Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0G06644g5.700ON1166116653500.0
TDEL0B022105.700ON1095110334250.0
SAKL0E14872g5.700ON1140112631950.0
Kpol_2001.745.700ON1113112231050.0
Kwal_55.197075.700ON1143112930560.0
KLLA0A00638g5.700ON1155115129820.0
TPHA0D045905.700ON1127115328690.0
KNAG0L021105.700ON120095328120.0
YIL147C (SLN1)5.700ON122094826710.0
AFR284W5.700ON1103112326200.0
NCAS0G002505.700ON118371223760.0
CAGL0H06567g5.700ON116969022710.0
Smik_9.225.700ON123074022360.0
Skud_9.215.700ON122173022300.0
Suva_9.415.700ON121973022030.0
KAFR0D022405.700ON118772021860.0
KLTH0E01100g5.700ON117770519530.0
Kpol_1043.685.700ON104269017730.0
Ecym_40205.700ON112571217690.0
TPHA0E002505.700ON106869017100.0
TBLA0E021005.700ON114071715280.0
NDAI0F003105.700ON125939914590.0
TBLA0I016805.700ON12142358692e-97
Smik_8.2964.385ON6251691739e-12
Ecym_74744.385ON4961261721e-11
ADL388W4.385ON4821261711e-11
KNAG0M001804.385ON6151391693e-11
TDEL0D003204.385ON5471351683e-11
KAFR0B069904.385ON5451261674e-11
Suva_15.4124.385ON6171691659e-11
TBLA0A107004.385ON5871261649e-11
KLLA0A10219g4.385ON4751401631e-10
CAGL0F09097g4.385ON6301261641e-10
SAKL0B12408g4.385ON4651261612e-10
NCAS0A064504.385ON6091401622e-10
Skud_8.2734.385ON6231371612e-10
YHR206W (SKN7)4.385ON6221371612e-10
Kpol_265.24.385ON5491261603e-10
KLTH0D17182g4.385ON4641381567e-10
ZYRO0G00484g4.385ON6471331577e-10
NDAI0D034304.385ON5971351514e-09
Ecym_50775.230ON7951501497e-09
TPHA0C001504.385ON5101291488e-09
Kwal_47.167704.385ON4611261479e-09
KNAG0B051405.230ON6481271462e-08
Suva_10.845.230ON6951471452e-08
Kwal_33.152885.230ON5871741443e-08
YLR006C (SSK1)5.230ON7121471434e-08
KAFR0J007005.230ON6201261407e-08
KLTH0B02684g5.230ON5951441398e-08
TDEL0E039805.230ON7301401391e-07
Skud_12.725.230ON7021471391e-07
Kpol_1004.45.230ON7141501353e-07
ZYRO0A11154g5.230ON7761801335e-07
Smik_12.685.230ON7121471336e-07
CAGL0D02882g5.230ON6671471336e-07
ADR343C5.230ON7491501311e-06
NCAS0D029005.230ON7621391282e-06
TPHA0N008505.230ON6701481263e-06
NDAI0I020005.230ON8901721212e-05
TBLA0D031705.230ON7651501192e-05
KLLA0E09505g5.230ON635711149e-05
Klac_YGOB_Anc_8.348.34ON1571871104e-04
SAKL0G12100g5.230ON738941085e-04
ACR218W8.34ON1569961020.003
NCAS0C037708.34ON15981571000.004
TDEL0C005908.34ON160299940.029
SAKL0B01210g8.34ON1588119920.044
KLLA0E04533g7.222ON42181890.071
Ecym_15088.34ON1694134860.21
Kpol_1035.408.34ON1517131850.28
YFL033C (RIM15)8.34ON177098840.43
CAGL0K12562g8.34ON168297820.60
Skud_6.388.34ON175899820.62
SAKL0F08184g7.222ON41281810.68
KLTH0G18612g8.34ON152493820.72
NDAI0B014302.582ON1063131810.86
Kwal_47.181517.222ON41430791.1
TBLA0G034508.34ON197284791.4
Smik_6.468.34ON176099791.4
KAFR0C035208.34ON145084772.3
TBLA0E049804.385ON791102754.4
ZYRO0F03014g8.34ON1604155745.7
Kwal_14.11598.34ON152172746.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0G06644g
         (1166 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] ...  2065   0.0  
TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {...  1323   0.0  
SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} sim...  1235   0.0  
Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON} (202...  1200   0.0  
Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {O...  1181   0.0  
KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {O...  1153   0.0  
TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_...  1109   0.0  
KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5...  1087   0.0  
YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}  S...  1033   0.0  
AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic h...  1013   0.0  
NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON...   919   0.0  
CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} simil...   879   0.0  
Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON} ...   865   0.0  
Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON} ...   863   0.0  
Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON} ...   853   0.0  
KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {...   846   0.0  
KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa] ...   756   0.0  
Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON} (141...   687   0.0  
Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON} ...   686   0.0  
TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON...   663   0.0  
TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5....   593   0.0  
NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON...   566   0.0  
TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5....   339   2e-97
Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W ...    71   9e-12
Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar t...    71   1e-11
ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homo...    70   1e-11
KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON...    70   3e-11
TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}...    69   3e-11
KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4...    69   4e-11
Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206...    68   9e-11
TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4...    68   9e-11
KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} simila...    67   1e-10
CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} simila...    68   1e-10
SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} simi...    67   2e-10
NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4...    67   2e-10
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    67   2e-10
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    67   2e-10
Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..1149...    66   3e-10
KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]...    65   7e-10
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    65   7e-10
NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385     63   4e-09
Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar t...    62   7e-09
TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}...    62   8e-09
Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206...    61   9e-09
KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.2...    61   2e-08
Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {O...    60   2e-08
Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa]...    60   3e-08
YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON} ...    60   4e-08
KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5....    59   7e-08
KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some s...    58   8e-08
TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.2...    58   1e-07
Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {O...    58   1e-07
Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}...    57   3e-07
ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} simila...    56   5e-07
Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {O...    56   6e-07
CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {...    56   6e-07
ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}...    55   1e-06
NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {O...    54   2e-06
TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {...    53   3e-06
NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {O...    51   2e-05
TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {O...    50   2e-05
KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly...    49   9e-05
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    47   4e-04
SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weak...    46   5e-04
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    44   0.003
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    43   0.004
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    41   0.029
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    40   0.044
KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} simila...    39   0.071
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    38   0.21 
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    37   0.28 
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    37   0.43 
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    36   0.60 
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    36   0.62 
SAKL0F08184g Chr6 (623521..624759) [1239 bp, 412 aa] {ON} simila...    36   0.68 
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    36   0.72 
NDAI0B01430 Chr2 (331560..334751) [3192 bp, 1063 aa] {ON} Anc_2....    36   0.86 
Kwal_47.18151 s47 (709368..710612) [1245 bp, 414 aa] {ON} YIL042...    35   1.1  
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    35   1.4  
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    35   1.4  
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    34   2.3  
TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4...    33   4.4  
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    33   5.7  
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    33   6.1  

>ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] {ON}
            similar to uniprot|P39928 Saccharomyces cerevisiae
            YIL147C SLN1 Histidine kinase osmosensor that regulates a
            MAP kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1166

 Score = 2065 bits (5350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1023/1166 (87%), Positives = 1023/1166 (87%)

Query: 1    MWMRQLMFGKFQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYM 60
            MWMRQLMFGKFQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYM
Sbjct: 1    MWMRQLMFGKFQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYM 60

Query: 61   AAQLKSTQIDQNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSS 120
            AAQLKSTQIDQNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSS
Sbjct: 61   AAQLKSTQIDQNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSS 120

