LK+QGAT L+YFFQFWCYV+P+ GG++ADTYWGKY+TICVGTG+YV
Sbjct: 98  MQNGPNDTPKGILNLKNQGATALSYFFQFWCYVSPLLGGFVADTYWGKYKTICVGTGIYV 157

Query: 151 VGIFILFITSLPSVDSKNTALGGFITAIVLIGIATGMIKANLSVLIADQFXXXXXXXXXX 210
           VGIFILFITS+PS+   + +LGGFIT+++LIG+ATGMIKAN+SVLIADQ           
Sbjct: 158 VGIFILFITSVPSITYYSASLGGFITSLILIGLATGMIKANISVLIADQIPKSRPTVKVL 217

Query: 211 XXGERVIEDPNITIQNVFMFFYLMINIGSLSVIATTELEEHKGFWAAYLLPFCFFWIAVI 270
             GERVIEDPNIT+QN+FMFFYLMINIGSLSVIATTE+E H GFWAAYLLPFCFF++AV 
Sbjct: 218 KSGERVIEDPNITVQNIFMFFYLMINIGSLSVIATTEMEAHIGFWAAYLLPFCFFFVAVF 277

Query: 271 VLFVGRKSYVRPPVGDKVIAKSFRVLGQLIKHRFDYEAVKPSVHPERDYPWNDHFVEEIK 330
           VL +GR  YV+ PVGDKVI+KSF+V   +++++F ++A +PS++PE  YPW+D F++EIK
Sbjct: 278 VLILGRNQYVKLPVGDKVISKSFKVCWIVMRNKFRFDAARPSLNPELGYPWSDKFIDEIK 337

Query: 331 RALKACKVFMFYPIYWVPYGQMTSTFVSVGGEMQLHGLPNDFFQAIDSIALIVFIPICEY 390
           RA+ ACKVF+FYPIYWV YGQM S FVS  G M+LHGLPNDF QAIDSIALIVFIPICE 
Sbjct: 338 RAIAACKVFVFYPIYWVCYGQMLSNFVSQAGMMELHGLPNDFLQAIDSIALIVFIPICER 397

Query: 391 WLYPFIRRYTPFKPITKIFFGFMWCSASMIWAAVLQHFIYKTGPCYDHPMDCP----NGP 446
           +LYPFIRR+TPF+PITKIF+GF++ + +M WAAVLQHFIYK GPCY +PM C     N P
Sbjct: 398 FLYPFIRRFTPFRPITKIFYGFIFGALAMAWAAVLQHFIYKAGPCYYYPMACAPEYKNTP 457

Query: 447 NNIHIGWQVPAYVLIAFSEIFASITGLEYAYSKAPTSMKSFIMSIFLLTNAFGSAIGCAL 506
           N IHI WQVPAYVLIAFSEIFASITGLEYAYSKAP SM+SFIMSIFLLT AFGSA+G AL
Sbjct: 458 NRIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAPVSMRSFIMSIFLLTTAFGSALGIAL 517

Query: 507 SPVDTDPKYLWMFTGLAVASFISGCLFWLTFHHLNDTEEEMNAMDYEENQEKIDDGLQKG 566
           S V  +PK++W F+GLAV+ FI+GCLFW  FH  NDTEE MNA+DYEE     DD L  G
Sbjct: 518 SSVSVNPKFVWTFSGLAVSCFIAGCLFWAFFHKYNDTEEAMNAIDYEE-----DDVLNYG 572

Query: 567 TS---DLEFEPAGADDK 580
            S   DLE   +   DK
Sbjct: 573 VSIHYDLEPIASVNSDK 589

>TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {ON}
           
          Length = 620

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/563 (62%), Positives = 440/563 (78%), Gaps = 15/563 (2%)

Query: 18  IEDKSLEVSGSHERGELDFDEYEVPNDDE-----PTEEELRSLRHVGGHIPFRCWLIAIV 72
           I+DK    +   E  E   D+   P +DE     PTEEE+ +L+HV GHIP+RCWLIA+V
Sbjct: 42  IDDKVENDTNEEELDEFAVDDEADPYNDEWGYVEPTEEEMATLKHVAGHIPYRCWLIAVV 101

Query: 73  ELSERFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATGLAYFFQFWCYVTPVFGGWLA 132
           ELSERFSYYGLSAPFQNYM NG +D P G+L L + GATGL+YFFQFWCY+TP+FGG++A
Sbjct: 102 ELSERFSYYGLSAPFQNYMANGPNDTPKGILQLNTNGATGLSYFFQFWCYITPIFGGYMA 161

Query: 133 DTYWGKYETICVGTGVYVVGIFILFITSLPSVDSKNTALGGFITAIVLIGIATGMIKANL 192
           DTYW KY TI VGT +Y++GIFILFIT++PS+ +K TA GGF+TAI+LIGI TGMIKANL
Sbjct: 162 DTYWNKYNTIAVGTVIYIIGIFILFITAIPSIATKETATGGFVTAIILIGIGTGMIKANL 221

Query: 193 SVLIADQFXXXXXXXXXXXXGERVIEDPNITIQNVFMFFYLMINIGSLSVIATTELEEHK 252
           SVL+A+Q             GERVIEDP+IT+QNVFMFFYLMINIG+LSV+ATTELE HK
Sbjct: 222 SVLVAEQIPKRKHRVITTKKGERVIEDPDITMQNVFMFFYLMINIGALSVLATTELESHK 281

Query: 253 GFWAAYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAKSFRVLGQLIKHRFDYEAVKPS 312
           GFWAAYLLPFCFFWIAV++L +GR SY+  PVGDKVI+K F+V   + K++F++++ KPS
Sbjct: 282 GFWAAYLLPFCFFWIAVVILVMGRNSYIIKPVGDKVISKCFKVTFIVCKNKFNFDSAKPS 341

Query: 313 VHPERDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQMTSTFVSVGGEMQLHGLPNDF 372
           ++PE  YPW+D FV+EI R++KACKVF+FYPIYW  YGQM + F++  G M+LH +PNDF
Sbjct: 342 LNPEMQYPWSDKFVDEINRSIKACKVFIFYPIYWCVYGQMINNFITQAGTMELHNIPNDF 401

Query: 373 FQAIDSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFGFMWCSASMIWAAVLQHFIYKT 432
            Q  DSI +IVFIPI E ++YP IRR+TP KPITKIF GFM  S +M+WAAVLQ FIYK 
Sbjct: 402 LQVFDSIGIIVFIPIFERFVYPTIRRFTPLKPITKIFLGFMCGSCAMVWAAVLQSFIYKA 461

Query: 433 GPCYDHPMDC----PNGPNNIHIGWQVPAYVLIAFSEIFASITGLEYAYSKAPTSMKSFI 488
           GPCYDHPM C     N PN +H+ WQ+PAYV+IA+SEIFAS+TGLE+AYS AP SMK+FI
Sbjct: 462 GPCYDHPMACGPEYTNIPNRVHVAWQIPAYVIIAWSEIFASVTGLEFAYSNAPDSMKAFI 521

Query: 489 MSIFLLTNAFGSAIGCALSPVDTDPKYLWMFTGLAVASFISGCLFWLTFHHLNDTEEEMN 548
           MSIFL TNA G+A+G A+SP   DPKY W+FTGLAV+ F++GCLFW+ FHH ND + +M 
Sbjct: 522 MSIFLFTNAIGAALGVAISPTSVDPKYTWVFTGLAVSCFVAGCLFWICFHHYNDIDADMK 581

Query: 549 AMDYEENQEKIDDGLQKGTSDLE 571
           A+D+      ++D +   + D+E
Sbjct: 582 AIDF------VEDDMINASGDVE 598

>TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {ON}
           
          Length = 591

 Score =  760 bits (1962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/526 (68%), Positives = 430/526 (81%), Gaps = 6/526 (1%)

