Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0G06666g5.699ON50348423590.0
TDEL0B022205.699ON48948711651e-155
Smik_9.235.699ON5275287333e-90
YIL146C (ATG32)5.699ON5295117072e-86
Skud_9.225.699ON5375127031e-85
Suva_9.435.699ON5133126234e-74
SAKL0E14850g5.699ON4705015752e-67
KLTH0E01122g5.699ON4725045299e-61
Kwal_55.197165.699ON4674955192e-59
KAFR0D022505.699ON5565514516e-49
Ecym_40215.699ON4595034381e-47
KNAG0L021005.699ON4444984361e-47
CAGL0H06545g5.699ON4922184302e-46
AFR283W5.699ON4523994054e-43
TBLA0E020905.699ON7491533459e-34
NCAS0G002605.699ON5103193362e-33
KLLA0A00660g5.699ON5245213213e-31
Kpol_2001.735.699ON4111251322e-07
NOTE: 1 genes in the same pillar as ZYRO0G06666g were not hit in these BLAST results
LIST: TPHA0D04580

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0G06666g
         (503 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {...   913   0.0  
TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {O...   453   e-155
Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON} Y...   286   3e-90
YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}  AT...   276   2e-86
Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON} Y...   275   1e-85
Suva_9.43 Chr9 complement(68866..68940,68994..69068,69093..69122...   244   4e-74
SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} simi...   226   2e-67
KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {...   208   9e-61
Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON...   204   2e-59
KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {O...   178   6e-49
Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON} s...   173   1e-47
KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5....   172   1e-47
CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} simila...   170   2e-46
AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic ho...   160   4e-43
TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.6...   137   9e-34
NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}...   134   2e-33
KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON...   128   3e-31
Kpol_2001.73 s2001 (199741..200976) [1236 bp, 411 aa] {ON} (1997...    55   2e-07

>ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {ON}
           similar to uniprot|P40458 Saccharomyces cerevisiae
           YIL146C ECM37 Non-essential protein of unknown function
          Length = 503

 Score =  913 bits (2359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/484 (92%), Positives = 446/484 (92%)

Query: 20  DIERRSILDPHLSVLELLRRPSDTRPHEALKGEVSDIVGNCAXXXXXXNGSISQSWQTIH 79
           DIERRSILDPHLSVLELLRRPSDTRPHEALKGEVSDIVGNCA      NGSISQSWQTIH
Sbjct: 20  DIERRSILDPHLSVLELLRRPSDTRPHEALKGEVSDIVGNCAGTTGTGNGSISQSWQTIH 79

Query: 80  RNDSCLSVVPERCPSQATAAGILSSSDTSEDEPDAVNSPSAVHQQLHATPPQKHTKSLED 139
           RNDSCLSVVPERCPSQATAAGILSSSDTSEDEPDAVNSPSAVHQQLHATPPQKHTKSLED
Sbjct: 80  RNDSCLSVVPERCPSQATAAGILSSSDTSEDEPDAVNSPSAVHQQLHATPPQKHTKSLED 139

Query: 140 YRSLNVGIPLVLPEDXXXXXXXXXXXXXXXXXXEEDDNDTITKSLNSSSNSFIMPKLSLS 199
           YRSLNVGIPLVLPED                  EEDDNDTITKSLNSSSNSFIMPKLSLS
Sbjct: 140 YRSLNVGIPLVLPEDSNNINNNNKNGSTTGSNGEEDDNDTITKSLNSSSNSFIMPKLSLS 199

Query: 200 QKTQKFRILVLGRPGLKFYHSIPKKYQHMFELPRSHDPAEFKQYTGILVVFQELKEMVSL 259
           QKTQKFRILVLGRPGLKFYHSIPKKYQHMFELPRSHDPAEFKQYTGILVVFQELKEMVSL
Sbjct: 200 QKTQKFRILVLGRPGLKFYHSIPKKYQHMFELPRSHDPAEFKQYTGILVVFQELKEMVSL 259

Query: 260 LNRVCQCNPNRPVIPVCQSGQRQQVRNLLESLLKNRLVSLLYPPVVVNNQPDLLGMFRFL 319
           LNRVCQCNPNRPVIPVCQSGQRQQVRNLLESLLKNRLVSLLYPPVVVNNQPDLLGMFRFL
Sbjct: 260 LNRVCQCNPNRPVIPVCQSGQRQQVRNLLESLLKNRLVSLLYPPVVVNNQPDLLGMFRFL 319

Query: 320 QELSKTVSDNSDMDAEEPNNGXXXXXXXXXXXXXXFIETSAERNGRPHKKRHNNEKVNRW 379
           QELSKTVSDNSDMDAEEPNNG              FIETSAERNGRPHKKRHNNEKVNRW
Sbjct: 320 QELSKTVSDNSDMDAEEPNNGSKRLKRSLQRKKKKFIETSAERNGRPHKKRHNNEKVNRW 379

Query: 380 VLWGVSLTLGVGVGYCISHLVSSTWISLTTNPLGPVDPESVSKDLFVFDRQELKLGEMDM 439
           VLWGVSLTLGVGVGYCISHLVSSTWISLTTNPLGPVDPESVSKDLFVFDRQELKLGEMDM
Sbjct: 380 VLWGVSLTLGVGVGYCISHLVSSTWISLTTNPLGPVDPESVSKDLFVFDRQELKLGEMDM 439

Query: 440 DSDHPFGHALFLFKQALKQWNLAVKQFLGRHLSCMERIGPANCLEWPTSDEHTNRVLALG 499
           DSDHPFGHALFLFKQALKQWNLAVKQFLGRHLSCMERIGPANCLEWPTSDEHTNRVLALG
Sbjct: 440 DSDHPFGHALFLFKQALKQWNLAVKQFLGRHLSCMERIGPANCLEWPTSDEHTNRVLALG 499

Query: 500 YVML 503
           YVML
Sbjct: 500 YVML 503

>TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {ON}
           Anc_5.699 YIL146C
          Length = 489

 Score =  453 bits (1165), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 249/487 (51%), Positives = 324/487 (66%), Gaps = 27/487 (5%)

Query: 21  IERRSILDPHLSVLELLRRPSDTRPHEALKG-EVSDIVGNCAXXXXXXNGSISQSWQTIH 79
            E++S+LDPHLSVLELL R  DT+     +G E +D + N          SIS SWQ IH
Sbjct: 26  FEKKSLLDPHLSVLELLERTGDTQ--RVGRGVEKADDMANTT-------NSISSSWQAIH 76

Query: 80  RNDSCLSVVPERCPSQATAAGILSSSDTSEDEPDAVNSPSAVH-QQLHAT--PPQKHTKS 136
           RND+ ++ VPERC SQA A GILSSSDTSE+E D  +SP+  H  Q H +  PP+   K 
Sbjct: 77  RNDAMITGVPERCSSQAAAVGILSSSDTSEEEIDPASSPNVAHFTQFHQSQQPPRLPFK- 135

Query: 137 LEDYRSLNVGIPLVLPEDXXXXXXXXXXXXXXXXXXEEDDNDTITKSLNSSSNSFIMPKL 196
                   + +P++LP                    +E D++T+TKSL++SSNSF+MPKL
Sbjct: 136 --------LDVPVILP----ARDQEPSGQTQTPDNDDERDDETLTKSLSNSSNSFVMPKL 183

Query: 197 SLSQKTQKFRILVLGRPGLKFYHSIPKKYQHMFELPRSHDPAEFKQYTGILVVFQELKEM 256
           SLSQK+ K RIL+LGRPGLKFY SIPK+YQH FEL R  DP+EF+Q+TGIL+VFQELKEM
Sbjct: 184 SLSQKSHKLRILILGRPGLKFYQSIPKRYQHFFELSRLQDPSEFRQFTGILIVFQELKEM 243