Query: 121  GLFSVATIYDATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVL 180
            GLFSVATIYDATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVL
Sbjct: 121  GLFSVATIYDATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVL 180

Query: 181  NGTSYLMSMSLPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAV 240
            NGTSYLMSMSLPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAV
Sbjct: 181  NGTSYLMSMSLPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAV 240

Query: 241  YDQNETLSSYNFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVA 300
            YDQNETLSSYNFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVA
Sbjct: 241  YDQNETLSSYNFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVA 300

Query: 301  VGYSPCSVVFVNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKP 360
            VGYSPCSVVFVNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKP
Sbjct: 301  VGYSPCSVVFVNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKP 360

Query: 361  IVRLQKATELITEGRGLRASSPGAGSSNVSRRSSFFHRPSNCGSSIRSRVTDNHNEKGHD 420
            IVRLQKATELITEGRGLRASSPGAGSSNVSRRSSFFHRPSNCGSSIRSRVTDNHNEKGHD
Sbjct: 361  IVRLQKATELITEGRGLRASSPGAGSSNVSRRSSFFHRPSNCGSSIRSRVTDNHNEKGHD 420

Query: 421  LHGEQIQHGFFAMNGSINHSLAASIASSGNEALSDKSKGLTTSANLIEARVPVYRRFFSD 480
            LHGEQIQHGFFAMNGSINHSLAASIASSGNEALSDKSKGLTTSANLIEARVPVYRRFFSD
Sbjct: 421  LHGEQIQHGFFAMNGSINHSLAASIASSGNEALSDKSKGLTTSANLIEARVPVYRRFFSD 480

Query: 481  ELSELTDTFNTMTDALDQHYALLEDRVRARTRQLXXXXXXXXXXXXXKTVFIANISHELR 540
            ELSELTDTFNTMTDALDQHYALLEDRVRARTRQL             KTVFIANISHELR
Sbjct: 481  ELSELTDTFNTMTDALDQHYALLEDRVRARTRQLEAAKIDAEAANEAKTVFIANISHELR 540

Query: 541  TPLNGILGMTAISMEERDIDKIQNSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTKLEKRN 600
            TPLNGILGMTAISMEERDIDKIQNSLKLIFRSG            FSKNVLKRTKLEKRN
Sbjct: 541  TPLNGILGMTAISMEERDIDKIQNSLKLIFRSGELLLHILTELLTFSKNVLKRTKLEKRN 600

Query: 601  FSVTDVALQIKSIFGKVAKDQRVRLSITLYPNLIRTMVLFGDSNRIIQIVMNLVSNALKF 660
            FSVTDVALQIKSIFGKVAKDQRVRLSITLYPNLIRTMVLFGDSNRIIQIVMNLVSNALKF
Sbjct: 601  FSVTDVALQIKSIFGKVAKDQRVRLSITLYPNLIRTMVLFGDSNRIIQIVMNLVSNALKF 660

Query: 661  TPVDGKVNVYMSLLGEYDAERSENENHKKVYVIPGTEPXXXXXXXXXXXXXXXRFSIEXX 720
            TPVDGKVNVYMSLLGEYDAERSENENHKKVYVIPGTEP               RFSIE  
Sbjct: 661  TPVDGKVNVYMSLLGEYDAERSENENHKKVYVIPGTEPKGNDEKDKGGIEEKERFSIENT 720

Query: 721  XXXXXXXXXXKHSDTETTPGLNDTDEKQAXXXXXXXXXXXXXXXXXXXXXXXXXXYNDTV 780
                      KHSDTETTPGLNDTDEKQA                          YNDTV
Sbjct: 721  PNDTSSNSSNKHSDTETTPGLNDTDEKQASDDMDGGEEDVEDADEVSSFSTSTSSYNDTV 780

Query: 781  FHSQFKKTPKVCDDSSEELGVEVKDKKKWVISIVVEDTGPGIDSSLHESVFEPFVQGDQA 840
            FHSQFKKTPKVCDDSSEELGVEVKDKKKWVISIVVEDTGPGIDSSLHESVFEPFVQGDQA
Sbjct: 781  FHSQFKKTPKVCDDSSEELGVEVKDKKKWVISIVVEDTGPGIDSSLHESVFEPFVQGDQA 840

Query: 841  LSRQYGGTGLGLSICRQLATMMNGTMDLKSKLGVGSRFTFTVPLTQTREINFDDIPAAFE 900
            LSRQYGGTGLGLSICRQLATMMNGTMDLKSKLGVGSRFTFTVPLTQTREINFDDIPAAFE
Sbjct: 841  LSRQYGGTGLGLSICRQLATMMNGTMDLKSKLGVGSRFTFTVPLTQTREINFDDIPAAFE 900

Query: 901  DEFNPDSKKNRKVKFXXXXXXXXXXXXXXLMTVGPXXXXXXXXXXXXXXXXXXRSVRLDR 960
            DEFNPDSKKNRKVKF              LMTVGP                  RSVRLDR
Sbjct: 901  DEFNPDSKKNRKVKFKIAKSLKSKRSKSSLMTVGPKSSSSDKSLSQLKLTDSDRSVRLDR 960

Query: 961  PFLQSTGTASSNTNLGTTSTINKILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALD 1020
            PFLQSTGTASSNTNLGTTSTINKILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALD
Sbjct: 961  PFLQSTGTASSNTNLGTTSTINKILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALD 1020

Query: 1021 KVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLD 1080
            KVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLD
Sbjct: 1021 KVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLD 1080

Query: 1081 AGMDGFLAKPIKRAQLRKIIEEFCPDKQPQEQDKEPKSSENDNXXXXXXXXXXXXXXXXX 1140
            AGMDGFLAKPIKRAQLRKIIEEFCPDKQPQEQDKEPKSSENDN                 
Sbjct: 1081 AGMDGFLAKPIKRAQLRKIIEEFCPDKQPQEQDKEPKSSENDNSQLLQQDPQQSKEQKQQ 1140

Query: 1141 XXXXXXXXXXXXXXXXGRETKNKDPQ 1166
                            GRETKNKDPQ
Sbjct: 1141 QQLLPIITTTTSSSSSGRETKNKDPQ 1166

>TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1095

 Score = 1323 bits (3425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 695/1103 (63%), Positives = 806/1103 (73%), Gaps = 31/1103 (2%)

Query: 10   KFQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAAQLKSTQI 69
            KF  P R+ IR QLTALVS+VALVSLIILAV+TGVYFT NYK+LRSERLY+AAQLKS+QI
Sbjct: 10   KFSPPFRISIRTQLTALVSLVALVSLIILAVTTGVYFTSNYKSLRSERLYVAAQLKSSQI 69

Query: 70   DQNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGLFSVATIY 129
            DQNLNY+YYQCYWLSS+ TLQ +LANYV+GNKT ANWVDS +V+QKFL+SS LFSVA +Y
Sbjct: 70   DQNLNYLYYQCYWLSSQSTLQTSLANYVSGNKTDANWVDSSSVLQKFLSSSALFSVARVY 129

Query: 130  DATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNGTSYLMSM 189
            DA F  VL+ATNNGTG+ + +  L +LMPLS N  LP+SL+SEG+LT+PVLNGTSYLMSM
Sbjct: 130  DADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVLNGTSYLMSM 189

Query: 190  SLPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYDQNETLSS 249
            SLPI+ANPSIILT S VYGY+TI+MSADSLK+V+DD TALEKS+V I+SA+Y +++ L S
Sbjct: 190  SLPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAIYKKDQGLGS 249

Query: 250  YNFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVAVGYSPCSVV 309
            Y FVFAP G    IL ET PI N +FLS+ALRQGK G+ +RT   Y +  AVGYSPCS  
Sbjct: 250  YRFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSAVGYSPCSFK 309