Query: 47  PTEEELRSLRHVGGHIPFRCWLIAIVELSERFSYYGLSAPFQNYMQNGKHDNPAGVLDLK 106
           PTEEEL++LRHV G+IP RCWLIAIVEL+ERFSYYGLSAPFQNYM NG +D P G+L L 
Sbjct: 57  PTEEELKTLRHVSGYIPLRCWLIAIVELAERFSYYGLSAPFQNYMANGPNDTPKGLLQLN 116

Query: 107 SQGATGLAYFFQFWCYVTPVFGGWLADTYWGKYETICVGTGVYVVGIFILFITSLPSVDS 166
           S GAT ++YFFQFWCYVTP+FGG++ADT+WGKY TIC GTG+YV GIFILF+TS+ S+ +
Sbjct: 117 SSGATAISYFFQFWCYVTPIFGGYMADTHWGKYNTICTGTGIYVSGIFILFMTSIESITT 176

Query: 167 KNTALGGFITAIVLIGIATGMIKANLSVLIADQFXXXXXXXXXXXXGERVIEDPNITIQN 226
           +N A GG+I AI+LIGIATGMIK+N+SVLIA+Q             GERVIEDP +T+QN
Sbjct: 177 QNAARGGYIAAIILIGIATGMIKSNISVLIAEQVPKRKIRVITTSKGERVIEDPKLTVQN 236

Query: 227 VFMFFYLMINIGSLSVIATTELEEHKGFWAAYLLPFCFFWIAVIVLFVGRKSYVRPPVGD 286
           +FMFFYLMINIGSLSVIATTELE HKGFWAAYLLPFCFFWIAV+VL VG+K YVR PVGD
Sbjct: 237 IFMFFYLMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWIAVVVLIVGKKQYVRKPVGD 296

Query: 287 KVIAKSFRVLGQLIKHRFDYEAVKPSVHPERDYPWNDHFVEEIKRALKACKVFMFYPIYW 346
           KVI+K F +     K++ D+++ KPS HPE +YPW D FVEE++RA++ACKVF+FYPIYW
Sbjct: 297 KVISKCFTITWIAFKNKLDFDSAKPSCHPEANYPWTDKFVEEVRRAIRACKVFLFYPIYW 356

Query: 347 VPYGQMTSTFVSVGGEMQLHGLPNDFFQAIDSIALIVFIPICEYWLYPFIRRYTPFKPIT 406
             YGQM + FV+  G M+LHGLPNDF QAIDSIA+IVFIPICE +LYPFIR++TPF+ IT
Sbjct: 357 CVYGQMLNNFVTQAGTMELHGLPNDFLQAIDSIAIIVFIPICEKFLYPFIRKFTPFRSIT 416

Query: 407 KIFFGFMWCSASMIWAAVLQHFIYKTGPCYDHPMDC----PNGPNNIHIGWQVPAYVLIA 462
           KIF+GFM+ SA+MIWAAVLQ FIYK GPC+D P+ C     + PN +HI WQVPAYVLIA
Sbjct: 417 KIFWGFMFGSAAMIWAAVLQSFIYKAGPCFDKPLACAAQYAHTPNQVHIAWQVPAYVLIA 476

Query: 463 FSEIFASITGLEYAYSKAPTSMKSFIMSIFLLTNAFGSAIGCALSPVDTDPKYLWMFTGL 522
           FSEIFASITGLEYAYS AP SMKSFIMSIFLLT AFGSA+G A+SP   DPK+ W FTGL
Sbjct: 477 FSEIFASITGLEYAYSNAPESMKSFIMSIFLLTTAFGSALGIAISPTSVDPKFTWAFTGL 536

Query: 523 AVASFISGCLFWLTFHHLNDTEEEMNAMDYEENQEKIDDGLQKGTS 568
           AV+ FI+GCLFW+ F   N+TE+ M+ +D+ +  EK+ D   K +S
Sbjct: 537 AVSCFIAGCLFWICFRKYNNTEDSMDEIDFID--EKVTDMANKASS 580

>TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/526 (66%), Positives = 422/526 (80%), Gaps = 2/526 (0%)

Query: 46  EPTEEELRSLRHVGGHIPFRCWLIAIVELSERFSYYGLSAPFQNYMQNGKHDNPAGVLDL 105
           EPTEEE+R+L+ VGG+IP RCWL+A++ELSERFSYYGLSAPFQNYMQNG +D P G L L
Sbjct: 70  EPTEEEMRTLKRVGGYIPARCWLMAVIELSERFSYYGLSAPFQNYMQNGPYDTPPGALSL 129

Query: 106 KSQGATGLAYFFQFWCYVTPVFGGWLADTYWGKYETICVGTGVYVVGIFILFITSLPSVD 165
            +QGATGL+YFFQFWCY+TP+FGG++ADTYWGKY TI VG   Y+ GIFILF+TSLP + 
Sbjct: 130 NTQGATGLSYFFQFWCYITPIFGGYMADTYWGKYNTIWVGVISYICGIFILFMTSLPKLT 189

Query: 166 SKNTALGGFITAIVLIGIATGMIKANLSVLIADQFXXXXXXXXXXXXGERVIEDPNITIQ 225
           S + A+GGFI +I++IG+ TGMIKANLSV+IA+Q             G RVIEDP+IT+Q
Sbjct: 190 SYSAAMGGFIVSIIIIGLGTGMIKANLSVMIAEQVPKRKRRIITRKDGTRVIEDPDITLQ 249

Query: 226 NVFMFFYLMINIGSLSVIATTELEEHKGFWAAYLLPFCFFWIAVIVLFVGRKSYVRPPVG 285
           NVFM FY MIN+GSLSV+ATTELE  KGFWAAYLLPFCFFW+AV+VL +G K +++ P+G
Sbjct: 250 NVFMAFYFMINVGSLSVMATTELEARKGFWAAYLLPFCFFWVAVVVLMIGNKRFIKVPIG 309

Query: 286 DKVIAKSFRVLGQLIKHRFDYEAVKPSVHPERDYPWNDHFVEEIKRALKACKVFMFYPIY 345
           DK I+KSF+V+G LIK++F+YE+ KPS+HPE +YPW D FVEEI+RA+KAC VF FYPIY
Sbjct: 310 DKTISKSFKVVGILIKNKFNYESAKPSIHPECNYPWTDKFVEEIRRAIKACNVFYFYPIY 369

Query: 346 WVPYGQMTSTFVSVGGEMQLHGLPNDFFQAIDSIALIVFIPICEYWLYPFIRRYTPFKPI 405
           WV YGQM + FV+ GG+M+LH LPNDF Q IDSIALIVFIPICE  +YPF+RR+TP +PI
Sbjct: 370 WVCYGQMLNNFVTQGGQMELHDLPNDFLQVIDSIALIVFIPICERLIYPFVRRFTPLRPI 429

Query: 406 TKIFFGFMWCSASMIWAAVLQHFIYKTGPCYDHPMDCPNGPNNIHIGWQVPAYVLIAFSE 465
           TKI  GF + S SM+WAAVLQ F+Y+  PCY HP +CPNGPN+IH+ WQVPAY LIA SE
Sbjct: 430 TKITIGFFFGSFSMVWAAVLQWFVYQKPPCYYHPTNCPNGPNHIHVCWQVPAYCLIALSE 489

Query: 466 IFASITGLEYAYSKAPTSMKSFIMSIFLLTNAFGSAIGCALSPVDTDPKYLWMFTGLAVA 525
           IFASITGLEYAYSKAP SMKSFIMSIFL T A GSA+G ALSPV  DPK+ W + GLAV+
Sbjct: 490 IFASITGLEYAYSKAPASMKSFIMSIFLFTTAIGSALGAALSPVSIDPKFTWQYVGLAVS 549