Query: 257 VSLLNRVCQCNPNRPVIPVCQSGQRQQVRNLLESLLKNRLVSLLYPPVVVNNQPDLLGMF 316
           VSLLNRVCQC P RPVIPVCQ+GQ QQVRN+LESLLK++L+SLLYPPVV++N  DL  M+
Sbjct: 244 VSLLNRVCQCAPTRPVIPVCQTGQHQQVRNVLESLLKSKLISLLYPPVVISNHSDLNNMY 303

Query: 317 RFLQELSKTVSDNSDMDAEEPNNGXXXXXXXXXXXXXXFIETSAERNGRPHKKRHNNEKV 376
           RFL +LSKT+SDNS+ D +E                      S ++  +P K+R    K+
Sbjct: 304 RFLLDLSKTISDNSEDDEDEEERELLDKKIKKSHQRKKKRAGSYDKTDKPRKRRSKETKI 363

Query: 377 NRWVLWGVSLTLGVGVGYCISHLVSSTWISLTTNPLGPVDPESVSKDLFVFDRQELKLGE 436
           N+W++WG+SLT+GVGVGYC+S+  SS  IS++   +  ++    + ++ VFD   L +GE
Sbjct: 364 NKWIVWGISLTVGVGVGYCMSYFASSGLISMSAKSIASINGCRPNDNVVVFDDSSLGMGE 423

Query: 437 MDMDSDHPFGHALFLFKQALKQWNLAVKQFLGRHLSCMERIGPANCLEWPTSDEHTNRVL 496
            D D ++PF HAL+L KQ LKQWN A+KQFL +HL   E     N  EW   D ++NRVL
Sbjct: 424 YDHDLENPFAHALYLLKQTLKQWNWAMKQFLMKHLHLPESSSSTNYKEWGAED-NSNRVL 482

Query: 497 ALGYVML 503
           ALGY++L
Sbjct: 483 ALGYILL 489

>Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON}
           YIL146C (REAL)
          Length = 527

 Score =  286 bits (733), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 194/528 (36%), Positives = 279/528 (52%), Gaps = 83/528 (15%)

Query: 22  ERRSILDPHLSVLELLRRPSDTRPHEALKGEVS--DIVGNCAXXXXXXNGSISQSWQTIH 79
           E R +LDPHLSVLELL +   + P    +  V+  DI G+        N SIS SWQ I 
Sbjct: 37  EDRGLLDPHLSVLELLGKTGHS-PSPMGQSLVTSIDISGH-----QNVNDSISGSWQAIQ 90

Query: 80  RNDSCLSVVPERCPSQATAAGILSSSDTSEDEPDAVNSPSA-----VHQQLHATPPQKHT 134
             D   S +PERC SQ T   ILSSSDTSE+E + + +P+A     + Q    T     T
Sbjct: 91  PLDLGASFIPERCSSQTTNGSILSSSDTSEEEQELLQAPAADIINIIKQGQEGT---NVT 147

Query: 135 KSLEDYRSLNVGIPLVLPEDXXXXXXXXXXXXXXXXXXEEDDNDTITKSLNSSSNSFIMP 194
            S   +R L+  I L +P                    EED + TITKSL SS+NSF+MP
Sbjct: 148 SSSHPFRQLHKVISLPIPSREKTPYKEQDINDDEDGAYEED-SVTITKSLTSSTNSFVMP 206

Query: 195 KLSLSQKTQKFRILVLGRPGLKFYHSIPKKYQHMFELPRSHDPAEFKQYTGILVVFQELK 254
           KLSLSQK   FR+L+LGR G  FY SIPK+YQ +FELP+ HD A F QYTGI+++FQEL+
Sbjct: 207 KLSLSQKNPVFRLLILGRTGSNFYQSIPKEYQSLFELPKYHDSATFPQYTGIIIIFQELR 266

Query: 255 EMVSLLNRVCQCNPNRPVIPVCQSGQRQQVRNLLESLLKNRLVSLLYPPVVVNNQPDLLG 314
           EMVSLLNR+ Q +  +P+IP+CQ GQ  QV+N+L+S L+N+L+ LL+PPVVV N+ DL  
Sbjct: 267 EMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKLLFPPVVVTNRKDLKK 326

Query: 315 MFRFLQELSKTVSDNSDMDAEEPNNGXXXXXXXXXXXXXXFIETSAERNGRPHKKRHNNE 374
           MF+ LQ+LS   +++ + + ++                    ET+  R+   +KK +N++
Sbjct: 327 MFQRLQDLSLEYAEDENEEGDD-------------------DETTKSRSYYRYKKANNSK 367

Query: 375 K----------------VNRWVLWGVSLTLGVGVGYCISHLVSSTW-------------- 404
           +                   W  WG+S+T+G+  G C+++ V++ +              
Sbjct: 368 RKSPKSNKKPKKKKQRFFTSWFTWGISITIGISFGCCVTYFVTAAYDHQTVKSLSLRSSL 427

Query: 405 ---------ISLTTNPLGPVDPESVSKDLFVFDRQELKLGEMDMDSDHPFGHALFLFKQA 455
                     S T N      P S S+    FD+  L   +++   D     +L + K+ 
Sbjct: 428 LTSMLSLDSSSDTVNTPATASPSS-SEHFLWFDKGTL---QINFHLDGLIMKSLSVIKET 483

Query: 456 LKQWNLAVKQFLGRHLSCMERIGPANCLEWPTSDEHTNRVLALGYVML 503
             + N  V   L R LS +E +  ++      S + +NR+LALGY++L
Sbjct: 484 WVKMNDFVLHALSRPLSFLENLNRSSDF----SIDESNRILALGYILL 527

>YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}
           ATG32Mitochondrial outer membrane protein required to
           initiate mitophagy; recruits the autophagy adaptor
           protein Atg11p and the ubiquitin-like protein Atg8p to
           the mitochondrial surface to initiate mitophagy, the
           selective vacuolar degradation of mitochondria in
           response to starvation; can promote pexophagy when
           placed ectopically in the peroxisomal membrane
          Length = 529

 Score =  276 bits (707), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 191/511 (37%), Positives = 276/511 (54%), Gaps = 47/511 (9%)

Query: 22  ERRSILDPHLSVLELLRRPSDTRPHEALKGEVS--DIVGNCAXXXXXXNGSISQSWQTIH 79
           E + +LDPHLSVLELL +   + P    +  V+  DI GN        N SIS SWQ I 
Sbjct: 37  EDKGLLDPHLSVLELLSKTGHS-PSPMGQNLVTSIDISGN-----HNVNDSISGSWQAIQ 90

Query: 80  RNDSCLSVVPERCPSQATAAGILSSSDTSEDEPDAVNSPSA--VHQQLHATPPQKHTKSL 137
             D   S +PERC SQ T   ILSSSDTSE+E + + +P+A  ++               
Sbjct: 91  PLDLGASFIPERCSSQTTNGSILSSSDTSEEEQELLQAPAADIINIIKQGQEGANVVSPS 150

Query: 138 EDYRSLNVGIPLVLPEDXXXXXXXXXXXXXXXXXXEEDDNDTITKSLNSSSNSFIMPKLS 197
             ++ L   I L LP                     E+D+ TITKSL SS+NSF+MPKLS
Sbjct: 151 HPFKQLQKIISLPLP-GKEKTPFNEQDDDGDEDEAFEEDSVTITKSLTSSTNSFVMPKLS 209

Query: 198 LSQKTQKFRILVLGRPGLKFYHSIPKKYQHMFELPRSHDPAEFKQYTGILVVFQELKEMV 257
           L+QK   FR+L+LGR G  FY SIPK+YQ +FELP+ HD A F QYTGI+++FQEL+EMV
Sbjct: 210 LTQKNPVFRLLILGRTGSSFYQSIPKEYQSLFELPKYHDSATFPQYTGIVIIFQELREMV 269