Query: 310  FVNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIVRLQKATE 369
            FVNW+A++ QSEAVFMEP+T+LTKII G VVGIG FVC+ TFPLAHWAV+PIVRLQKATE
Sbjct: 310  FVNWVAIISQSEAVFMEPSTRLTKIIIGVVVGIGAFVCIATFPLAHWAVQPIVRLQKATE 369

Query: 370  LITEGRGLRASSPGAGSSNVSRRSSFFHRPSNCGSSIRSRVTDNHNEKGHDLHGEQIQHG 429
            +ITEGRGLR+ +PG+ S + +             S IR R + + + +   L  E+   G
Sbjct: 370  IITEGRGLRSGTPGSSSVSRNS------------SFIRRRFSGSSSVRSPSLADEKGAVG 417

Query: 430  FFAMNGSINHSLAASIASSGNEALSDKSKGLTTSANLIEARVPVYRRFFSDELSELTDTF 489
              +  GS N+  A    +S  E  SD+++   TS+NL+EARVPVYR FFSDE SELTDTF
Sbjct: 418  RASTEGSFNYDQAVPSLNSNAEISSDRTRKYMTSSNLVEARVPVYRIFFSDEFSELTDTF 477

Query: 490  NTMTDALDQHYALLEDRVRARTRQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGM 549
            NTMT+ALDQHYALLEDRVRART+QL             KTVFIANISHELRTPLNGILGM
Sbjct: 478  NTMTNALDQHYALLEDRVRARTKQLEAAKVEAEAANEAKTVFIANISHELRTPLNGILGM 537

Query: 550  TAISMEERDIDKIQNSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTKLEKRNFSVTDVALQ 609
            TAISMEERDIDKIQ+SLKLIFRSG            FSKNVL+RTKLEKR+FS+TDVA+Q
Sbjct: 538  TAISMEERDIDKIQSSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFSITDVAVQ 597

Query: 610  IKSIFGKVAKDQRVRLSITLYPNLIRTMVLFGDSNRIIQIVMNLVSNALKFTPVDGKVNV 669
            IKSIFGKVAKDQRV+ SITL+PN IR MVL+GDSNRIIQIVMNLVSNALKFTPVDGKV+V
Sbjct: 598  IKSIFGKVAKDQRVKFSITLFPNQIRKMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVSV 657

Query: 670  YMSLLGEYDAERSENENHKKVYVIPGTEPXXXXXXXXXXXXXXXRFSIEXXXXXXXXXXX 729
             M LLGEYD +RSENE+ K VYVI GTEP               +  +E           
Sbjct: 658  RMRLLGEYDKQRSENEDFKAVYVIDGTEPREDGLIPPPVKQFEKQEDLE------KEKIS 711

Query: 730  XKHSDTETTPGLNDTDEKQAXXXXXXXXXXXXXXXXXXXXXXXXXXYNDTVFHSQFKKTP 789
             KH++ E +       EK                            Y+DT+FH+QFKK  
Sbjct: 712  EKHNEEEAS---TSDSEKTNLDDKTPDSKRSDADDQVSLISISTSSYDDTIFHTQFKKH- 767

Query: 790  KVCDDSSEELGVEVKDKKKWVISIVVEDTGPGIDSSLHESVFEPFVQGDQALSRQYGGTG 849
                 S +E G  ++  K W IS+ VEDTGPGID SLHESVFEPFVQGDQALSRQYGGTG
Sbjct: 768  --TSSSGDENGHLLEHPKNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQALSRQYGGTG 825

Query: 850  LGLSICRQLATMMNGTMDLKSKLGVGSRFTFTVPLTQTREINFDDIPAAFEDEFNPDSKK 909
            LGLSICRQLATMMNGTM L SKLGVGS+FTFT+PLTQTREI F+D   AFEDEFNP SKK
Sbjct: 826  LGLSICRQLATMMNGTMKLDSKLGVGSKFTFTLPLTQTREIEFED-ENAFEDEFNPLSKK 884

Query: 910  NRKVKFXXXXXXXXXXXXXXLMTVGPXXXXXXXXXXXXXXXXXXRS---VRLDRPFLQST 966
            NRKVKF              L                        S   V LDRPFLQST
Sbjct: 885  NRKVKFKVAKSIKSRKSKSSLSNSSGKGGSSDKSSKQLKGSESEFSVGNVSLDRPFLQST 944

Query: 967  GTASSNTNLGTTSTINK---ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVK 1023
            GTASS+ N+   S +NK   ILVAEDN VNQEVIKRML LEG+  I+L  DGQ+A DKVK
Sbjct: 945  GTASSSKNVTVVSNVNKSYRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVK 1004

Query: 1024 QLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLDAGM 1083
             L E GEHY LIFMDVQMPK+DGLL+TKMIR+DL+Y +PIVALTAFADDSNIR CL+AGM
Sbjct: 1005 ALQEKGEHYELIFMDVQMPKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGM 1064

Query: 1084 DGFLAKPIKRAQLRKIIEEFCPD 1106
            +GFL+KPIKR +L+ II ++C D
Sbjct: 1065 NGFLSKPIKRPKLKTIIAQYCHD 1087

>SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} similar
            to uniprot|P39928 Saccharomyces cerevisiae YIL147C SLN1
            Histidine kinase osmosensor that regulates a MAP kinase
            cascade; transmembrane protein with an intracellular
            kinase domain that signals to Ypd1p and Ssk1p, thereby
            forming a phosphorelay system similar to bacterial
            two-component regulators
          Length = 1140

 Score = 1235 bits (3195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 641/1126 (56%), Positives = 787/1126 (69%), Gaps = 35/1126 (3%)

Query: 10   KFQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAAQLKSTQI 69
            K + P ++GIR QL ALV +VAL+SL+ILAV+TGVYFT NYK+LR++RL++AAQLKS+QI
Sbjct: 10   KLKPPFKVGIRTQLIALVCVVALLSLVILAVTTGVYFTANYKSLRADRLHVAAQLKSSQI 69

Query: 70   DQNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGLFSVATIY 129
            DQNLNY+YYQCYWLS+RDTLQ++L  Y AGN T  NW ++  V++KFL SS LFSVA IY
Sbjct: 70   DQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVARIY 129

Query: 130  DATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNGTSYLMSM 189
            D+TF  VL+ATNNG+GN +PE  L  L PLS + PL SSLQ+ GILT+PVLN T Y+MSM
Sbjct: 130  DSTFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTVYVMSM 189

Query: 190  SLPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYDQNETLSS 249
            SLPIFA+PSI+LT S + GYIT+VMSA+SLK VF+DTTAL+KS+VAILSA Y       S
Sbjct: 190  SLPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQSLPVS 249

Query: 250  YNFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVAVGYSPCSVV 309
            Y+FVF P GV + I+  +  I+NG+F+ SA    K G+++RT F Y K VAVGYSPC   
Sbjct: 250  YHFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYSPCLFK 309

Query: 310  FVNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIVRLQKATE 369
             V W+AV+ Q E VF+ P+T+LT II GT +GI VF+CLVTFPLAHWAVKPIVRLQKATE
Sbjct: 310  QVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQKATE 369

Query: 370  LITEGRGLRASSPGAGSSNVSRRSSFFHRPSNCGS--SIRSRVTDNHNEK--GH---DLH 422
            +IT  RGLR+ +  A +   SR +SF  RPS   S  S+   +TD  +E+  GH   +LH
Sbjct: 370  IITARRGLRSYNQSAPA---SRTNSFRKRPSTSSSIGSVFRTITDRPHERDNGHSNFELH 426