Query: 526 SFISGCLFWLTFHHLNDTEEEMNAMDYEENQEKIDDGLQKGTSDLE 571
            FI+G  FWL F   ND E+E+N +D + +  +I    +    DLE
Sbjct: 550 CFIAGIAFWLCFSRYNDEEDELNNIDDQPDVIQISS--ENENDDLE 593

>KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa]
           {ON} similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 654

 Score =  752 bits (1941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/576 (63%), Positives = 445/576 (77%), Gaps = 15/576 (2%)

Query: 3   SASPSITGPEKNKVIIEDKSLEVSGSHER----------GELDFDEYEVPNDDEPTEEEL 52
           S+    TG +K++    +  ++V  S +           G +D D+ +  N  EPTEEEL
Sbjct: 43  SSDDEFTGEKKDEKFKNNTDIKVYISKDHHASSDKIDFIGAVDEDDNQNENGREPTEEEL 102

Query: 53  RSLRHVGGHIPFRCWLIAIVELSERFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATG 112
            +LRHV   IPF CWLIAIVEL+ERFSYYGLSAPFQNYMQNG +D P GVL LKSQGAT 
Sbjct: 103 STLRHVSERIPFTCWLIAIVELAERFSYYGLSAPFQNYMQNGPNDTPKGVLQLKSQGATA 162

Query: 113 LAYFFQFWCYVTPVFGGWLADTYWGKYETICVGTGVYVVGIFILFITSLPSVDSKNTALG 172
           L+YFFQFWCYVTP+ GG+LADT+WGKY TICVG   YVVGI ILF+T++PS++ KN++LG
Sbjct: 163 LSYFFQFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTAIPSINDKNSSLG 222

Query: 173 GFITAIVLIGIATGMIKANLSVLIADQFXXXXXXXXXXXXGERVIEDPNITIQNVFMFFY 232
           GFI ++++IGI TG IKANLSVLIADQ             GE+VIEDPN+T+QNVFMFFY
Sbjct: 223 GFIVSLIIIGIGTGFIKANLSVLIADQIPKTRPRIKVLKNGEKVIEDPNVTMQNVFMFFY 282

Query: 233 LMINIGSLSVIATTELEEHKGFWAAYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAKS 292
           LMINIGSLSV+ATT LE   GFWAAYLL FCFFW+ ++VL  GRK YVR P+GD VIA+ 
Sbjct: 283 LMINIGSLSVMATTHLEASYGFWAAYLLTFCFFWVGIVVLVFGRKKYVRRPIGDHVIARC 342

Query: 293 FRVLGQLIKHRFDYEAVKPSVHPERDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQM 352
           F++    + + F+     PS++PE++YPWND F++EI+RA KACKVF FYPIYWV YGQM
Sbjct: 343 FKICWIGLCNGFNLNRAVPSLNPEKEYPWNDLFIDEIRRAFKACKVFAFYPIYWVVYGQM 402

Query: 353 TSTFVSVGGEMQLHGLPNDFFQAIDSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFGF 412
            + FV+  G M+LHGLPNDF QAI+SIALIVFIPI E ++YPFIRR+TPF+P+TKIF GF
Sbjct: 403 LNNFVTQAGTMELHGLPNDFLQAINSIALIVFIPIMEQFIYPFIRRFTPFRPVTKIFIGF 462

Query: 413 MWCSASMIWAAVLQHFIYKTGPCYDHPMDC----PNGPNNIHIGWQVPAYVLIAFSEIFA 468
            + S++M++AAVLQHFIYK GPCYD PM C     N PN +HIGWQVPAYVLI+ SEIFA
Sbjct: 463 CFGSSAMVYAAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVHIGWQVPAYVLISLSEIFA 522

Query: 469 SITGLEYAYSKAPTSMKSFIMSIFLLTNAFGSAIGCALSPVDTDPKYLWMFTGLAVASFI 528
           SITGLEYAYSKAP +MK+FIMSIFL+TNA GSA+G ALSP   +PKY+W F+GLAVA FI
Sbjct: 523 SITGLEYAYSKAPATMKAFIMSIFLVTNAVGSALGIALSPTAENPKYVWTFSGLAVACFI 582

Query: 529 SGCLFWLTFHHLNDTEEEMNAMDYE-ENQEKIDDGL 563
           +GCLFWL FHH N  EE +NA+DY+ E QE++  G+
Sbjct: 583 AGCLFWLCFHHYNKDEEALNALDYKTEEQEQMLSGV 618

>TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON} 
          Length = 615

 Score =  748 bits (1931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/586 (62%), Positives = 446/586 (76%), Gaps = 24/586 (4%)

Query: 20  DKSLEVSGSHERGELDFDEYEVPNDD----------------------EPTEEELRSLRH 57
           D S++   S E+  + FD  E  +                        EPTEEEL++L  
Sbjct: 18  DNSIKKESSVEKNHIKFDSIENTSTTSTINKQLTNDSDYDDMDDGDDIEPTEEELKTLPR 77

Query: 58  VGGHIPFRCWLIAIVELSERFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATGLAYFF 117
             GHIPF CWL+AI+EL+ERFSYYGLSAPFQNYMQN   DNP G L L S GATGL+YFF
Sbjct: 78  EAGHIPFNCWLLAIIELAERFSYYGLSAPFQNYMQNNPSDNPPGALSLNSTGATGLSYFF 137

Query: 118 QFWCYVTPVFGGWLADTYWGKYETICVGTGVYVVGIFILFITSLPSVDSKNTALGGFITA 177
           QFWCYVTP+F G++ADTYWGK+ T+C+GT +Y++GIFILFITSLP++ S NTALGGFI A
Sbjct: 138 QFWCYVTPIFAGFMADTYWGKFNTLCIGTIIYIIGIFILFITSLPAITSYNTALGGFIVA 197

Query: 178 IVLIGIATGMIKANLSVLIADQF-XXXXXXXXXXXXGERVIEDPNITIQNVFMFFYLMIN 236
           I+LIGIATGMIKANLSV+IADQ              G+RVIEDP +TIQNVFM FY MIN
Sbjct: 198 IILIGIATGMIKANLSVMIADQLPKKKLRVVTKKKSGKRVIEDPQLTIQNVFMAFYFMIN 257

Query: 237 IGSLSVIATTELEEHKGFWAAYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAKSFRVL 296
           +GSLSVIATTELE H GFWAAYLLPFCFFWIAV+VL  G + +V+ P+GD+VI+K F ++
Sbjct: 258 VGSLSVIATTELELHVGFWAAYLLPFCFFWIAVLVLAFGNRKFVKKPIGDRVISKCFTII 317

Query: 297 GQLIKHRFDYEAVKPSVHPERDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQMTSTF 356
           G LIK+ F+++  KP+ +PE++YPW+D FV+EI+R+LKACKVF+FYPIYWV YGQM + F
Sbjct: 318 GILIKNNFNFQKAKPTYNPEKNYPWSDKFVDEIQRSLKACKVFLFYPIYWVCYGQMLNNF 377

Query: 357 VSVGGEMQLHGLPNDFFQAIDSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFGFMWCS 416
           V+ G  MQLHGLPNDFFQAI+SIALIVFIPI E ++YPFIR++TP KPITK+  GF++ S
Sbjct: 378 VTQGSTMQLHGLPNDFFQAINSIALIVFIPIVEKFVYPFIRKFTPLKPITKVTIGFVFGS 437