Query: 258 SLLNRVCQCNPNRPVIPVCQSGQRQQVRNLLESLLKNRLVSLLYPPVVVNNQPDLLGMFR 317
           SLLNR+ Q +  +PVIP+CQ GQ  QV+N+L+S L+N+LV LL+PPVVV N+ DL  MF+
Sbjct: 270 SLLNRIVQYSQGKPVIPICQPGQVIQVKNVLKSFLRNKLVKLLFPPVVVTNKRDLKKMFQ 329

Query: 318 FLQELSKTVSDNSDMDAEEPNNGXXXXXXXXXXXXXXFIETSAERNGRPHKKRHNNEK-- 375
            LQ+LS    ++ +   EE N+                 E S +++ + +KK    ++  
Sbjct: 330 RLQDLSLEYGEDVN---EEDNDDEAIHTKSRSYCRNKKAENSKKKSPKSNKKPKRKKQKF 386

Query: 376 VNRWVLWGVSLTLGVGVGYCISHLVSSTW-------ISL----------------TTNPL 412
              W  WG+S+T+G+  G C+++ V++ +       +SL                T N  
Sbjct: 387 FTSWFTWGISITIGISFGCCVTYFVTAAYEHQTVKSLSLRPSILASLLSLDSSSDTINTP 446

Query: 413 GPVDPESVSKDLFVFDRQELKLGEMDMDSDHPFGHALFLFKQALKQWNLAVKQFLGRHLS 472
               P S  + L+ FD+  L   +++  SD     +L + K+   + N  V   L + L 
Sbjct: 447 ATASPSSTEQFLW-FDKGTL---QINFHSDGFIMKSLTIIKETWGKMNTFVLHALSKPLK 502

Query: 473 CMERIGPANCLEWPTSDEHTNRVLALGYVML 503
            +E +  ++      S + +NR+LALGY++L
Sbjct: 503 FLENLNKSSEF----SIDESNRILALGYILL 529

>Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON}
           YIL146C (REAL)
          Length = 537

 Score =  275 bits (703), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 185/512 (36%), Positives = 268/512 (52%), Gaps = 41/512 (8%)

Query: 22  ERRSILDPHLSVLELLRRPSDTRPHEALKGEVSDIVGNCAXXXXXXNGSISQSWQTIHRN 81
           E + +LDPHLSVLELL +   + P       V+ I           N SIS SWQ IH  
Sbjct: 37  EDKGLLDPHLSVLELLGKTGHS-PSPMGHSLVTSI---DISSHHYVNDSISGSWQAIHPL 92

Query: 82  DSCLSVVPERCPSQATAAGILSSSDTSEDEPDAVNSPSA--VHQQLHATPPQKHTKSLED 139
           D   S VPER  SQ T   ILSSSDTSE+E + + +P+A  ++           T     
Sbjct: 93  DLGASFVPERSSSQTTNGSILSSSDTSEEEQELLQAPAADIINIIKQGQEGASVTSPSRP 152

Query: 140 YRSLNVGIPLVLPEDXXXXXXXXXXXXXXXXX-----XEEDDNDTITKSLNSSSNSFIMP 194
           +R L+  I L LP                          E+D+ TITKSL SS+NSF+MP
Sbjct: 153 FRQLHKVISLPLPAKGRTSYGEQDDDDNNVDDDYDDGAYEEDSGTITKSLTSSTNSFVMP 212

Query: 195 KLSLSQKTQKFRILVLGRPGLKFYHSIPKKYQHMFELPRSHDPAEFKQYTGILVVFQELK 254
           KLSLSQK   FR+L+LGR G  FY SIPK++Q +FELP+ HD   F QYTGI+++FQEL+
Sbjct: 213 KLSLSQKNPVFRLLILGRTGSNFYQSIPKEHQSLFELPKYHDSTAFPQYTGIIIIFQELR 272

Query: 255 EMVSLLNRVCQCNPNRPVIPVCQSGQRQQVRNLLESLLKNRLVSLLYPPVVVNNQPDLLG 314
           EMVSLLNR+ Q +  +P+IP+CQ GQ  QV+N+L+S L+N+L+ LLYPPVVV N+ DL  
Sbjct: 273 EMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKLLYPPVVVTNRRDLKK 332

Query: 315 MFRFLQELSKTVSDNSDMDAEEPNNGXXXXXXXXXXXXXXFIETSAERNGRPHKKRHNNE 374
           MF+ LQ+LS   +++ D D E+ ++                  +  +      K +   +
Sbjct: 333 MFQRLQDLSLEYAEDGDNDDEDNDDEIIHTNSRSYYRNKKANSSKKKSFKSNKKPKKKKQ 392

Query: 375 K-VNRWVLWGVSLTLGVGVGYCISHLVSSTWISLTTNPLG-------------------- 413
           + + RW  WGVS+T+G+  G C+++  ++ +   T                         
Sbjct: 393 RSLTRWFTWGVSITIGISFGCCVTYFATAAYDHQTGKSFNLRSSILTSLLSLDSYHDTVN 452

Query: 414 -PVDPESVSKDLFV-FDRQELKLGEMDMDSDHPFGHALFLFKQALKQWNLAVKQFLGRHL 471
            P    + S + F+ FD+  L   +++  SD     +L + K    + N+ V   L R L
Sbjct: 453 TPATTSTSSGEQFLWFDKGTL---QINFHSDGFIMKSLTVIKDTWSKMNVFVLNALSRPL 509

Query: 472 SCMERIGPANCLEWPTSDEHTNRVLALGYVML 503
           + +E +   +      S + +NR+LALGY++L
Sbjct: 510 NFLENLNKNSDF----SLDESNRILALGYILL 537

>Suva_9.43 Chr9
           complement(68866..68940,68994..69068,69093..69122,
           69126..70484) [1539 bp, 513 aa] {ON} YIL146C (REAL)
          Length = 513

 Score =  244 bits (623), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 145/312 (46%), Positives = 190/312 (60%), Gaps = 18/312 (5%)

Query: 22  ERRSILDPHLSVLELLRRPSDTRPHEALKGEVSDI-VGNCAXXXXXXNGSISQSWQTIHR 80
           E + +LDPHLSVLELL + + + P    +  V+ I + N          +IS SWQTI  
Sbjct: 37  EDKGLLDPHLSVLELLGK-TGSSPSPLGQSLVTSIDISNHHNVI----DNISGSWQTIQP 91

Query: 81  NDSCLSVVPERCPSQATAAGILSSSDTSEDEPDAVNSPSA-----VHQQLHATPPQKHTK 135
            D   S +PERC SQ T   ILSSSDTSE+E D + +P+A     + Q    T     T 
Sbjct: 92  LDLGASFIPERCSSQTTNGSILSSSDTSEEEQDLLQAPAADIINIIKQGQDGT---SVTS 148

Query: 136 SLEDYRSLNVGIPLVLPEDXXXXXXXXXXXXXXXXXXE----EDDNDTITKSLNSSSNSF 191
               ++ L+  I L +P                    +    E+D+ TITKSL SS+NSF
Sbjct: 149 PSHPFKQLHTVISLPMPPRERTFYGEQEDVVCIDNDDDNGMYEEDSVTITKSLTSSTNSF 208

Query: 192 IMPKLSLSQKTQKFRILVLGRPGLKFYHSIPKKYQHMFELPRSHDPAEFKQYTGILVVFQ 251
           +MPKLSLS+K   FR+L+LGR G  FY S PK+YQ +FELP+SHD   F QYTGI++VFQ
Sbjct: 209 VMPKLSLSRKNPVFRLLILGRTGTNFYQSTPKEYQSLFELPKSHDSTIFPQYTGIVIVFQ 268