Query: 423  -------GEQIQHGFFAMNGSINHSLAASIASSGNEALSDKSKGLTTSANLIEARVPVYR 475
                     Q       ++G++  +   +  S  N+  S KS     S NLI+ARVPVY 
Sbjct: 427  HRTSNSVDSQEARMELEISGALPDTNPTTPTSYTNDQHSYKSDNFVNSTNLIDARVPVYG 486

Query: 476  RFFSDELSELTDTFNTMTDALDQHYALLEDRVRARTRQLXXXXXXXXXXXXXKTVFIANI 535
            R FSDELSELTDTFNTMTD LD+HYALLEDRVRART+QL             KTVFIANI
Sbjct: 487  RLFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLEAAKIEAEAANEAKTVFIANI 546

Query: 536  SHELRTPLNGILGMTAISMEERDIDKIQNSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTK 595
            SHELRTPLNGILGMTAISM E+D+ K+QNSLKLIFRSG            FSKNVL+RTK
Sbjct: 547  SHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGELLLHILTELLTFSKNVLQRTK 606

Query: 596  LEKRNFSVTDVALQIKSIFGKVAKDQRVRLSITLYPNLIRTMVLFGDSNRIIQIVMNLVS 655
            LE+RNF++ DVALQ+KSIFGK+AKDQ V LSI L PN+IRTM+L+GDSNRIIQIVMNLVS
Sbjct: 607  LEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMILWGDSNRIIQIVMNLVS 666

Query: 656  NALKFTPVDGKVNVYMSLLGEYDAERSENENHKKVYVIPGTE-PXXXXXXXXXXX----- 709
            NALKF+PVDGKV V + LLGEYD ++S++ N+  V++ PGTE P                
Sbjct: 667  NALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEIPDASASKSSLSTLEYTK 726

Query: 710  --XXXXRFSIEXXXXXXXXXXXXKHSDTETTPGLNDTDEKQA-XXXXXXXXXXXXXXXXX 766
                  R + +              SD  ++ G    DE +A                  
Sbjct: 727  VDAIQRRLASKSSDSQKLKEEPIASSDVSSSDG---KDESEADTDTDTDKRSNSEISDSL 783

Query: 767  XXXXXXXXXYNDTVFHSQFKKTPKV--CDDSSEELGVEVKDKKKWVISIVVEDTGPGIDS 824
                     Y+D + H+Q +K P     +DS + LG +++  K WVI+I VEDTGPGI+ 
Sbjct: 784  SLVSSNNSSYDDAILHAQLRKVPSCGNGEDSGDSLGRKLEISKTWVIAIEVEDTGPGIEP 843

Query: 825  SLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMDLKSKLGVGSRFTFTVPL 884
            +LHESVFEPFVQGDQ LSRQYGGTGLGLSICRQLA MM GTM L+SK+GVGS+FTFTVPL
Sbjct: 844  ALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLESKVGVGSKFTFTVPL 903

Query: 885  TQTREINFDDIPAAFEDEFNPDSKKNRKVKFXXXXXXXXXXXXXXLMT-VGPXXXXXXXX 943
            TQTRE++FDD+   FEDEFN  SKKNRKVKF              + T +          
Sbjct: 904  TQTREVSFDDVENPFEDEFNAHSKKNRKVKFKMNKNSGGSKSRPSVNTSLNSGTDSTAEK 963

Query: 944  XXXXXXXXXXRSVRLDRPFLQSTGTASSNTNLGTTSTIN---KILVAEDNDVNQEVIKRM 1000
                       SVR+DRPFLQSTGTA+S  ++ T  ++    KILVAEDN+VNQEV+KRM
Sbjct: 964  MALSESEVSVGSVRVDRPFLQSTGTATSTRSITTVKSLERPFKILVAEDNNVNQEVVKRM 1023

Query: 1001 LNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNYT 1060
            LNLEG+ +I+L CDGQEA DKVK L E  +HY +IFMDVQMP++DGLLSTKMIR++L Y+
Sbjct: 1024 LNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPRVDGLLSTKMIRQELRYS 1083

Query: 1061 HPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEFCPD 1106
            HPIVALTAFADDSNI+ CLD+GM+GFL+KPIKR +L+ ++ EFCPD
Sbjct: 1084 HPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLKSVLSEFCPD 1129

>Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON}
            (202108..205449) [3342 nt, 1114 aa]
          Length = 1113

 Score = 1200 bits (3105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 639/1122 (56%), Positives = 780/1122 (69%), Gaps = 38/1122 (3%)

Query: 3    MRQLMFGKFQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAA 62
            MRQ     F+ P R+ IRAQLTALVS+VA++SLIILAV+TGVYFT+NYK LRS RL +AA
Sbjct: 1    MRQSWRKAFKPPYRITIRAQLTALVSLVAIISLIILAVTTGVYFTENYKELRSGRLNIAA 60

Query: 63   QLKSTQIDQNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGL 122
            +LKS+QIDQ LNY++YQC +L+SRDTLQ AL NY AGNKTY NW++S NV+QKFL+SS L
Sbjct: 61   KLKSSQIDQTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDL 120

Query: 123  FSVATIYDATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNG 182
            F VA +YD  F  V++ATNNGTG+ IP   L  L PLS N+ LPSSL ++GILT+PVLNG
Sbjct: 121  FYVARLYDLNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNG 180

Query: 183  TSYLMSMSLPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYD 242
            + YLMSMSLPI  NPSIIL++S VYGYITIVMSAD LKNV+ + TALE SNV ++SA+Y+
Sbjct: 181  SIYLMSMSLPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYN 240

Query: 243  QNETLSSYNFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVAVG 302
                +  ++FVF       S L E  PI+NGT+LSSAL +GK G++++TK+ + +++A+G
Sbjct: 241  DQGKVDGFHFVFEVENDDFSTLIE-YPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIG 299

Query: 303  YSPCSVVFVNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIV 362
            YSPCS    NW+A+V Q EAVF+ P+TKL KIISGTVV I VFVCL+TFPL+HWAVKPIV
Sbjct: 300  YSPCSFSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIV 359

Query: 363  RLQKATELITEGRGLRASS-----PGAGSSNVSRRSSFFHRPSNCGSSIRSRVTDNHNEK 417
            RLQKATELI++GRGL+ +S       + +S+  R S   H  ++ G   +S   +  NE 
Sbjct: 360  RLQKATELISQGRGLKPTSNFSNGDSSSTSDNWRESVESHVRASLG-IFKSLRNNGSNEL 418

Query: 418  GHDLHGEQIQHGFFAMNGSINHSLAASIASSGNEALSDKSKGLTTSANLIEARVPVYRRF 477
              +    +I         S N+S   +I SS N++ S   +   T++NL++ARVPVY RF
Sbjct: 419  QSNDDMNEINE-----RSSKNNSTGDNIKSSDNDSSSSFQR--YTTSNLVQARVPVYGRF 471

Query: 478  FSDELSELTDTFNTMTDALDQHYALLEDRVRARTRQLXXXXXXXXXXXXXKTVFIANISH 537
              DELSELTDTFN MT+ALDQHY LLEDRVRART+QL             KTVFIANISH
Sbjct: 472  LQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISH 531

Query: 538  ELRTPLNGILGMTAISMEERDIDKIQNSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTKLE 597
            ELRTPLNGILGMTAISMEE D DKI+ +LKLIFRSG            FSKNVLKRT LE
Sbjct: 532  ELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGELLLHILTELLTFSKNVLKRTNLE 591

Query: 598  KRNFSVTDVALQIKSIFGKVAKDQRVRLSITLYPNLIRTMVLFGDSNRIIQIVMNLVSNA 657
            KR+F +T++ALQIKSIFGKVA+DQ V+L I L PN IR+MVL+GDSNRIIQIVMNLVSNA
Sbjct: 592  KRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWGDSNRIIQIVMNLVSNA 651

Query: 658  LKFTPVDGKVNVYMSLLGEYDAERSENENHKKVYVIPGTE-PXXXXXXXXXXXXXXXRFS 716
            LKFTP+DGKV+V + LLGEYD ERS N+++K+VY+  GTE P                 S
Sbjct: 652  LKFTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTELPIGNGKKTDMVRKKIQELS 711

Query: 717  IEXXXXXXXXXXXXKHSDTETTPGLNDTDEKQAXXXXXXXXXXXXXXXXXXXXXXXXXXY 776
             +              S +     L + +EK +                          Y
Sbjct: 712  EKDCIEGDTASSGSHMSGSSKIDKLIEDEEKNS---FSDNEDTNNDIEILSMTTSSTRSY 768

Query: 777  NDTVFHSQFKKTPKVCDDSSEELGVEVKDKKKWVISIVVEDTGPGIDSSLHESVFEPFVQ 836
            +D     QFKKTP + DD  E LGVE+ + K WVIS+ VEDTGPGI+  L E+VFEPFVQ
Sbjct: 769  DDAALQRQFKKTPDL-DDKEETLGVELSEPKTWVISVEVEDTGPGIEPKLQEAVFEPFVQ 827

Query: 837  GDQALSRQYGGTGLGLSICRQLATMMNGTMDLKSKLGVGSRFTFTVPLTQTREINFDDIP 896
            GDQALSRQYGGTGLGLSICRQLATMM+GTM L+S +GVGS+F FTVPL QTREI+FDD  
Sbjct: 828  GDQALSRQYGGTGLGLSICRQLATMMHGTMKLESTVGVGSKFIFTVPLKQTREIHFDD-- 885

Query: 897  AAFEDEFNPDSKKNRKVKFXXXXXXXXXXXXXX-----LMTVGPXXXXXXXXXXXXXXXX 951
              FEDEFN +SKKNR++KF                     +                   
Sbjct: 886  EKFEDEFNAESKKNRRIKFKIYDSSKSHDSNDEDEEGIKSSRDIDSSNNEHKDENGTSPD 945

Query: 952  XXRSVRLDRPFLQSTGTASSNTNLGTTSTINK----------ILVAEDNDVNQEVIKRML 1001
                VRLDRPFLQSTGTA+S+  + T   INK          ILVAEDN VNQEVIKRML
Sbjct: 946  NHSKVRLDRPFLQSTGTATSSQKIPT--LINKEDTNIEKSIRILVAEDNHVNQEVIKRML 1003

Query: 1002 NLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNYTH 1061
            NLE + NI+L CDGQ+A DKVK L +N E+Y++IFMDVQMPK+DGL+STKMIR+DLNY H
Sbjct: 1004 NLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRKDLNYKH 1063

Query: 1062 PIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEF 1103
            PIVALTAFA+D NI+ECLDAGMDGFL KPIKR +L++I++E+
Sbjct: 1064 PIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105

>Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {ON}
            YIL147C (SLN1) - histidine kinase osmosensor that
            regulates an osmosensing MAP kinase cascade and is
            similar to bacterial two-component regulators [contig
            159] FULL
          Length = 1143

 Score = 1181 bits (3056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 608/1129 (53%), Positives = 772/1129 (68%), Gaps = 50/1129 (4%)

Query: 10   KFQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAAQLKSTQI 69
            + + P+ + IR QLTALV +VAL+SLIILAV TGVYFT ++K+LR+ERL++AAQLKS+QI
Sbjct: 16   RLRRPLVVSIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSLRAERLHVAAQLKSSQI 75

Query: 70   DQNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGLFSVATIY 129
            DQNLNY+YYQCYWLS+RD LQ AL  Y+AGN +  NW D+   + KFL SS LFS+A +Y
Sbjct: 76   DQNLNYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLDKFLGSSNLFSLARVY 135

Query: 130  DATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNGTSYLMSM 189
            D++F  VL+ +NNG+GN IPE+ L +L PLS +  LPSSL+  G+LT+PVLNG+ YLMSM
Sbjct: 136  DSSFQDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGMLTDPVLNGSVYLMSM 195

Query: 190  SLPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYDQNETLSS 249
            SLPIFANPSIIL+T+ VYGYIT+V+SA+ LK+V++DTTAL+ S+V I+S VYD +E L+ 
Sbjct: 196  SLPIFANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSVIIVSTVYDDHE-LAG 254

Query: 250  YNFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVAVGYSPCSVV 309
            Y+ VF P  +   ++ E   I+NG+FL  A++ GKGG+++ T+F   KK+AVGYSPC+  
Sbjct: 255  YHLVFPPYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFNNKKIAVGYSPCNST 314

Query: 310  FVNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIVRLQKATE 369
               W+A++ Q EA+F+ P+T+L KII GT + I V  C+VTFPL+HWAV+PIVRLQKATE
Sbjct: 315  LAQWVAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSHWAVQPIVRLQKATE 374

Query: 370  LITEGRGLRASSPGA-----------------GSSNVSRRSSFFH--RPSNCGSSIRSRV 410
            +IT GRGLR+ +                    G+ +V R  S     R      S +   
Sbjct: 375  IITAGRGLRSDNSSTLFSHKRTSTAESFSSIFGTGSVRRSGSVARAGRDKYIPDSSKEVP 434

Query: 411  TDNHNEKGHDLHGEQIQH-GFFAMNGSINHSLAASIASSGNEALSDKSKGLTTSANLIEA 469
              N ++  H+++ E I+      +N    +S+        NE+ + KS+   TS NLIEA
Sbjct: 435  RGNSSDAIHEVNQENIEDIEMQKVNSPTPYSMM-------NESQAVKSERYITSTNLIEA 487

Query: 470  RVPVYRRFFSDELSELTDTFNTMTDALDQHYALLEDRVRARTRQLXXXXXXXXXXXXXKT 529
            RVPVY+R FSDELSELT+TFNTMTD LD+HYALLEDRVRARTRQL             KT
Sbjct: 488  RVPVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGANEAKT 547

Query: 530  VFIANISHELRTPLNGILGMTAISMEERDIDKIQNSLKLIFRSGXXXXXXXXXXXXFSKN 589
            VFIANISHELRTPLNGILGMTAI+M E D  K+++SLKLIFRSG            FSKN
Sbjct: 548  VFIANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSGELLLHIMTELLTFSKN 607

Query: 590  VLKRTKLEKRNFSVTDVALQIKSIFGKVAKDQRVRLSITLYPNLIRTMVLFGDSNRIIQI 649
            VLKRTKLE+R+F + D+ALQ++SIFGK+AKDQ V L+I++ PNL+R+MVL+GDSNRI+QI
Sbjct: 608  VLKRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTISILPNLLRSMVLWGDSNRIVQI 667

Query: 650  VMNLVSNALKFTPVDGKVNVYMSLLGEYDAERSENENHKKVYVIPGTEPXXXXXXXXXXX 709
            VMNLVSNALKFTPVDGKV+V   LLGEYD E+S+   +K+V+V+P   P           
Sbjct: 668  VMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVFVLP---PTESRTSSTEAK 724

Query: 710  XXXXRFSIEXXXXXXXXXXXXKHSDTETTPGLNDTDEKQAXXXXXXXXXXXXXXXXXXXX 769
                  S                S  E    +    E +A                    
Sbjct: 725  DEKNAESCVDSDTNVLSLPSTAESTDEKNVKIGQRSESEAIDSEAIESSDEDDENEDTKS 784