Query: 417 ASMIWAAVLQHFIYKTGPCYDHPMDCPNGPNNIHIGWQVPAYVLIAFSEIFASITGLEYA 476
            +M+WAAVLQHFIY+ GPCYDHP+ CPNGPN++H+ WQVPAY LI+ SEIFASITGLE A
Sbjct: 438 LAMVWAAVLQHFIYQAGPCYDHPVKCPNGPNHVHVAWQVPAYCLISLSEIFASITGLEIA 497

Query: 477 YSKAPTSMKSFIMSIFLLTNAFGSAIGCALSPVDTDPKYLWMFTGLAVASFISGCLFWLT 536
           YSKAP SMKSFIMS+FL+TNAFG+AIGCALS V  DPKY+W++TGLAV  F +G  FW T
Sbjct: 498 YSKAPESMKSFIMSMFLVTNAFGAAIGCALSSVSEDPKYVWLYTGLAVTCFCAGIAFWFT 557

Query: 537 FHHLNDTEEEMNAMDYEENQEKIDDGLQKGTSDLEFEPAGADDKLD 582
           F H ND E+ MN +D+E + E   +   +   +LE       DK D
Sbjct: 558 FKHYNDEEDAMNNIDFESDNENEKNEYSQ-IENLELSQTKTTDKDD 602

>KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}
           Anc_5.698 YKR093W
          Length = 591

 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/577 (61%), Positives = 443/577 (76%), Gaps = 17/577 (2%)

Query: 6   PSITGPEKNKVIIEDKSLEVS---GSHERGEL----------DFDEYEVPNDDEPTEEEL 52
           PS       K  IE K+ +VS   G H+  E           D ++Y+    + PT++E+
Sbjct: 11  PSSINTSMEKNYIELKNTKVSSSDGEHKDTEAYTLQDGSIEPDHEDYQEEGYEIPTQDEM 70

Query: 53  RSLRHVGGHIPFRCWLIAIVELSERFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATG 112
           ++LR VGG IPFRC+L+A+VEL+ERFSYYGLSAPFQNYMQNG  D+P GVL L S GATG
Sbjct: 71  KTLRRVGGRIPFRCFLVALVELAERFSYYGLSAPFQNYMQNGPTDSPPGVLQLNSSGATG 130

Query: 113 LAYFFQFWCYVTPVFGGWLADTYWGKYETICVGTGVYVVGIFILFITSLPSVDSKNTALG 172
           L+YFFQFWCY+TP+FGG+LADT WG+Y TI VGT +Y++GIFILFITS  +V  ++ AL 
Sbjct: 131 LSYFFQFWCYITPIFGGYLADTKWGRYNTIGVGTVIYIIGIFILFITSFKTVAGRDGALA 190

Query: 173 GFITAIVLIGIATGMIKANLSVLIADQFXXXXXXXXXXXXGERVIEDPNITIQNVFMFFY 232
           GFI A++LIG ATG+IK+NLSVLIADQ             GERVIED ++TIQNVFMFFY
Sbjct: 191 GFILALILIGFATGLIKSNLSVLIADQIPAKRPRVKTLKSGERVIEDHDVTIQNVFMFFY 250

Query: 233 LMINIGSLSVIATTELEEHKGFWAAYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAKS 292
           LMINIGSLSVIATTELE + GFWAAYLLPFCFFWIAVIV+  G++ Y+  P GD+VIAKS
Sbjct: 251 LMINIGSLSVIATTELELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYIIKPTGDRVIAKS 310

Query: 293 FRVLGQLIKHRFDYEAVKPSVHPERDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQM 352
           F+V   L K++FD  + KPS HPE ++PW D FV+EI+RAL ACKVF+FYPIYW  YGQM
Sbjct: 311 FKVCWILCKNKFDITSAKPSYHPESEFPWEDKFVDEIQRALAACKVFLFYPIYWTCYGQM 370

Query: 353 TSTFVSVGGEMQLHGLPNDFFQAIDSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFGF 412
            + F+++G  MQLHGLPND FQAI+SI+LI+FIPICE +LYPFIRR+TP +P+T+IF GF
Sbjct: 371 VNNFITMGSMMQLHGLPNDIFQAINSISLIIFIPICEKFLYPFIRRFTPLRPVTRIFCGF 430

Query: 413 MWCSASMIWAAVLQHFIYKTGPCYDHPMDCPNGPNNIHIGWQVPAYVLIAFSEIFASITG 472
           ++ + +M+W+ VLQHFIY TGP Y+ P++   G N+IH+GWQVPAYV IAFSEIFASITG
Sbjct: 431 IFAAMAMVWSCVLQHFIYSTGPNYNRPLEL--GANDIHVGWQVPAYVFIAFSEIFASITG 488

Query: 473 LEYAYSKAPTSMKSFIMSIFLLTNAFGSAIGCALSPVDTDPKYLWMFTGLAVASFISGCL 532
           LEYAYSKAP +MKSFIM++FL  NAFGSAIGCALSPV  DP Y W++  LAVA F+SG +
Sbjct: 489 LEYAYSKAPANMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYGSLAVACFLSGLI 548

Query: 533 FWLTFHHLNDTEEEMNAMDYEENQEKIDDGLQKGTSD 569
           FWL F   N  E+EMNA+D+ +++E  D+ L +   D
Sbjct: 549 FWLCFRKYNKIEDEMNALDFTDSEE--DEILIRRAED 583

>Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093W
           (REAL)
          Length = 399

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/371 (73%), Positives = 305/371 (82%), Gaps = 1/371 (0%)

Query: 187 MIKANLSVLIADQFXXXXXXXXXXXXGERVIEDPNITIQNVFMFFYLMINIGSLSVIATT 246
           MIKANLSVLIADQ             GERV+ DPNIT+QNVFMFFY MIN+GSLS++ATT
Sbjct: 1   MIKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATT 60

Query: 247 ELEEHKGFWAAYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAKSFRVLGQLIKHRFDY 306
           ELE HKGFWAAYLLPFCFFWIAV+ L +G+K Y++ P+GDKVIAKSFRV   L K++FD+
Sbjct: 61  ELEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDF 120

Query: 307 EAVKPSVHPERDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQMTSTFVSVGGEMQLH 366
            A KPS+HPERDYPWND FV+EIKRAL ACKVF+FYPIYW  YG M S+F++    M+LH
Sbjct: 121 NAAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELH 180

Query: 367 GLPNDFFQAIDSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFGFMWCSASMIWAAVLQ 426
           G+PNDF QA DSIALI+FIPI E ++YPFIRRYTPFKPITKIFFGFM+ S +M WAAVLQ
Sbjct: 181 GIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ 240

Query: 427 HFIYKTGPCYDHPMDCPNGPNNIHIGWQVPAYVLIAFSEIFASITGLEYAYSKAPTSMKS 486
            FIYK GP YD P+   N PN +H+ WQ+PAYVLI+FSEIFASITGLEYAYSKAP SMKS
Sbjct: 241 SFIYKAGPWYDEPLG-HNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKS 299

Query: 487 FIMSIFLLTNAFGSAIGCALSPVDTDPKYLWMFTGLAVASFISGCLFWLTFHHLNDTEEE 546
           FIMSIFLLT AFGSAIGCALSPV  DPK+ W+FTGLAVA FISGCLFW  F   NDTEEE
Sbjct: 300 FIMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYNDTEEE 359

Query: 547 MNAMDYEENQE 557
           MNAMDYEE  E
Sbjct: 360 MNAMDYEEEDE 370

>Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093W
           (PTR2) - Peptide transporter [contig 219] FULL
          Length = 611

 Score =  266 bits (681), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 175/577 (30%), Positives = 270/577 (46%), Gaps = 57/577 (9%)