Query: 252 ELKEMVSLLNRVCQCNPNRPVIPVCQSGQRQQVRNLLESLLKNRLVSLLYPPVVVNNQPD 311
           EL+EMVSLLNR+ +    +P+IP+CQ GQ  QV+N+L+S LKN L+ LLYPPVV  N+ D
Sbjct: 269 ELREMVSLLNRIVEYAQGKPIIPICQPGQTIQVKNVLKSFLKNSLIKLLYPPVVATNRKD 328

Query: 312 LLGMFRFLQELS 323
           L  MF+ LQ+LS
Sbjct: 329 LKKMFQRLQDLS 340

>SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} similar
           to uniprot|Q753M9 Ashbya gossypii AFR283W AFR283Wp and
           weakly similar to YIL146C uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 470

 Score =  226 bits (575), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 164/501 (32%), Positives = 255/501 (50%), Gaps = 74/501 (14%)

Query: 21  IERRSILDPHLSVLELLRR-----------PSDTRPHEALKGEVSDIVGNCAXXXXXXNG 69
            ++RSILDPH SVL+LL R            S   P E LK   +  +          N 
Sbjct: 26  FQKRSILDPHFSVLQLLERNGCEQEEDVNQASSQIPVE-LKSAFNRPLSPHKRYPEALNQ 84

Query: 70  SISQSWQTIHRND-SCLSVVPERCPSQATAAGILSSSDTSEDEPDAVNSPSAVHQQLHAT 128
           SIS SWQ+I   D S L+ + +   SQA   GILSSSDTSE+E D +NSPS   QQ+   
Sbjct: 85  SISDSWQSIKMVDYSILNSLHDTSSSQA--VGILSSSDTSEEELDHLNSPSPSSQQVFPN 142

Query: 129 PPQKHTKSLEDYRSLNVGIPLVLPEDXXXXXXXXXXXXXXXXXXEEDDNDTITKSLNSSS 188
            P    ++     + +  +P                        EEDDN+T+T SL +SS
Sbjct: 143 GPPISFQTQAGVLTASATLP-------------------NPGVLEEDDNETVTVSLAASS 183

Query: 189 NSFIMPKLSLSQKTQKFRILVLGRPGLKFYHSIPKKYQHMFELP--RSHDPAEFKQYTGI 246
           NSF+MP+LSLSQ++ +F ILV+G+P  KF++++PK YQ MF++    S    +   YT +
Sbjct: 184 NSFVMPQLSLSQRSHRFEILVVGKPARKFWNNVPKMYQKMFDIGDFESISAPKVSHYTAV 243

Query: 247 LVVFQELKEMVSLLNRVCQCNPNRPVIPVCQSGQRQQVRNLLESLLKNRLVSLLYPPVVV 306
           +++FQ+ KE+  +L+ +      + +IP+CQ GQ+QQ+ +LLE  +K + + L++ P V+
Sbjct: 244 MIIFQDTKEVSFILDSLVTKLDGKAIIPICQRGQKQQLASLLEPFVKAKKIRLMFQPTVM 303

Query: 307 NNQPDLLGMFRFLQELSKTVSDNSDMDAEEPNNGXXXXXXXXXXXXXXFIETSAERNGRP 366
           +N  ++  + R+L  LS  +    + D                       ET  +   R 
Sbjct: 304 SNHQEIHKLLRYLHRLSTEIDSGYETD-----------------------ETHLKVRKRK 340

Query: 367 HKKRHNNEKV-NRWVLWGVSLTLGVGVGYCISHLVSSTWISLTTNPLGPVDPESVSKDLF 425
              +  ++   NRWV+WG+SLT+GVG+G CIS ++SS   S+         P +   D+ 
Sbjct: 341 KTHKKKSKGTSNRWVIWGLSLTVGVGIGCCISFILSSYSSSVQI-------PHASRDDVV 393

Query: 426 VFDRQELKLGEMDMDSDHPFGHALFLFKQALKQWNLAVKQFLGRH---LSCMERIGPANC 482
           + +  E+       + + P G  + L ++ +KQ+NL +KQF+      LS ++R+G    
Sbjct: 394 LVE--EVPTLPDKAEGNGPIGQVITLLRKTVKQFNLVLKQFIYEQVGSLSWIQRVGKELI 451

Query: 483 LEWPTSDEHTNRVLALGYVML 503
            E   SD    RV AL  V+L
Sbjct: 452 SE--DSDGTVGRVAALDLVLL 470

>KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 472

 Score =  208 bits (529), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 178/504 (35%), Positives = 247/504 (49%), Gaps = 89/504 (17%)

Query: 22  ERRSILDPHLSVLELLRRPSDTRPHEALK-GEVSDIVGNCAXXXXXXNGSISQSWQTIHR 80
           +R SILDPHLSVL+LL R        +LK GE++             N SIS+SWQ+I  
Sbjct: 36  QRNSILDPHLSVLQLLDRADPPSELSSLKHGEIAKPATPRRSGFESVNCSISESWQSIKH 95

Query: 81  NDSCLSVVPERCPSQATAAGILSSSDTSEDEPDAVNSPS--------AVHQQLHATPPQK 132
            D C S+V  +  +    AGILSSSDTSEDEPDA  SPS        +        P   
Sbjct: 96  TD-C-SMVNTQGDATHQHAGILSSSDTSEDEPDAQLSPSPNNFAFPNSATSIFPEAPHNL 153

Query: 133 HTKSLEDYRSLNVGIPLVLPEDXXXXXXXXXXXXXXXXXXEEDDNDTITKSLNSSSNSFI 192
              SL +Y++  +  P                        EE+DN+T+T SL +SSNSF+
Sbjct: 154 EASSLREYQNSEIANP-----------------------REENDNETVTMSLMNSSNSFV 190

Query: 193 MPKLSLSQKTQKFRILVLGRPGLKFYHSIPKKYQHMFELPR-SH-DPAEFKQYTGILVVF 250
           MPKLSL Q++QKF IL++G+P  +FY  IP+ Y  MFE+    H  P E  +Y+ ++V+F
Sbjct: 191 MPKLSLIQQSQKFCILIVGKPAQRFYRDIPRAYHKMFEVRDVGHLSPREMNKYSAVMVIF 250

Query: 251 QELKEMVSLLNRVCQCNPNRPVIPVCQSGQRQQVRNLLESLLKNRLVSLLYPPVVVNNQP 310
            E KE   LL +V   N N  +I VCQ GQ+QQ+ N+L    K+  + L+Y   V+++  
Sbjct: 251 GEPKEGKELLEKVAAHNSN--IIAVCQRGQQQQISNILNRYSKSNEIRLVYHLTVMSDHQ 308

Query: 311 DLLGMFRFLQELSKTVSDNSDMDAEEPNNGXXXXXXXXXXXXXXFIETSAERNGRPHKKR 370
           D+  + R+L  LS  V    + +      G                + +           
Sbjct: 309 DVHRLLRYLNTLSTEVDSGYETEV-----GSRKIRKRRKSSKKRSPQIT----------- 352

Query: 371 HNNEKVNRWVLWGVSLTLGVGVGYCISHLVSSTWISLTTNPLGPVDPESVSKDLFVFDRQ 430
                VNRWV+W +SLT+GVG+GYCIS L+SST  +L+            S D       
Sbjct: 353 -----VNRWVIWSISLTVGVGLGYCISCLLSSTSSTLSV--------TLRSGD------- 392

Query: 431 ELKLGEMDMDSDH--PFG----HALFLFKQALKQWNLAVKQFL-GRHLSC--MERIGPAN 481
           E+ + E   +S H  PF     H L   K+A+KQ N + KQ+L G+ L    M+RIG   
Sbjct: 393 EVTIMEDIHNSPHESPFDNYLRHLLLAVKRAVKQVNSSFKQYLSGQSLPVLWMQRIGK-- 450

Query: 482 CLEW--PTSDEHTNRVLALGYVML 503
             EW    SD     V AL  V++
Sbjct: 451 --EWLSEASDPTLPGVTALDLVLV 472

>Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON}
           YIL146C (ECM37) - (putative) involved in cell wall
           biogenesis [contig 159] FULL
          Length = 467