Query: 770  --XXXXXXYNDTVFHSQFKKTPKVCDDSSEE--LGVEVKDKKKWVISIVVEDTGPGIDSS 825
                    Y+D +F ++ +K     D S+EE   G  ++  KKWVIS+ V DTGPGID +
Sbjct: 785  IGSGNTSSYDDAIFQTRLRK-----DSSNEENEEGRALESPKKWVISMEVHDTGPGIDPA 839

Query: 826  LHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMDLKSKLGVGSRFTFTVPLT 885
            LHESVFEPFVQGDQ LSRQYGGTGLGLSICRQLATMM+GTM L S++GVGS+F+FTVPLT
Sbjct: 840  LHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLDSQVGVGSKFSFTVPLT 899

Query: 886  QTREINFDDIPAAFEDEFNPDSKKNRKVKFXXXXXXXXXXXXXXLMTV------GPXXXX 939
            QT+E+ F+D+   FEDEFNPDSKKNRKVKF                         P    
Sbjct: 900  QTKELLFEDVENPFEDEFNPDSKKNRKVKFRMGKSNKRSKSRSESSGTEGNGGNSPGVEG 959

Query: 940  XXXXXXXXXXXXXXRSVRLDRPFLQSTGTASSNTNLGTTSTI---NKILVAEDNDVNQEV 996
                           SVR+DRPFLQSTGTA S T L TTS++    KILVAEDN+VNQEV
Sbjct: 960  SGGNSPGTGSEVSVGSVRVDRPFLQSTGTALSTT-LVTTSSLADRRKILVAEDNNVNQEV 1018

Query: 997  IKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRD 1056
            IKRMLNLEG+ ++EL CDGQ+A DKVK     G+HY+LIFMDVQMP++DGL +T+MIR++
Sbjct: 1019 IKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIRKE 1078

Query: 1057 LNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEFCP 1105
            L Y+HPIVALTAFADDSNI+ECLDAGM+GFL+KPIKR +++ I++E+CP
Sbjct: 1079 LGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEYCP 1127

>KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {ON}
            similar to uniprot|P39928 Saccharomyces cerevisiae
            YIL147C SLN1 Histidine kinase osmosensor that regulates a
            MAP kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1155

 Score = 1153 bits (2982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 603/1151 (52%), Positives = 769/1151 (66%), Gaps = 59/1151 (5%)

Query: 10   KFQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAAQLKSTQI 69
            +F  P  +G+R QL  LV  + ++SL I+ V+TGVYFT NYK++R+ERL +AAQLKS+Q+
Sbjct: 17   RFTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAAQLKSSQV 76

Query: 70   DQNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGLFSVATIY 129
            DQNLNY+YYQ YWLS+RDTLQ+AL N+ AGN +  NW  + + ++KFL SSGLFS A +Y
Sbjct: 77   DQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGLFSAARVY 136

Query: 130  DATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNGTSYLMSM 189
            D +F  V+++TNNG+G++IPE+ L  L PLSG +PL SSL + GI+T+PV N T+YL+SM
Sbjct: 137  DTSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNWTNYLLSM 196

Query: 190  SLPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYDQNETLSS 249
            SLP+  NPSIIL T+ + GYIT++ SA+SLK V +DT AL+KS+V+ILSAV+D N +L+ 
Sbjct: 197  SLPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVFDSNSSLTG 256

Query: 250  YNFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVAVGYSPCSVV 309
            Y+FVF P G  S     T PIKNGTF++ A   GK G++ +T  +  + +AVGYSP +  
Sbjct: 257  YHFVFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAVGYSPPTFK 316

Query: 310  FVNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIVRLQKATE 369
             VNW+AVV Q E VF+ P  +L KII+GTV  I VF+CL+TFP+AHWAV+PIVRLQKATE
Sbjct: 317  LVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQKATE 376

Query: 370  LITEGRGLRA-SSPGAGSSNVSRRSSFFHRPSNCGSSIRSRVTDNHNE----------KG 418
            +IT GR L+  S+ G   SN +   S            R+R T N N+          KG
Sbjct: 377  IITSGRDLKHYSNTGNSDSNTAITHS------------RTRSTSNQNQVMKLFNKSVTKG 424

Query: 419  HDLHGEQIQHGFFAMNGSINHSLAA--------------SIASSGNEALSDKSKGLTT-- 462
               +     +  F  + + + S++A                A++G+   S+ S   T+  
Sbjct: 425  TPSNYLNHNYNVFPPSRTDSPSVSARNSQTIPRGPGDLTRSATTGSTPFSNDSSSYTSER 484

Query: 463  ---SANLIEARVPVYRRFFSDELSELTDTFNTMTDALDQHYALLEDRVRARTRQLXXXXX 519
               S NL+EA VPVYRRFF DELSELTDTFNTMTD LD+HYALLE+RVRART+QL     
Sbjct: 485  YIKSTNLVEAYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAAKI 544

Query: 520  XXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQNSLKLIFRSGXXXXXX 579
                    KTVFIANISHELRTPLNGILGMTAI+M E D+ K+QNSLKLIFRSG      
Sbjct: 545  QAESANEAKTVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGELLLHI 604

Query: 580  XXXXXXFSKNVLKRTKLEKRNFSVTDVALQIKSIFGKVAKDQRVRLSITLYPNLIRTMVL 639
                  FSKNVLKRTKLE+R+FSV D+ALQIKSIFGK+AKDQ V+LSI L PN IRT+VL
Sbjct: 605  LTELLTFSKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIRTLVL 664

Query: 640  FGDSNRIIQIVMNLVSNALKFTPVDGKVNVYMSLLGEYDAERSENENHKKVYVIPGTEPX 699
            +GDSNRIIQIVMNLVSNALKFTPVDGKV+V + LLGEYD++RSE+ ++++V+V+PG+E  
Sbjct: 665  WGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGSEAN 724

Query: 700  XXXXXXXXXXX------XXXRFSIEXXXXXXXXXXXXK------HSDTETTPGLNDTDEK 747
                                  S+             K        ++ET+   ND DE 
Sbjct: 725  DDFEFNLTSTTPMRLPFNSSSGSVNTATKDGSTSPTTKTKEGSIQVESETSTEGNDNDES 784

Query: 748  QAXXXXXXXXXXXXXXXXXXXXXXXXXXYNDTVFHSQFKKTPKVCD-DSSEELGVEVKDK 806
                                        Y+D +FHSQFKK     D D+ E    ++K  
Sbjct: 785  SIVLESKHEENEDEKEKMSILSTSTSSSYDDAIFHSQFKKVLSSTDSDTEENTFRDLKVP 844

Query: 807  KKWVISIVVEDTGPGIDSSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTM 866
            K WVIS+ VEDTG GID SL ESVFEPFVQGDQ LSRQYGGTGLGLSICRQLA MM GTM
Sbjct: 845  KTWVISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTM 904

Query: 867  DLKSKLGVGSRFTFTVPLTQTREINFDDIPAAFEDEFNPDSKKNRKVKFXXXXXXXXXXX 926
             L SK+GVGS+F FTVPL QT+EI FD     FEDEFN  S+KNRKVKF           
Sbjct: 905  KLDSKVGVGSKFIFTVPLQQTKEIVFDGAEKQFEDEFNIHSRKNRKVKFKINSSRKSVQT 964

Query: 927  XXXLMTV-GPXXXXXXXXXXXXXXXXXXRSVRLDRPFLQSTGTASSNTNLGTTS---TIN 982
                 ++ G                    +VR+DRPFLQSTGTA+S  ++ + +   T +
Sbjct: 965  KKSKSSIDGHSDNNVSERKASNSTENSVGNVRVDRPFLQSTGTATSTRSISSVASEVTRH 1024