Query: 24  EVSGSHERGELDFDEYEVPNDDEPTEEELRSLRHVGGHIPFRCWLIAIVELSERFSYYGL 83
           E+ G  E    DFDE +     EPTE E   LR V GH  +  + I ++E SER SYYG 
Sbjct: 13  EIDGHSE----DFDELDTQTFPEPTERERSELRRVLGHPKWYVYFICLIEFSERASYYGT 68

Query: 84  SAPFQNYMQN-------------GKHDNPAGVLDLKSQGATGLAYFFQFWCYVTPVFGGW 130
                N++Q                 +  AG L +  Q AT L     F  Y  P+  G+
Sbjct: 69  GDRLNNFIQKPLPAGGNGAGAPAPGSEATAGALGMGLQVATALNLLLTFLAYCFPLITGY 128

Query: 131 LADTYWGKYETICVGTGVYVVGIFILFITSLPSV-DSKNTALGGFITAIVLIGIATGMIK 189
           +AD YWG+   + +G  V +V   +  I SLP V    + AL   I  I+ + IAT  +K
Sbjct: 129 VADRYWGRMRMLWIGVFVGIVSHVVFIIGSLPVVLGHGSAALAPCIIGIITLAIATAFVK 188

Query: 190 ANLSVLIADQFXXXXXXXXXXXXGERVIEDPNITIQNVFMFFYLMINIGSLSVIATTELE 249
             L   +  Q+            GERVI D + ++Q + M FY  IN+GS   +AT+   
Sbjct: 189 PILLPTLLSQYPHATDVVKTLPSGERVIIDRDASLQRMTMTFYWSINVGSFLSVATSYSA 248

Query: 250 EHKGFWAAYLLPFCFFWIAVIVLFVGRKSYVR--PPVGDKVIAKSFRVLGQLIKH----- 302
              G+W A+L+P   F I   VL V R+ Y++  PP G  +IA   +VL    +      
Sbjct: 249 RDVGYWLAFLIPLALFMIMPAVLLVLRR-YIKDEPPSGRSLIADCLKVLKVCFERNWWSR 307

Query: 303 -------------------RFDYEAVKPSVHPERDYPWNDHFVEEIKRALKACKVFMFYP 343
                              R  +   KP  +PE         V++ +  + AC +F++Y 
Sbjct: 308 YRAGTFWDYAKPSNLRSLGRQGWRKSKPGFYPE-------SLVQDARVTISACTIFLYYV 360

Query: 344 IYWVPYGQMTSTFVSVGGEMQLHGLPNDFFQAIDSIALIVFIPICEYWLYPFIRRYT-PF 402
           IY +  G + S   S    +   G+PND     + + +IVF+PI +  +YP +R+    F
Sbjct: 361 IYNINDGGIGSIMNSQTASLTSKGVPNDLMSNFNPLCIIVFMPILDRVVYPLLRKLRWNF 420

Query: 403 KPITKIFFGFMWCSASMIWAAVLQHFIYKTGPCYDHPMDCPNGPNNIHIGWQVPAYVLIA 462
           +P+ +IF GFM  + +    A++QH IY+T PC ++  +C  G + I +      Y L  
Sbjct: 421 RPVFRIFAGFMVAALASAVGAIIQHAIYQTSPCGNYATECEKGVSPISMWVVAIEYALTG 480

Query: 463 FSEIFASITGLEYAYSKAPTSMKSFIMSIFLLTNAFGSAIGCALSPVDTDPKYLWMFTGL 522
           FSE  A  TG E A+ ++P  MK+F+M++FL  +A  +A+G  ++P   DP  +  F  L
Sbjct: 481 FSECLAMTTGYEIAFERSPPHMKTFVMALFLFMSALSAALGEIVTPSLVDPHLVIPFGVL 540

Query: 523 A-VASFISGCLFWL--TFHHLNDTEE-EMNAMDYEEN 555
           A + + ++    W     HH+ + E  E  A+  +E 
Sbjct: 541 AGLGAAVAFAFLWRYWNLHHVMEQERIEREALAKQEE 577

>KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa]
           {ON} similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 626

 Score =  246 bits (627), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 167/576 (28%), Positives = 269/576 (46%), Gaps = 43/576 (7%)

Query: 46  EPTEEELRSLRHVGGHIPFRCWLIAIVELSERFSYYGLSAPFQNYMQN------------ 93
           EPTE E  +LR V  H  +  + I ++E SER SYYG      N++Q             
Sbjct: 36  EPTEHERTTLRRVLEHPKWYVYFICLIEFSERASYYGTGDRLNNFIQQPLPAGGNGAGAP 95

Query: 94  ----GKHDNPAGVLDLKSQGATGLAYFFQFWCYVTPVFGGWLADTYWGKYETICVGTGVY 149
                     AG L +  Q AT L     F  Y  P+  G++AD YW +   + +G  V 
Sbjct: 96  AHGAAGDSATAGALGMGLQTATALNLLLTFLAYCFPLVTGYIADRYWSRMRMLWIGVFVG 155

Query: 150 VVGIFILFITSLPSV-DSKNTALGGFITAIVLIGIATGMIKANLSVLIADQFXXXXXXXX 208
           ++   I  I +LP V  +   AL   +  I+ + IAT  +K  L   +  Q+        
Sbjct: 156 IISHVIFIIGALPPVLGNGQAALAPCVIGIITLAIATSFVKPVLLPTLLSQYPHETDVVR 215

Query: 209 XXXXGERVIEDPNITIQNVFMFFYLMINIGSLSVIATTELEEHKGFWAAYLLPFCFFWIA 268
               GERV+ D + ++Q + M FY  INIGS   +AT+      G+W A+L+P   + I 
Sbjct: 216 TLASGERVLVDRDASLQRMTMTFYWSINIGSFLSVATSYAARDIGYWLAFLIPLILYLIM 275

Query: 269 VIVLFV-GRKSYVRPPVGDKVIAKSFRVL------GQLIKHRFD--YEAVKPSVHPERDY 319
             VL V GR     PP G  ++A   +VL      G   ++R    +   +PS   +   
Sbjct: 276 PAVLLVLGRYLRDEPPSGRSMLADCCKVLRVCFERGWWRRYRSGDFWNYARPSRLRQAGR 335

Query: 320 P----------WNDHFVEEIKRALKACKVFMFYPIYWVPYGQMTSTFVSVGGEMQLHGLP 369
                      + +  V++ +  L A  +F++Y IY +  G + S   S    +  +G+P
Sbjct: 336 AGWRRKGAGGFYAESLVQDTRVTLSASAIFLYYVIYNINDGGIGSIMNSQTASLTSNGVP 395

Query: 370 NDFFQAIDSIALIVFIPICEYWLYPFIRRYT-PFKPITKIFFGFMWCSASMIWAAVLQHF 428
           ND     + + +IVF+P+ ++ LYP +R+    FKP+ +IF GFM  + +    A++Q  
Sbjct: 396 NDLISNFNPLCIIVFMPVLDHVLYPVLRKMRWNFKPVYRIFCGFMIAALASAVGAIIQTV 455

Query: 429 IYKTGPCYDHPMDCPNGPNNIHIGWQVPAYVLIAFSEIFASITGLEYAYSKAPTSMKSFI 488
           IY T PC  +  +C  G + + +      Y L   SE  A  TG E A+ ++P  MKSF+
Sbjct: 456 IYNTSPCGRYATECDKGVSPVSMWVVAVEYALTGLSECLAMTTGYEIAFERSPAHMKSFV 515

Query: 489 MSIFLLTNAFGSAIGCALSPVDTDPKYLWMFTGLA-VASFISGCLFWLTFHHLNDTEEEM 547
           M++FL T+A  +A+G  ++P   DP  +  F  LA + +F++    W  +  L+ T E  
Sbjct: 516 MALFLFTSALSAALGEIVTPSLVDPHLVIPFGVLAGLGAFMAFVFLW-RYWSLDKTMELE 574