 Score =  204 bits (519), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 168/495 (33%), Positives = 239/495 (48%), Gaps = 69/495 (13%)

Query: 23  RRSILDPHLSVLELLRRPS-DTRPHEALKGEVSDIVGNCAXXXXXXNGSISQSWQTIHRN 81
           R SILDPHLSVL+LL R    + P E    ++                SIS SWQ+I   
Sbjct: 28  RNSILDPHLSVLQLLERNEVHSEPQEFRHSDIPSPHLLSRSSSEPMGRSISDSWQSIRHT 87

Query: 82  D-SCLSVVPERCPSQATAAGILSSSDTSEDEPDAVNSPSAVHQQLHATPPQKHTKSLEDY 140
           D S L+++ E   +    AGILSSSDTSEDEPD   SPS                   +Y
Sbjct: 88  DYSILNLIGE---TSHQPAGILSSSDTSEDEPDHFLSPSP-----------------NEY 127

Query: 141 RSLNVGIPLVLPE-----DXXXXXXXXXXXXXXXXXXEEDDNDTITKSLNSSSNSFIMPK 195
              N G   V PE     +                  E++DN+T+T SL +SSNSF+MPK
Sbjct: 128 AFAN-GAKTVFPEASHAPEGPSLATLQDSVYEHSNVAEDNDNETVTLSLINSSNSFVMPK 186

Query: 196 LSLSQKTQKFRILVLGRPGLKFYHSIPKKYQHMFEL--PRSHDPAEFKQYTGILVVFQEL 253
           LSL+Q  +KF IL++G+P  +FY  IP+ YQ MFE+    S    +  Q++ I+V+F + 
Sbjct: 187 LSLAQPLRKFSILIVGKPAQRFYRDIPRAYQKMFEVCDAESFKTRDVDQFSAIMVIFTDP 246

Query: 254 KEMVSLLNRVCQCNPNRPVIPVCQSGQRQQVRNLLESLLKNRLVSLLYPPVVVNNQPDLL 313
           K   SLL  V   + N  +I VCQ GQ+QQ+ NLL    K   + L+Y   V+++  D+ 
Sbjct: 247 KNGQSLLEMVTGRSSN--IIAVCQRGQQQQISNLLNRFSKTHHLRLIYHLTVMSDHQDVH 304

Query: 314 GMFRFLQELSKTVSDNSDMDAEEPNNGXXXXXXXXXXXXXXFIETSAERNGRPHKKRHNN 373
            + R+L  LS  +  +S+ D E                     ET A             
Sbjct: 305 RLLRYLYTLSNEI--DSEYDTE-----VGPRKVRKRRKSYKKRETPA------------- 344

Query: 374 EKVNRWVLWGVSLTLGVGVGYCISHLVSSTWISLTTNPLGPVDPESVSKDLFVFDRQELK 433
             VNRWV+W +SLT+GVG+GYCIS L+SST +S+  N L     + ++        +E  
Sbjct: 345 -AVNRWVIWSISLTVGVGIGYCISCLLSST-MSVRGNTLTLHSSDEIAL------IEEAP 396

Query: 434 LGEMDMDSDHPFGHALFLFKQALKQWNLAVKQFLGRH---LSCMERIGPANCLEW--PTS 488
           +   +   ++ F   +  FK+A+KQ + + KQ L  H   +  M+RIG     +W    S
Sbjct: 397 ISPHETVLENYFRQLVLAFKKAVKQVSQSFKQCLHGHSLPVLWMQRIGK----DWMSEAS 452

Query: 489 DEHTNRVLALGYVML 503
           D     V AL  V++
Sbjct: 453 DTTLPGVTALDLVLI 467

>KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {ON}
           Anc_5.699 YIL146C
          Length = 556

 Score =  178 bits (451), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 160/551 (29%), Positives = 256/551 (46%), Gaps = 95/551 (17%)

Query: 25  SILDPHLSVLELLRRPSDTRPHEALKGEVS----DIVGNCAXXXXXXNGS---------- 70
           SILDPHLSVLELL R      HE     +S    DI    A        S          
Sbjct: 29  SILDPHLSVLELLERGFQN-VHEQDDTIMSTTPRDIAVEMATVRLNSEASGVSTPSVGDI 87

Query: 71  ISQSWQTIHRND--SCLSVVPERCPSQATAAGILSSS-----------DTSEDEP----- 112
           ISQSW TI R D    L     +   Q+  AGILSSS           +  ++ P     
Sbjct: 88  ISQSWHTIQRRDLEESLHNNSNKLVLQSATAGILSSSDTSEEEEGYDINGKKNSPLHLQP 147

Query: 113 ---------DAVNSPSAVHQQLHATPPQKHTKSLEDYRSLNVGIPLVLPEDXXXXXXXXX 163
                    D  +S   V ++L ++P +  +  +     LN  +P               
Sbjct: 148 KRLCEPIIQDICSSHMNVVKRLQSSPVKADSDKICTVSDLNRRVP-----------SNNA 196

Query: 164 XXXXXXXXXEEDDNDTITKSLNSSSNSFIMPKLSLSQKTQK------FRILVLGRPGLKF 217
                    E +D  T +KSL SSS SFIMP+LSL++K ++      FRIL++GR   K 
Sbjct: 197 MTPDTEEEEEGEDYMTASKSLTSSSTSFIMPRLSLTKKERQQLNANEFRILIVGRLSSKL 256

Query: 218 YHSIPKKYQHMFELPRSHDPAEFKQYTGILVVFQELKEMVSLLNRVCQCNP-NRPVIPVC 276
           +  IP K+Q++F+L +S+D  E++++T ILVV QE +E++SLLNR+ +     RP+I +C
Sbjct: 257 FKMIPHKFQNLFQLQKSYDINEYQKFTAILVVIQETRELISLLNRISRSEKVKRPLIAIC 316

Query: 277 QSGQRQQVRNLLESLLKNRLVSLLYPPVVVNNQPDLLGMFRFLQELSKTVSDNS-----D 331
           +     Q +N+L+S L+N L++LLY P V++N  +L  M  FL+E S    + +      
Sbjct: 317 EKDAFLQCKNVLKSYLRNDLITLLYQPFVISNTEELDRMLVFLKETSIKFYEQAYNPKIQ 376

Query: 332 MDAEEPNNGXXXX-XXXXXXXXXXFIETSAERN------------GRPHKKRHNNEKVNR 378
           +  + PN+G                ++    R+                +K   NE+ N+
Sbjct: 377 IKEKVPNDGNRNAPTSSDLTLSKDRVKNDKHRHTKGDGSGGSKKGNEHDRKPKENEEYNK 436

Query: 379 WVLWGVSLTLGVGVGYCISHLVSSTWISLT------TNPLGPVDPESVSKDLFVFDRQEL 432
           W++WG+SL++GVG+GYCIS+  SS W SL       ++ +    P  +S + FV     L
Sbjct: 437 WIIWGISLSIGVGIGYCISYFGSSPWSSLVQYFNPESDSISATVPVPLSNESFVL----L 492

Query: 433 KLGEMDMDSDHPFGHALFLFKQALKQWNLAVKQFLGRHLSCMERIGPANCLEWPTSDEHT 492
              + D ++   F  ++   K ++ +  + +K  + + L+    +   N        +  
Sbjct: 493 HDSDNDSETKKYFFKSINFLKYSINKVKVIIKDTIRKPLNAFSYLNGLNT-------DDA 545

Query: 493 NRVLALGYVML 503
           + +LALGY+++
Sbjct: 546 SSLLALGYILI 556

>Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON}
           similar to Ashbya gossypii AFR283W
          Length = 459

 Score =  173 bits (438), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 149/503 (29%), Positives = 230/503 (45%), Gaps = 89/503 (17%)