Query: 983  KILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMP 1042
            ++LVAEDN+VNQEVIKRML LEG+ ++++ CDGQEA +KV+++++NGE Y++IFMDVQMP
Sbjct: 1025 RVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMP 1084

Query: 1043 KMDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEE 1102
            ++DGLL+TKMIR DL Y  PIVALTA+ADDSNI+ CL++GMDGFL KPIKR  L+KII +
Sbjct: 1085 RVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMDGFLPKPIKRPLLKKIIAQ 1144

Query: 1103 FCPDKQPQEQD 1113
            +C  K+ Q ++
Sbjct: 1145 YCSKKEKQREE 1155

>TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_5.700
            YIL147C
          Length = 1127

 Score = 1109 bits (2869), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 613/1153 (53%), Positives = 762/1153 (66%), Gaps = 76/1153 (6%)

Query: 5    QLMFGKF-QSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAAQ 63
            QL+  KF + P R+ IRAQLTALVS+VA++SLIILAV+ GVYFT NYKNL++ RLY+AAQ
Sbjct: 2    QLIPKKFWKPPYRISIRAQLTALVSLVAIISLIILAVTAGVYFTANYKNLKTGRLYIAAQ 61

Query: 64   LKSTQIDQNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGLF 123
            LK++QIDQ LNY+YYQCY+LSS +TLQ +L +Y AGN +  NW +S  V++KFLTSS LF
Sbjct: 62   LKASQIDQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLF 121

Query: 124  SVATIYDATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNGT 183
            SVA +YD  F  +++ATNN +GN++PES +D+L  LS N  LPSSL++ GI T+PVLNG+
Sbjct: 122  SVARLYDTNFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGS 181

Query: 184  SYLMSMSLPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYDQ 243
            ++LMSMSLPIFANPSIIL+ S +YGY++++MSA+ LK+VF+DTTALE S V ++SA Y  
Sbjct: 182  NFLMSMSLPIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSI 241

Query: 244  NETLSSYNFVFAPLGVPSSILAET-IPIKNGTFLSSALRQGKGGALERTKFLYTKKVAVG 302
               L  +NF+FA     +    +    I N TF+ + L  GKGGA+++T        AVG
Sbjct: 242  TTNLEYFNFLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVG 301

Query: 303  YSPCSVVFVNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIV 362
            YS CS   VNW+A+V Q EA F E ATKL +IISG VV + VFVCL+TFPL+HWAV+P++
Sbjct: 302  YSSCSFSLVNWLAIVAQPEAAFSESATKLERIISGVVVAVAVFVCLLTFPLSHWAVQPLI 361

Query: 363  RLQKATELITEGRGLRASSPGAGSSNVSRRSSFFHRPSNCGSSIRSRVTDNHNEKGHDLH 422
            RLQKATE I EGRGLR   P  GSS VSR SS   R S   + +RS +  N N+      
Sbjct: 362  RLQKATERIAEGRGLRPPQPTVGSS-VSRNSSIKWRNS-LENHVRSSLGFNANK------ 413

Query: 423  GEQIQHGFFAMNGSI-----------------------NHSLAASIASSGNEALSDKSKG 459
                     + +GSI                       N+S  +S+  + ++ LS  S+ 
Sbjct: 414  --------LSDSGSITANNFKNNTSSSNSITSSHIYGNNNSSHSSMGINPDDDLSSSSQK 465

Query: 460  LTTSANLIEARVPVYRRFFSDELSELTDTFNTMTDALDQHYALLEDRVRARTRQLXXXXX 519
              TSANLIEARVPVY R   DELSELTDTFNTMTDALDQHY LLE+RVRART+QL     
Sbjct: 466  YKTSANLIEARVPVYWRLLQDELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAKI 525

Query: 520  XXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQNSLKLIFRSGXXXXXX 579
                    KTVFIANISHELRTPLNGILGMTAISMEE D+DKI+ +LKLIFRSG      
Sbjct: 526  QAESANEAKTVFIANISHELRTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSGELLLHI 585

Query: 580  XXXXXXFSKNVLKRTKLEKRNFSVTDVALQIKSIFGKVAKDQRVRLSITLYPNLIRTMVL 639
                  FSKNVL+RTKLEKR+F +T+VALQIKSIFGK+AKDQ V+LSI L PN++R+ VL
Sbjct: 586  LTELLTFSKNVLQRTKLEKRDFCITEVALQIKSIFGKLAKDQHVKLSIILMPNILRSYVL 645

Query: 640  FGDSNRIIQIVMNLVSNALKFTPVDGKVNVYMSLLGEYDAERSENENHKKVYVIPGTE-P 698
            +GDSNRIIQ+VMNLVSNALKFTPVDG V+V ++LLGEYD ERS+ E++KKVYV  GTE P
Sbjct: 646  WGDSNRIIQVVMNLVSNALKFTPVDGNVDVRINLLGEYDEERSKAEDYKKVYVKQGTELP 705

Query: 699  XXXXXXXXXXXXXXXRFSIEXXXXXXXXXXXXKHSDTETTPGLNDTDEKQAXXXXXXXXX 758
                           R S                ++T T    +  D             
Sbjct: 706  LNISHLKTEENNDISRKS--------ETELNNDENETHTISKDDTADSSIKIGNEDVEIS 757

Query: 759  XXXXXXXXXXXXXXXXXYNDTVFHSQFKKTPKVCDDSSEELGVEVKDKKKWVISIVVEDT 818
                             Y+DT    Q  K+  + DD   +LGVE+K++K WVIS+ V+DT
Sbjct: 758  EVDKMGMASLVTTSSKSYDDTALMKQLIKSTDL-DDDENKLGVELKEQKTWVISVEVKDT 816

Query: 819  GPGIDSSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMDLKSKLGVGSRF 878
            G GID  L ESVFEPFVQGDQALSRQYGGTGLGLSIC+QL+TMMNGTM+L+S++GVGS+F
Sbjct: 817  GSGIDPKLQESVFEPFVQGDQALSRQYGGTGLGLSICKQLSTMMNGTMELESEVGVGSKF 876

Query: 879  TFTVPLTQTREINFDDIPAAFEDEFNPDSKKNRKVKFXXXXXXXXXXXXXXLMTVGPXXX 938
             FT+PL QTREI+  D    F DEFN  SKKNRKVKF                ++G    
Sbjct: 877  IFTLPLKQTREISIPD-DELFNDEFNAVSKKNRKVKFKFSGSSSAKSIKTR-NSIGSSLN 934

Query: 939  XXXXXXXXXXXXXXX--------RSVRLDRPFLQSTGTASSNTNLGT----------TST 980
                                    SVRL+RPFLQSTGTA+S  N+ T             
Sbjct: 935  NRHSTTSIDSSSSDSDEEDNVRPSSVRLNRPFLQSTGTATSTQNVPTLNAHTDDKSKNKV 994

Query: 981  INK-----ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLI 1035
            +NK     ILVAEDN VNQEVIKRML LEG++NI+L  DGQ+A DK K L EN  +Y++I
Sbjct: 995  LNKMDLIYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDII 1054

Query: 1036 FMDVQMPKMDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQ 1095
            FMDVQMP++DGL +TKMIR +LNYT PIVAL+AF  + N++ECLD GM+ FL+KPIKR  
Sbjct: 1055 FMDVQMPRLDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPD 1114

Query: 1096 LRKIIEEFCPDKQ 1108
            L+ I++++  D Q
Sbjct: 1115 LKIILKKYIEDFQ 1127

>KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1200

 Score = 1087 bits (2812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 569/953 (59%), Positives = 666/953 (69%), Gaps = 32/953 (3%)