Query: 548 NAMDYEENQEKIDDGLQKGTSDLEFEPAGADDKLDH 583
            A   E    + ++G     + +    +GA+D +DH
Sbjct: 575 RA---ERRALEAEEGAMPAITSVRSYVSGAED-VDH 606

>Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar to
           Ashbya gossypii AGL365C
          Length = 613

 Score =  237 bits (604), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 182/610 (29%), Positives = 282/610 (46%), Gaps = 59/610 (9%)

Query: 7   SITGPEKNKVIIEDKSLEVSGSHERGELDFDEYEVPNDDEPTEEELRSLRHVGGHIPFRC 66
           S  G   N   +++   EV    ER +++           PTEEE R+LR +  H  +  
Sbjct: 15  STLGSGSNAATVQEAPQEV---KERSDIEIGL--------PTEEEERTLRRIVVHPSWYV 63

Query: 67  WLIAIVELSERFSYYGLSAPFQNY--------------MQNGKHDNPAGVLDLKSQGATG 112
           +LI  +EL+ER SYYG      NY                +G   N +G L      AT 
Sbjct: 64  YLICFIELAERASYYGTGDRLNNYYTYPLPEGGNGAGATAHGSEAN-SGALGKGLATATS 122

Query: 113 LAYFFQFWCYVTPVFGGWLADTYWGKYETICVGTGVYVVGIFILFITSLPSV-DSKNTAL 171
           L    +F  Y  P+  G+L D Y G   T+  G    V    I  +++LP V    + A+
Sbjct: 123 LGLLLKFTSYFFPLVTGYLCDMYMGHVRTLWYGIWTGVASHIIFILSALPVVLKHPDAAM 182

Query: 172 GGFITAIVLIGIATGMIKANLSVLIADQFXXXXXXXXXXXXGERVIEDPNITIQNVFMFF 231
              +  ++ + + T  +K  L  L+  Q+            GERVI D + ++Q + M F
Sbjct: 183 ALSLIGLITLSVCTAFVKPVLLPLLLQQYPHETNVVKTLETGERVIIDRDASLQRMTMTF 242

Query: 232 YLMINIGSLSVIATTELEEHKGFWAAYLLPFCFFWIAVIVLFVGRKSYV--RPPVGDKVI 289
           Y  INIG+   +AT+   +  GFW A+L+P   + +A+ V+F   + ++  R P G  ++
Sbjct: 243 YWAINIGAFMSLATSYAAKEVGFWLAFLIPLIIY-MAMPVVFSLVQPHIKDRAPSGYSLL 301

Query: 290 AKSFRVL--------GQLIKHRFDYEAVKPSVHPE-------RDYP-WNDHFVEEIKRAL 333
           A   +VL            K    ++   PS   +       +  P + +  V++ K  L
Sbjct: 302 ADCMKVLYVAFGKGWNARRKEGVFWDYALPSNQRQMGKVGWRKKSPFYKESLVQDTKITL 361

Query: 334 KACKVFMFYPIYWVPYGQMTSTFVSVGGEMQLHGLPNDFFQAIDSIALIVFIPICEYWLY 393
            AC +F +Y IY +   Q+T+   S  G M  +G+PND     + +++IV IPI +Y LY
Sbjct: 362 SACFIFCYYIIYNMNDNQLTTIINSQTGSMTKNGVPNDVISNFNPLSIIVLIPILDYGLY 421

Query: 394 PFIRRYT-PFKPITKIFFGFMWCSASMIWAAVLQHFIYKTGPCYDHPMDCPNGPNNIH-- 450
           P +RR    FKP+ +IF GFM   AS +  A++Q  IY+T  C  H   C      +   
Sbjct: 422 PLLRRLRINFKPVYRIFTGFMLAVASSVAGALIQWRIYETSSCGYHATTCSEKGLGVSPL 481

Query: 451 IGWQVPA-YVLIAFSEIFASITGLEYAYSKAPTSMKSFIMSIFLLTNAFGSAIGCALSPV 509
             W V   Y L   SE  A  T  E AY ++P  MKSF++++FL T+A  +AI   ++P+
Sbjct: 482 SSWIVAVEYTLSGASECLAMTTAYEIAYDRSPEHMKSFVLALFLFTSAVSAAITQIVNPI 541

Query: 510 DTDPKYLWMFTGLAVASFISGCLFWLTFHHLNDTEEEMNAMDYEENQEKIDDGLQKGTSD 569
             DP  +  F   A   FISGC F   F +L   ++EM     +E +E+  + LQ+ +  
Sbjct: 542 LKDPLLIVPFALFAGIGFISGCHFLWKFRNL---DKEM----LQEKRER--ELLQESSES 592

Query: 570 LEFEPAGADD 579
            E E     D
Sbjct: 593 DELEVVEIKD 602

>AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON}
           NOHBY725; No homolog in Saccharomyces cerevisiae
          Length = 599

 Score =  236 bits (602), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 159/545 (29%), Positives = 256/545 (46%), Gaps = 39/545 (7%)

Query: 53  RSLRHVGGHIPFRCWLIAIVELSERFSYYGLSAPFQNYMQ-----------NGKHDNPAG 101
           + LRHV     +  ++I ++EL+ER SYYG      N+ Q            G  D   G
Sbjct: 44  KRLRHVVAAPKWTVYMICLIELAERASYYGTGDRLYNFFQYPLPQGGNGAGAGPDDQNPG 103

Query: 102 VLDLKSQGATGLAYFFQFWCYVTPVFGGWLADTYWGKYETICVGTGVYVVGIFILFITSL 161
            L    Q AT L    +F  Y  P+  G++AD Y G+ + + +G    VV   I  I +L
Sbjct: 104 ALGRGLQVATSLNLVLKFTSYFFPLVTGYVADMYVGELKMLWLGIWTGVVSHVIFVIAAL 163

Query: 162 PSV-DSKNTALGGFITAIVLIGIATGMIKANLSVLIADQFXXXXXXXXXXXXGERVIEDP 220
           P+V    N  +   +  ++ + + T  +K  L  ++  Q+            GERVI + 
Sbjct: 164 PAVIKHNNLCMALAVLGLLTLSLCTAFVKPVLLPMLLRQYPHETNVVKTLPTGERVILNR 223

Query: 221 NITIQNVFMFFYLMINIGSLSVIATTELEEHKGFWAAYLLPFCFFWIAVIVLFVGRKSYV 280
           + ++Q + M FY  IN+GS   +AT    +  G+W ++L+P   F I   +L   +   V
Sbjct: 224 DASLQRMSMTFYWCINVGSFVSLATGYSAQRVGYWLSFLIPLVLFLIMPAILLTLKNVKV 283

Query: 281 RPPVGDKVIAKSFRVL------GQLIKHRFD--YEAVKPSV---------HPERDYPWND 323
            PP+G+ + A+  +V+      G   ++R    +   KPS             ++  + +
Sbjct: 284 TPPLGESLFAECLKVIKVCFEPGWFKRYRSGSFWRYAKPSNLRALGRTGWRRSKEGFYKE 343

Query: 324 HFVEEIKRALKACKVFMFYPIYWVPYGQMTSTFVSVGGEMQLHGLPNDFFQAIDSIALIV 383
             VE+ +  L AC +F++Y IY +   Q++S   +  G M   G+PND     + +A+I+
Sbjct: 344 SLVEDTRITLAACVIFLYYVIYNMNDNQLSSIINNQAGSMTGEGVPNDVISNFNPLAIII 403

Query: 384 FIPICEYWLYPFIRRYT-PFKPITKIFFGFMWCSASMIWAAVLQHFIYKTGPCYDHPMDC 442
            +PI +Y L P +RR    FKP+ +IFFGFM    + +  A++Q  IY T PC  H   C
Sbjct: 404 TMPIIDYGLNPLLRRLRINFKPVYRIFFGFMLAVLASVAGAIIQAAIYNTSPCGKHASTC 463