Query: 23  RRSILDPHLSVLELLRRPSDTR---PHEALKGEVSDIVGNCAXXXXXXNGSISQSWQTIH 79
           +RSILDPHLSVLE+L      +   PHE L G  S + G         + SIS+SWQ+I 
Sbjct: 24  QRSILDPHLSVLEILEGKELNKVEGPHE-LSG-ASRVSGKQFEGERVLHHSISESWQSIK 81

Query: 80  RNDSC-LSVVPERCPSQATAAGILSSSDTSEDEPDAVNSPSAVHQQLHATPPQKHTKSLE 138
             D   LS   +    Q +A GILSSSDTSE+E D       +H    + PP     S  
Sbjct: 82  STDYLFLSRANDTSLQQQSAVGILSSSDTSEEEQD-------IHP---SPPPPNSASSAF 131

Query: 139 DYRSLNVGIPLVLPEDXXXXXXXXXXXXXXXXXXEEDDNDTITKSLNSSSNSFIMPKLSL 198
           D R +N+                           E+DD +T+T SL ++  S +MPKLSL
Sbjct: 132 DSRIINIA-----------GQAFSATLSHLRSEDEDDDGETVTVSLPNTMTSLVMPKLSL 180

Query: 199 SQKTQKFRILVLGRPGLKFYHSIPKKYQHMFELP-----RSHDPAEFKQYTGILVVFQEL 253
           S +  + ++L++G+P  KF+ SIPK YQ MFE+      R  D  E  +Y+ I+V+F ++
Sbjct: 181 SDRIIESKVLIVGQPARKFWFSIPKSYQKMFEICSLSVLRDKDVDE--KYSTIMVIFHDM 238

Query: 254 KEMVSLLNRVCQCNPNRPVIPVCQSGQRQQVRNLLESLLKNRLVSLLYPPVVVNNQPDLL 313
                LL+R+C       +IP+CQ GQ+Q + +LL+  +    + L   P+V++N  +  
Sbjct: 239 GLAPELLDRICNKVVRPRIIPICQKGQKQHLSSLLKQYVSGNRIKLFCNPIVMSNHHEKH 298

Query: 314 GMFRFLQELSKTVSDNSDMDAE-EPNNGXXXXXXXXXXXXXXFIETSAERNGRPHKKRHN 372
            + + L +LS       + +   EP                       ++  R  KKR +
Sbjct: 299 RLLKHLHQLSSGSDSGYETEVTVEP----------------------VKKLPRKAKKRPS 336

Query: 373 NEKVNR-WVLWGVSLTLGVGVGYCISHLVSSTWISL----------TTNPLGPVDPESVS 421
                R WV+W  S+T+G+G+G C+S +VS+ +  L          T++PL P   +  S
Sbjct: 337 KPSTFRDWVVWTASITIGIGIGCCVSLMVSTRYAFLVPRQLAVDDITSSPLSPEGTDKSS 396

Query: 422 KDLFVFDRQELKLGEMDMDSDHPFGHALFLFKQALKQWNLAVKQFLGRHLSCMERIGPAN 481
            +LF+                    HA  L K +LK+   +++ F    L     I    
Sbjct: 397 HNLFL--------------------HAYSLCKTSLKKLASSLRPFFSDRLESCTWIHTLG 436

Query: 482 C-LEWPTSDEHTNRVLALGYVML 503
             L +  S     R++ L ++ML
Sbjct: 437 IELSYDDSLISMGRIMPLDFIML 459

>KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5.699
           YIL146C
          Length = 444

 Score =  172 bits (436), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 159/498 (31%), Positives = 235/498 (47%), Gaps = 79/498 (15%)

Query: 25  SILDPHLSVLELLRRPSDTRPHEALKGEVSDIVGNCAXXXXXXNGSISQSWQTIHRNDSC 84
           S+LDPHLSVLELL +  +   H    G         +         +S+SW T+ R++  
Sbjct: 7   SVLDPHLSVLELLEKSCERGGHAEAPGS--------SRNKGAGQIQLSESWCTVERDE-- 56

Query: 85  LSVVPERCPSQATAAGILSSSDTSED-EPDAVNSPSAVHQQLHATPPQKHTKSLEDYRSL 143
           LS + ER  SQ T  G+LSSSDTSE+ EP+  +        +  T   +   SL+   S 
Sbjct: 57  LSAM-ERSASQQTNNGVLSSSDTSEEGEPEQGSPGDGEGGGVADTRMARPAMSLQSTSST 115

Query: 144 NVGIPLVLPEDXXXXXXXXXXXXXXXXXXEEDDNDTITKSLNSSSNSFIMPKL------- 196
             G+                          +DD+ T++KSL SSSNSFIMPKL       
Sbjct: 116 LDGV--------------------------DDDSATVSKSLTSSSNSFIMPKLYTTVAGA 149

Query: 197 ----SLSQKTQKFRILVLGRPGLKFYH-SIPKKYQHMFELPRS-HDPAEFKQYTGILVVF 250
               S + +T+ F++ VLGR  +KF   ++P++++H FEL    HD A+     GIL+V 
Sbjct: 150 PSTVSTALQTRCFKVAVLGRGAVKFCQETVPEQFRHRFELTAGVHDLAQCADRQGILIVV 209

Query: 251 QELKEMVSLLNRV-CQCNPNRPVIPVCQSGQRQQVRNLLESLLKNRLVSLLYPPVVVNNQ 309
           QE++E++SLLNRV C C P  PV+ V    ++ QV+N+L +  + RLVSLL+PPV ++N 
Sbjct: 210 QEVRELISLLNRVHCAC-PEVPVVAVYDRDRQVQVKNVLRNFTRQRLVSLLHPPVPLSNN 268

Query: 310 PDLLGMFRFLQELSKTVSDNSDMDAEEPNNGXXXXXXXXXXXXXXFIETSAERNGRPHKK 369
             L  MF F+  L++          +EP                   E        PH+ 
Sbjct: 269 EALDKMFHFVDNLARQ---------QEPAGVIHNDPQTTQEQHPDHNEDD------PHRG 313

Query: 370 RHNNEKV-NRWVLWGVSLTLGVGVG-YCISHLVSSTWISLTTNPLGPVDPESVSKDLFVF 427
               E    RW+LWGVS++LG+G G YC+S++VSS+      N        + +      
Sbjct: 314 PSKPEGTFKRWLLWGVSISLGIGAGYYCVSYVVSSSMCVSCFNFRHTDHTLAATTSTAAA 373

Query: 428 DRQELKLGEMDMDSDH--PFGHALFLFKQALKQWNLAVKQFLGRHLSCMERIGPANCLEW 485
                    +D D+D      H L + K +LK+    VKQ + +    ++R       EW
Sbjct: 374 AAAAATPSGIDHDADSHTTLRHCLSIVKNSLKRATAFVKQAMHKPFHYIDR-----SQEW 428

Query: 486 PTSDEHTNRVLALGYVML 503
              D   NR L LGY ++
Sbjct: 429 HLHD--PNRFLQLGYAVI 444

>CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} similar
           to uniprot|P40458 Saccharomyces cerevisiae YIL146c ECM37
          Length = 492

 Score =  170 bits (430), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 80/218 (36%), Positives = 133/218 (61%), Gaps = 15/218 (6%)

Query: 191 FIMPKLSLSQK-TQKFRILVLGRPGLKFYHSIPKKYQHMFELPRSHDPAEFKQYTGILVV 249
           F+MPKLSL+ K +Q  ++LV+GR   +F+  IP++Y+  F + +S DP+EF+ Y GI++V
Sbjct: 195 FVMPKLSLTYKPSQAKKLLVVGRLSKRFHQDIPREYRQYFHISQSSDPSEFQNYIGIVIV 254