Query: 443 PNGPNNIH--IGWQVPA-YVLIAFSEIFASITGLEYAYSKAPTSMKSFIMSIFLLTNAFG 499
                 +     W V   YVL   SE FA  TG E A+ ++P  MK+F+MS+FL+T A  
Sbjct: 464 SETIRQVSPLSRWLVGVEYVLSGVSECFAMPTGYEIAFERSPKDMKAFVMSLFLVTTALS 523

Query: 500 SAIGCALSPVDTDPKYLWMFTGLAVASFISGCLFWLTFHHLNDTEEEMNAMDYEENQEKI 559
           S +    + + TDP  +  F   AV   +   LF   + +L+        M+ E  +  I
Sbjct: 524 SILTQIFNGIMTDPYLVIPFILFAVLGTLFAILFLYRYWNLDKV------MEAERRERAI 577

Query: 560 DDGLQ 564
            D L+
Sbjct: 578 LDPLE 582

>AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKR093W (PTR2)
          Length = 576

 Score =  192 bits (489), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 154/580 (26%), Positives = 260/580 (44%), Gaps = 58/580 (10%)

Query: 12  EKNKVIIEDKSLEVSGSHERGELDFDEYEVPNDDEPTEEELRSLRHVGGHIPFRCWLIAI 71
           EK K I E ++L++                     PTE E  +LR +        + I +
Sbjct: 17  EKEKYITETETLQI---------------------PTEHEELTLRRIVTSPKIHLYFICL 55

Query: 72  VELSERFSYYGLSAPFQNYMQ------------NGKHDNPAGVLDLKSQGATGLAYFFQF 119
           +E +ER S+YG      N+ Q             G  +   G L      AT +    +F
Sbjct: 56  IEFAERGSFYGTGNRMGNFYQYPLPIGGNGAGAPGPGEQDPGALGKGLAVATAMGLLLKF 115

Query: 120 WCYVTPVFGGWLADTYWGKYETICVGTGVYVVGIFILFITSLPSVDS-KNTALGGFITAI 178
             Y   +  G+++D Y G+ + + +G  + V    +  I +LPSV +  N A    + A+
Sbjct: 116 TSYTFSIITGYISDVYIGQIKMLWIGVWLGVGSHILFIIAALPSVLAHTNVAYALSVVAL 175

Query: 179 VLIGIATGMIKANLSVLIADQFXXXXXXXXXXXXGERVIEDPNITIQNVFMFFYLMINIG 238
           + + + T  +K  L  L+  Q+            GERVI D + ++Q + M FY  IN+G
Sbjct: 176 LSLSLCTSFVKPVLLPLLLQQYPYKTNIVKTLLSGERVIVDRDASLQRMTMVFYWAINVG 235

Query: 239 SLSVIATTELEEHKGFWAAYLLPFCFFWIAVIVLFVGRKSY-VRPPVGDKVIAKSFRVLG 297
           +   +AT    +  G+W A+ +P   + +  IVL+  ++      P  + V+A+S +VL 
Sbjct: 236 AFLSLATAYSAQRVGYWLAFTVPLIIYLLMPIVLWKLQEDIKTNEPSRESVLAESLKVLK 295

Query: 298 QL-----IKHRFD---YEAVKPSV---------HPERDYPWNDHFVEEIKRALKACKVFM 340
                  IK  +    ++  KP+            ++   +++ +V + K  + AC +F+
Sbjct: 296 VCYEWGWIKRYWSGQFWDYAKPTNLIQQGRIGWRKKKAGFYDEKYVYDTKLTISACTIFL 355

Query: 341 FYPIYWVPYGQMTSTFVSVGGEMQLHGLPNDFFQAIDSIALIVFIPICEYWLYPFIRRYT 400
           +Y IY + +  +     S  G M+  G+PND F   + I++IV +PI +Y LYP +RRY 
Sbjct: 356 YYVIYQM-HSNLDEPMRSQAGSMEGEGVPNDLFSNFNPISIIVVMPILDYVLYPLLRRYR 414

Query: 401 -PFKPITKIFFGFMWCSASMIWAAVLQHFIYKTGPC-YDHPMDCP--NGPNNIHIGWQVP 456
             FKP+ +IF GFM         A++Q  +Y T PC Y     CP  +   +    W V 
Sbjct: 415 INFKPVYRIFCGFMIGCLGSTVGAIIQWRVYNTSPCGYMGATTCPELHHKKSPLSRWLVA 474

Query: 457 -AYVLIAFSEIFASITGLEYAYSKAPTSMKSFIMSIFLLTNAFGSAIGCALSPVDTDPKY 515
             Y L   SE  A  TG E A+ ++P  MK F++++F+ T A  SAI   ++P   DP  
Sbjct: 475 IEYALGGTSECLAMTTGYEIAFERSPKKMKGFVLALFMFTVAISSAIILPITPFFKDPYL 534

Query: 516 LWMFTGLAVASFISGCLFWLTFHHLNDTEEEMNAMDYEEN 555
           +  F   A    ++  +F   +  L+   +    +   EN
Sbjct: 535 IQPFAVCAGVGALTAIIFLWRYWDLDKQMKLERELSSPEN 574

>ADL156C Chr4 complement(416054..417505) [1452 bp, 483 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL119C
           (MCH4); Tandem gene duplication in this genome
          Length = 483

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 70/171 (40%), Gaps = 29/171 (16%)

Query: 40  EVPNDDEPTEEELRSLRHVGGHIP---FRCWLIAIVELSERFSYYGLS---APFQNYMQN 93
           EV   DE    E  +   V    P   +R WL  +      F  +G +     ++ Y+ N
Sbjct: 49  EVLAADEKAATEATNELDVEEEYPDGGYRAWLTVLGSFVGIFPIWGTANALGAYEGYISN 108

Query: 94  GKHDNPAGVLDLKSQGATGLAYFFQF---WCYVTPVFGGWLADTYWGKYETICVGTGVYV 150
            +         L S GA  +++ F      C+V  VF G   D   G+ + I VG+ +YV
Sbjct: 109 HQ---------LASSGAGEVSWIFALHMIACFVGCVFSGSYFDRNGGQ-KAIIVGSVLYV 158

Query: 151 VGIFILFITSLPSVDSKNTALGGFITAIVL-IGIATGMIKANLSVLIADQF 200
            GIF++         S+ T L  FI A  L  G+  G++   L   +A  F
Sbjct: 159 FGIFMM---------SECTKLWHFILAFSLSSGVGAGILTTPLISCVATWF 200

>TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 49/110 (44%), Gaps = 9/110 (8%)

Query: 89  NYMQNGKHDNPAGVLDLKSQGATGLAYFFQFWCYVTPVFGGWLADTYWGKYETICVGTGV 148
           +++Q     N  GVL L +     L   F   C +  VF G L D Y G+   +  GT +
Sbjct: 102 DFIQRFGTKNEDGVLYLSTIRMGLLVSIFNIGCAIGSVFLGKLGDLY-GRRWGLIFGTSI 160

Query: 149 YVVGIFILFITSLPSVDSKNTALGGFITAIVLIGIATGMIKANLSVLIAD 198
           +VVG+ I        + S +     FI  I+  GI  G+I     +LI++
Sbjct: 161 FVVGVII-------QIASVSKWFQYFIGRIIA-GIGMGVIAVLSPMLISE 202

>ZYRO0G18700g Chr7 (1542876..1544651) [1776 bp, 591 aa] {ON} similar
           to uniprot|P36029 Saccharomyces cerevisiae YKL174C TPO5
           Protein involved in excretion of putrescine and
           spermidine putative polyamine transporter in the Golgi
           or post-Golgi vesicles
          Length = 591

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 40/188 (21%), Positives = 75/188 (39%), Gaps = 37/188 (19%)

Query: 116 FFQFWCYVTPVFGGWLADTYWGKYETICVGTGVYVVGIFILFITSLPSVDSKNTALGGFI 175
           +++ W YV P      +++   KY  +   +  Y++G+  LF          N A   FI
Sbjct: 383 YYRLWTYVDPQ-----SESRVPKYSILLSMSISYILGLLPLF---------SNAAFNAFI 428

Query: 176 TAIVLIGIATGMIKANLSVLIADQFXXXXXXXXXXXXGERVIEDPNITIQ-------NVF 228
              VL   +  +I   L VL+  +               RV+++  + I+       N+ 
Sbjct: 429 GCAVLCLCSATLIPL-LLVLVTRR---------------RVLKNAPVKIKYKLGWIANIG 472

Query: 229 MFFYLMINIGSLSVIATTELEEHKGFWAAYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKV 288
              +L++++ S+ +     +      +A  +  FCFF I ++    GRK +  P V    
Sbjct: 473 SVCWLLLSMFSVCLPPQIPVTAKTMNYALLVFLFCFFIICILYYKWGRKHFQLPQVDKAS 532

Query: 289 IAKSFRVL 296
           IA+    L
Sbjct: 533 IAEEMSTL 540

>KAFR0A08260 Chr1 complement(1656030..1658867) [2838 bp, 945 aa]
           {ON} Anc_3.73 YNL287W
          Length = 945

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 6/62 (9%)

Query: 543 TEEEMNAMDYEENQEKIDDGLQKGTSD------LEFEPAGADDKLDHIGSHGATGFRHDG 596
           TE+E+ AMD +  QE++ +   +G+ +      LE   +  + +LD    HGA+  +H  
Sbjct: 616 TEDEVKAMDLKRKQEQVFNNTSEGSRETPIDMSLESTTSIKEQRLDTETYHGASLDQHQE 675

Query: 597 EL 598
           EL
Sbjct: 676 EL 677

>Suva_2.730 Chr2 (1271371..1273059) [1689 bp, 562 aa] {ON} YDR536W
           (REAL)
          Length = 562

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 57/127 (44%), Gaps = 17/127 (13%)

Query: 68  LIAIVELSERFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATGLAYFFQFWCYVTPVF 127
           L+A +   ++F+Y      F    +NG HD  A V+    QGAT   Y  +  C+   +F
Sbjct: 48  LMASLITGKQFNY-----EFPATKENGDHDRHATVV----QGATTSCY--ELGCFAGSLF 96

Query: 128 GGWLADTYWGKYETICVGTGVYVVGIFILFITSLPSVDSKNTALGGFITAIVLIGIATGM 187
             +  +   G+   I +G+ + +VG      T   S      ALG FI   V+ G+ TG+
Sbjct: 97  VMFYGERI-GRKPLILMGSIITIVGA-----TISTSAFRDYWALGQFIIGRVVTGVGTGL 150

Query: 188 IKANLSV 194
             + + V
Sbjct: 151 NTSTIPV 157

>NDAI0F01930 Chr6 (467932..469626) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 1/67 (1%)

Query: 89  NYMQNGKHDNPAGVLDLKSQGATGLAYFFQFWCYVTPVFGGWLADTYWGKYETICVGTGV 148
           +Y+      +P+G   +       L   F   C +  VF G L D+  G+ + I VG  +
Sbjct: 88  DYINRFGSTHPSGTKYMSKVRTGLLVSIFNVGCAIGSVFLGRLGDSI-GRRKGIVVGASI 146

Query: 149 YVVGIFI 155
           Y+VGI I
Sbjct: 147 YIVGIVI 153

>TDEL0F01350 Chr6 (241090..241512) [423 bp, 140 aa] {ON} Anc_2.181
           YOR103C
          Length = 140

 Score = 30.8 bits (68), Expect = 5.4,   Method: Composition-based stats.
 Identities = 27/112 (24%), Positives = 50/112 (44%), Gaps = 13/112 (11%)

Query: 74  LSERFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATGLAYFFQFWCYVTPVFGGWLAD 133
           +S+ FS    +   ++Y+   K DN   ++D+          F      V  VF   + D
Sbjct: 29  ISKDFSD-AFNVSLESYLSQVKKDNRLKLIDI-------FCVFLVAIALVQTVFMAMIRD 80

Query: 134 TY----WGKYETICVGTGVYVVGIFILFITSLPSVDSKNTALGGFITAIVLI 181
           T+    +     +CVG  V ++ + +  + S P + SKN A G F+ A +++
Sbjct: 81  TFPFNAFLAGFIVCVGQFVLLISLRLQIVDSFPGI-SKNRAFGEFVLASLVL 131

>Skud_4.809 Chr4 (1427842..1429548) [1707 bp, 568 aa] {ON} YDR536W
           (REAL)
          Length = 568

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 61/128 (47%), Gaps = 19/128 (14%)

Query: 68  LIAIVELSERFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATGLAYFFQFWCYVTPVF 127
           L+A +   ++F+Y      F    +NG+HD  A V+    QGAT   Y  +  C+   +F
Sbjct: 48  LMASLITGKQFNY-----EFPATKENGEHDRHATVV----QGATTSCY--ELGCFAGSLF 96

Query: 128 GGWLADTYWGKYETICVGTGVYVVGIFILFITSLPSVDSKNT-ALGGFITAIVLIGIATG 186
             +  +   G+   I +G+ + ++G       ++ +   ++  ALG FI   V+ G+ TG
Sbjct: 97  VMFYGEKI-GRKPLILMGSIITIIG------ATISTCAFRDYWALGQFIIGRVVTGVGTG 149

Query: 187 MIKANLSV 194
           +  + + V
Sbjct: 150 LNTSTIPV 157

>ADL155C Chr4 complement(418382..419842) [1461 bp, 486 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL119C
           (MCH4); Tandem gene duplication in this genome
          Length = 486

 Score = 31.2 bits (69), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 64/170 (37%), Gaps = 23/170 (13%)

Query: 38  EYEVPNDDEPTEEELRSLRHVGGHIP---FRCWLIAIVELSERFSYYGLSAPFQNYMQNG 94
           +  VP  DE  EEE R+        P    R WL+        F  +G+      Y   G
Sbjct: 50  QQTVPLSDEKVEEEERAYLDNSNEYPDGGLRAWLVVFGSFMGLFPVWGM------YNTLG 103

Query: 95  KHDNPAGVLDLKSQGATGLAYFFQFWCYV---TPVFGGWLADTYWGKYETICVGTGVYVV 151
             +       L S     +++ F     +     VF G   D   G+ + I VG  +YV 
Sbjct: 104 AIEGYVSEHQLASNSTLEISWIFSLHLTIGCLCCVFSGSYFDRNGGQ-KAIIVGGALYVF 162

Query: 152 GIFILFITSLPSVDSKNTALGGFITAI-VLIGIATGMIKANLSVLIADQF 200
           GIF++         S+ T +  F+ +  V  GI  G++   L   +A  F
Sbjct: 163 GIFMM---------SECTKVWQFVLSFSVSSGIGAGIVTTPLVSCVATWF 203

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.141    0.451 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 66,890,419
Number of extensions: 3004398
Number of successful extensions: 8342
Number of sequences better than 10.0: 42
Number of HSP's gapped: 8510
Number of HSP's successfully gapped: 44
Length of query: 613
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 497
Effective length of database: 40,180,143
Effective search space: 19969531071
Effective search space used: 19969531071
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 69 (31.2 bits)