Query: 250 FQELKEMVSLLNRVCQCNPNRPVIPVCQSGQRQQVRNLLESLLKNRLVSLLYPPVVVNNQ 309
           FQELKE V++LNR+ Q    +P+IP+CQ GQR +V+N+L+S LKN  ++L YPPV + N+
Sbjct: 255 FQELKEFVAMLNRIVQYTDKKPIIPICQPGQRIRVKNILKSFLKNDAITLWYPPVTIANE 314

Query: 310 PDLLGMFRFLQELSKTVSDNSDMDAEEPNNGXXXXXXXXXXXXXXFIETSAERNGRPHKK 369
             +  +F+   +L   + +  D+ +   ++                 ETS  R     KK
Sbjct: 315 KSMEKLFKHTVKLVNKLENEEDVLSLSTSDKSLSD------------ETSGYRKNNRRKK 362

Query: 370 RHNNEKVN--RWVLWGVSLTLGVGVGYCISHLVSSTWI 405
                  N  +W+ WG+SLT+GV +GY  ++++++T +
Sbjct: 363 HGGKPSTNYSKWITWGISLTIGVSIGYYATYMITTTLL 400

>AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL146C (ECM37)
          Length = 452

 Score =  160 bits (405), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 115/399 (28%), Positives = 189/399 (47%), Gaps = 64/399 (16%)

Query: 22  ERRSILDPHLSVLELLRRPSDTRPHEALKGEVSDIVGNCAXXXXXXNGSISQSWQTIHRN 81
           + + ILDPHLSVLE+L R       +  +G V  +           + SIS+SWQ I R+
Sbjct: 27  QHKGILDPHLSVLEMLDRQDGDGAGQVEEGAVMTVGKR--RVERSLHHSISESWQAIKRS 84

Query: 82  DSCLSVVPERCPSQATAAGILSSSDTSEDEPDAVNSPSAVHQQLH-----ATPPQKHTKS 136
           D           +  ++ GILSSSDTSE+E +    PSA H  +H     A+P ++    
Sbjct: 85  DYSFLSGTHEVGAMHSSVGILSSSDTSEEEAEM--RPSA-HGTVHLGSSLASPMRQ---- 137

Query: 137 LEDYRSLNVGIPLVLPEDXXXXXXXXXXXXXXXXXXEEDDNDTITKSLNSSSNSFIMPKL 196
                       L++ ED                  EEDD  T+T S+ SSS S +MPKL
Sbjct: 138 ------------LLVEEDNSCA--------------EEDDCQTVTISMPSSSTSLVMPKL 171

Query: 197 SLSQKTQKFRILVLGRPGLKFYHSIPKKYQHMFELPRSHDPAEF---KQYTGILVVFQEL 253
           SLSQ+  + ++L++G+P  KF+ +IPK YQ +F++        +   ++Y  ++VVF ++
Sbjct: 172 SLSQRLGEPQLLLVGQPARKFWLTIPKCYQKLFDVKNLGMVTRWDVGQRYLAVMVVFHDI 231

Query: 254 KEMVSLLNRVCQCNPNRPVIPVCQSGQRQQVRNLLESLLKNRLVSLLYPPVVVNNQPDLL 313
            +   LL+ +C+  P   VIPVCQ GQ+  +  LL+     + + +   P++++N  +  
Sbjct: 232 AQAPELLDGLCEKAPCPTVIPVCQKGQKSTLAALLKRYTARKCIRVYCSPIIMSNHHEKH 291

Query: 314 GMFRFLQELSKTVSDNSDMDAEEPNNGXXXXXXXXXXXXXXFIETSAERNGRPHKKRHNN 373
            + + L  L             E  +G                  S +++ RP KK    
Sbjct: 292 RLLKHLHNL-----------CNESESGYETE----------LTVKSKKQHRRPRKKDAGP 330

Query: 374 EKVNRWVLWGVSLTLGVGVGYCISHLVSSTWISLTTNPL 412
             +  W +W  S T+G+G+G CIS + ++ +   ++ PL
Sbjct: 331 VALRHWAIWTASFTIGIGIGCCISLMATTRFTFFSSAPL 369

>TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.699
           YIL146C
          Length = 749

 Score =  137 bits (345), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 67/153 (43%), Positives = 104/153 (67%), Gaps = 2/153 (1%)

Query: 176 DNDTITKSLNSSSNSFIMPKLSLSQKTQKFRILVLG-RPGLKFYHSIPKKYQHMFELPRS 234
           +N  +TKS+ SSSNSFIMPKLS +   +KFRIL+LG    L FY +IP  Y+++FELP +
Sbjct: 321 NNLNLTKSMTSSSNSFIMPKLSWTNTFRKFRILILGSNQNLTFYQNIPTSYKYLFELPPN 380

Query: 235 HDPAEFKQYTGILVVFQELKEMVSLLNRVCQCNPNR-PVIPVCQSGQRQQVRNLLESLLK 293
           +    FK Y GI +V  +L +  S+LN++ + + N+ P+IP+C+ GQ  +V+N+L+  +K
Sbjct: 381 NFDYNFKHYAGIAIVIHDLTDFKSILNKIDKYSMNKKPIIPICEKGQINEVKNILKPYIK 440

Query: 294 NRLVSLLYPPVVVNNQPDLLGMFRFLQELSKTV 326
            + +SLLYPP+V  N+  +  ++  L +LSK V
Sbjct: 441 TKDLSLLYPPIVGTNRDGMNTLYLHLNDLSKNV 473

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 70/157 (44%), Gaps = 42/157 (26%)

Query: 374 EKVNRWVLWGVSLTLGVGVGYCISHLVSSTWISLTTNPLGPVDPESVSKDLFVFDRQELK 433
           +K+ + + W VSL++GVG+G+C+S+  S+ + +++         ES+SK +     + + 
Sbjct: 608 KKLKKIIYWTVSLSVGVGLGFCLSYYASTIFSNIS---------ESISKGINTLISESVT 658

Query: 434 LGEMDMDSDHP-----------------------FGHALFLFKQALKQWNLAVKQFLG-- 468
               D     P                       F ++LFL K  L+  N   KQ     
Sbjct: 659 PTVSDTPIPSPTTYSMEENLSTTCHYVGEKVKETFSNSLFLLKTTLRNLNWTTKQIWNSP 718

Query: 469 RHLSCMERIGPA--NCLEWPTSDEHTNRVLALGYVML 503
           + L+ +++I P+  N  E P        +LALG+V+L
Sbjct: 719 QGLNGVDQILPSKYNFYEDPA------MILALGFVLL 749

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 53/123 (43%), Gaps = 27/123 (21%)

Query: 20  DIERRSILDPHLSVLELLR-------------------RPSD-TRPHEALKGEVS----D 55
           D ++R  LDPH S++ELL                    +P + T P   ++ E+S    D
Sbjct: 21  DYDKRGFLDPHFSLIELLENAKYSLQENSNEATVTNVLQPDNPTSPLNEIRLELSGMNVD 80

Query: 56  IVGNCAXXXXXXNGSISQSWQTIHRND-SCLSV--VPERCPSQATAAGILSSSDTSEDEP 112
            + +        + S+S SWQ I   D S L V              GILSS+D+SE+E 
Sbjct: 81  DINSENQESSELSQSLSNSWQRIQTPDYSPLDVKDSNSINNINNNTVGILSSTDSSEEEQ 140

Query: 113 DAV 115
           D +
Sbjct: 141 DNI 143

>NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}
           Anc_5.699 YIL146C
          Length = 510

 Score =  134 bits (336), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 110/319 (34%), Positives = 165/319 (51%), Gaps = 57/319 (17%)

Query: 24  RSILDPHLSVLELLRRPSDTRPHEALKGEVSDIVGNCAXXXXXXNGSISQSWQTIHRNDS 83
           +S+LDPHLSVLE+L R  +    EA                   +  IS+SWQ I     
Sbjct: 36  KSLLDPHLSVLEMLERKDNDTVMEA-------------------SSRISRSWQNIESPAD 76

Query: 84  CLSVVPERCPSQATAAGILSSSDTSEDEP-DAVNSPSAVHQQLHATPPQKHTKSLEDYRS 142
              ++  +    +    ILSSS  + DE  D +NS ++  +   ++    +   L++   
Sbjct: 77  SKQLLSAKSSQVSNLVSILSSSSDTSDEEVDRINSLNSAGE--GSSKNYNNPSPLQN--- 131

Query: 143 LNVGIPLVLPEDXXXXXXXXXXXXXXXXXXEEDDN--DTITKSLNSSS---NSFIMPKLS 197
                P+ LPE                   + DD    TITKSL SSS   NSF+MP LS
Sbjct: 132 -----PIYLPE------------FTDVTAGDNDDGIASTITKSLTSSSTISNSFVMPTLS 174

Query: 198 LSQKT---QKFRILVLGRPGLKFYHSIPKKYQHMFELPRSHDPA---EFKQYTGILVVFQ 251
           LS      +KF+IL+ GR G  FY +IPK+YQ++F +P   +     E   +T  L++F+
Sbjct: 175 LSSSQSQQRKFQILIFGRLGPSFYRTIPKQYQYLFHVPNQLNTLTRNEMDNFTAFLIIFE 234

Query: 252 ELKEMVSLLNRVCQCNPNRPVIPV----CQSGQRQQVRNLLESLLKNRLVSLLYPPVVVN 307
           ELKE+VSLLNR+ +    + V P     CQ GQ+ +V+++L+  LKN  V+LL P +++N
Sbjct: 235 ELKELVSLLNRISEELSFKKVPPPIIPICQPGQKIKVKSILKYFLKNNFVTLLSPIIIIN 294

Query: 308 NQPDLLGMFRFLQELSKTV 326
           ++  LL MF+ +Q +SKTV
Sbjct: 295 DERALLKMFKTMQSISKTV 313

>KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 524

 Score =  128 bits (321), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 133/521 (25%), Positives = 219/521 (42%), Gaps = 72/521 (13%)

Query: 22  ERRSILDPHLSVLELLRRPSDTRPHEAL---------KGEVSDIVGNCAXXXXXXNGSIS 72
           +R SILDPH SV++LL           L         KG+ ++I  N         G ++
Sbjct: 37  QRHSILDPHDSVMDLLNGQQSCAFDSRLIQNQDLIDRKGKSNNIDHNDINTHTHSKG-LT 95

Query: 73  QSWQTIHRNDSCLSVVPERCPSQATAAGILS-------SSDTSEDEPDAVNSPS------ 119
            SWQ I R++              T+ G  +       SSDTSE+E +   +PS      
Sbjct: 96  DSWQAIDRDEYSFLNAGNHNNYHNTSNGDFNQQFGGVLSSDTSEEEVEINAAPSPNLSAS 155

Query: 120 AVHQQLHATPPQKHTKSLEDYRSLNVGIPLVLPEDXXXXXXXXXXXXXXXXXXEEDDNDT 179
             H Q  A P    +    D  +    +      D                    +D +T
Sbjct: 156 QQHNQFLAYPLS--STGFGDQGNSETTVHQFSDGDPVKSTKTGQFSKAELGAGTGED-ET 212

Query: 180 ITKSLNSS--SNSFIMPKLSLSQKTQKFRILVL--GRPGLKFYHSIPKKYQHMFELPRSH 235
           I  +L  S   + F+MPKLSLS+  ++F+IL+L  G     FY+ + + ++ MF++ + +
Sbjct: 213 IMVNLGHSWAGSFFVMPKLSLSESMKRFKILILSDGDSANSFYNRLSRYHRLMFDVGKLN 272

Query: 236 DPA--EFKQYTGILVVFQELKEMVSLLNRVCQCNPNRPVIPVCQSGQRQQVRNLLESLLK 293
           + +  E  +YT  +++F + K++ ++LNR+ +   +  +IP+CQ GQ+Q V   +++   
Sbjct: 273 EASKEEALKYTAFMIIFSDSKKVTTILNRMWKKYGDFTLIPICQKGQKQSVTEKVKTFAN 332

Query: 294 NRLVSLLYPPVVVNNQPDLLGMFRFLQELSKTVSDNSDMD---AEEPNNGXXXXXXXXXX 350
           +  + L+  PVV+++  ++ G+ R L  L   V  + + D     +P  G          
Sbjct: 333 SNKIKLMSYPVVISDHYEIHGLLRHLHSLYVEVDSDYETDIPKKTKPRKG---------- 382

Query: 351 XXXXFIETSAERNGRPHKKRHNNEKVNRWVLWGVSLTLGVGVGYCISHLVSSTWISLTTN 410
                    A++   PH  +       RW  W +S+ LGVG+G C++   S    S   +
Sbjct: 383 ---------AKKKPAPHLAK-------RWWFWPISIALGVGIGCCVTFYFSKFETSSYNS 426

Query: 411 PLGPVDPESVSKDLFVFDRQELK----LGEMDMDSDHPF-GHALFLFKQALKQWNLAVKQ 465
            +G +       D  V D  E      L E    S   F G    L K    Q N  +KQ
Sbjct: 427 SVGVIQTADKEIDAIV-DAIEGNSPSILEESSPQSISDFLGQVCKLVKDTAIQINELLKQ 485

Query: 466 FLGRHL---SCMERIGPANCLEWPTSDEHTNRVLALGYVML 503
           FL  HL   + ++ IG       P S    ++V AL  VM 
Sbjct: 486 FLSAHLMTSAWIQSIGKE--FMQPDSQSTISKVTALDLVMF 524

>Kpol_2001.73 s2001 (199741..200976) [1236 bp, 411 aa] {ON}
           (199741..200976) [1236 nt, 412 aa]
          Length = 411

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 67/125 (53%), Gaps = 21/125 (16%)

Query: 379 WVLWGVSLTLGVGVGYCISHLVSSTWISLTTNPLGPVDPESVSKDLFVFDRQELKLGEMD 438
           +V +G+S+TLGVGVGYCIS LV    +S  +N +  + P + + D+   + Q+L     D
Sbjct: 308 FVYYGISITLGVGVGYCISSLV----VSQNSNDIQSIVPSTPNNDIIALESQDLNSHNGD 363

Query: 439 MDSDHPFGHALFLFKQALKQWNLAVKQFLGRHLSCMERIGPANCLEWPTSDEHTNRVLAL 498
            D +  F       K ++K     +K+F+   +         N LE+ T ++ +N+++A+
Sbjct: 364 -DYNWNF------LKLSIKNVYSILKRFITTSI---------NLLEYKTLND-SNKIIAM 406

Query: 499 GYVML 503
            YV+L
Sbjct: 407 SYVLL 411

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 43/89 (48%), Gaps = 13/89 (14%)

Query: 190 SFIMPKLSLSQK-------TQKFRILVLGRPGLKFYHSI-PKKYQHMFELPRSHDPAEFK 241
           +FIMPKL +SQ            R L++G   L FY+ I P  Y+  F++   +      
Sbjct: 76  TFIMPKLIVSQNLWDTNNDNNNNRFLIVGNNSLFFYNEILPINYKKFFKIWCLNKLDS-- 133

Query: 242 QYTGILVVFQELKEMVSLLNRVCQCNPNR 270
             + ++++  +  E+ ++L ++   N NR
Sbjct: 134 --SNLIIIINDHNELFNILQKIL-LNSNR 159

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,658,833
Number of extensions: 2008477
Number of successful extensions: 5991
Number of sequences better than 10.0: 24
Number of HSP's gapped: 6061
Number of HSP's successfully gapped: 33
Length of query: 503
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 389
Effective length of database: 40,409,475
Effective search space: 15719285775
Effective search space used: 15719285775
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)