Query: 1   MWMRQLMFGKFQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYM 60
           MW R   F   + P R+GIRAQLT LVSIVA++SL+ILAV+TGVYFT NYKNLRS+RLY+
Sbjct: 1   MWFRLRSFTP-KPPYRVGIRAQLTMLVSIVAIISLVILAVTTGVYFTSNYKNLRSDRLYI 59

Query: 61  AAQLKSTQIDQNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSS 120
           AAQLKS+QIDQNLNY+YYQCYW++SRDTLQ  LANYVAGNK+ ANW+DS +V++KFL SS
Sbjct: 60  AAQLKSSQIDQNLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSS 119

Query: 121 GLFSVATIYDATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVL 180
            LFSVA +YD++FT VL+ TNN TG+ IPE  L +L+PLS N PLPSSL++ GI+TNPV 
Sbjct: 120 NLFSVARVYDSSFTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVK 179

Query: 181 NGTSYLMSMSLPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAV 240
           NG+SYLMSMSLPIFANPSIILT S VYGY+T+VMSA+ L +VF+DTTALE+S VAI+SAV
Sbjct: 180 NGSSYLMSMSLPIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAV 239

Query: 241 YDQNETLSSYNFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVA 300
           Y     L +Y FVF P G  SSIL ET P+ N TFLSSALRQGKGGAL+ T+  Y  K+A
Sbjct: 240 YTNATKLDAYRFVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLA 299

Query: 301 VGYSPCSVVFVNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKP 360
           VGYSP +    NW+A+V Q+E+VF+ PATKL KII+GTVVGIGVF  L+TFPLAHWAVKP
Sbjct: 300 VGYSPSTSNLANWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKP 359

Query: 361 IVRLQKATELITEGRGLRASSPGAGS---SNVSRRSSFFHRPSNCGSSIR---------- 407
           IVRLQKATELITE RGLR ++P +GS   S +  +SS    P +  S+            
Sbjct: 360 IVRLQKATELITESRGLRPTTPTSGSRANSILRDKSSLISFPLHPVSTNNINNNNSNEKA 419

Query: 408 ---SRVTDNHNEKGHDLHGEQIQHGFFAMNGSINHSLAASIASSGNEALSDKSKGLTTSA 464
              S    N N     +    I+         +   ++ S  S   E LS+ SK  TT+ 
Sbjct: 420 QPPSDQDTNTNNSSSSIAVSNIREEHSPHADGVFSGISLSNVSDRLERLSNTSKHYTTAV 479

Query: 465 NLIEARVPVYRRFFSDELSELTDTFNTMTDALDQHYALLEDRVRARTRQLXXXXXXXXXX 524
           NLI+ARVP YR  F DELS+LT+TFNTMTDALDQHYALLE+RVRART+QL          
Sbjct: 480 NLIQARVPSYRALFKDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEAETA 539

Query: 525 XXXKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQNSLKLIFRSGXXXXXXXXXXX 584
              KTVFIANISHELRTPLNGILGMTAISMEE DIDKI+NSLKLIFRSG           
Sbjct: 540 NEAKTVFIANISHELRTPLNGILGMTAISMEETDIDKIRNSLKLIFRSGELLLHILTELL 599

Query: 585 XFSKNVLKRTKLEKRNFSVTDVALQIKSIFGKVAKDQRVRLSITLYPNLIRTMVLFGDSN 644
            FSKNVLKRTKLEKRNF +TDVALQIKSIFGKVAKDQ VRLSI L PN+IR+MVL+GDSN
Sbjct: 600 TFSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHVRLSIILSPNMIRSMVLYGDSN 659

Query: 645 RIIQIVMNLVSNALKFTPVDGKVNVYMSLLGEYDAERSENENHKKVYVIPGTE--PXXXX 702
           RIIQIVMNLVSNALKFTPVDGKV+V M +LG YD   SE  NH KVYV PGTE       
Sbjct: 660 RIIQIVMNLVSNALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNKVYVKPGTEITDSTPS 719

Query: 703 XXXXXXXXXXXRFSIEXXXXXXXXXXXXKHSDTETTPGLNDTDEKQAXXXXXXXXXXXXX 762
                      +F+ +              +   T     ++DE                
Sbjct: 720 LNVKSEGQGKDKFTSDTASKNNTSSDTAYDATPTTDRVAQESDEDN------------MY 767

Query: 763 XXXXXXXXXXXXXYNDTVFHSQFKKTPKVCDDSSE-ELGVEVKDKKKWVISIVVEDTGPG 821
                        Y+D +F+SQFKKT  + D+  E E+GVE++  K WVIS  VED+GPG
Sbjct: 768 EDNESMISSTTSSYDDAIFNSQFKKTTNLYDEDDESEMGVELETPKTWVISFEVEDSGPG 827

Query: 822 IDSSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMDLKSKLGVGSRFTFT 881
           ID  L ESVFEPFVQGDQ LSRQYGGTGLGLSICRQLA MM G M L+SK+GVGS+FTFT
Sbjct: 828 IDKGLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAGMMKGKMLLESKVGVGSKFTFT 887

Query: 882 VPLTQTREINFDDIPAAFEDEFNPDSKKNRKVKFXXXXXXXXXXXXXXLMTVG 934
           +PLTQTREINF ++   FEDEFN  SKKNRKVKF              ++T G
Sbjct: 888 LPLTQTREINFANVEDPFEDEFNAKSKKNRKVKFRMARSLNSRKSRSSIVTAG 940

 Score =  223 bits (567), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 112/190 (58%), Positives = 134/190 (70%), Gaps = 30/190 (15%)

Query: 955  SVRLDRPFLQSTGTASSNTNLGTTSTIN----------------------------KILV 986
            ++ LDRPFLQSTGTA+S  ++   S+                              KILV
Sbjct: 1010 TMSLDRPFLQSTGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKKTSEGNGAYKILV 1069

Query: 987  AEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPKMDG 1046
            AEDN VNQEVIKRML LEGV +I+L CDGQ+A DKVKQL + G  YNLIFMDVQMPK+DG
Sbjct: 1070 AEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPKVDG 1129

Query: 1047 LLSTKMIRRDLNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEFCPD 1106
            L STKMIR DL+   PIVALTAFADDSNI+ECLDAGMDGFL+KPIKR +L+ I++EFC D
Sbjct: 1130 LTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKEFCSD 1189

Query: 1107 KQPQEQDKEP 1116
            +  +E+D +P
Sbjct: 1190 E--REEDSKP 1197

>YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}
           SLN1Histidine kinase osmosensor that regulates a MAP
           kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1220

 Score = 1033 bits (2671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/948 (58%), Positives = 663/948 (69%), Gaps = 50/948 (5%)

Query: 14  PIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAAQLKSTQIDQNL 73
           P R+GIR QLTALVSIVAL SLIILAV+TGVYFT NYKNLRS+RLY+AAQLKS+QIDQ L
Sbjct: 14  PFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQTL 73

Query: 74  NYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGLFSVATIYDATF 133
           NY+YYQ Y+L+SRD LQ +L +YVAGNK+  NWVDS +VIQKFL+SS LF VA +YD++F
Sbjct: 74  NYLYYQAYYLASRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSSNLFYVAKVYDSSF 133

Query: 134 TPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNGTSYLMSMSLPI 193
             VL+ATNNGTG+ IPE  LD L PLS + PLPSSL++ GILT+PVLN T YLMSMSLPI
Sbjct: 134 NAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVLNSTDYLMSMSLPI 193

Query: 194 FANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYDQNETLSSYNFV 253
           FANPSIILT S VYGYITI+MSA+ LK+VF+DTTALE S +AI+SAVY+     S Y+FV
Sbjct: 194 FANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAVYNSQGKASGYHFV 253

Query: 254 FAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVAVGYSPCSVVFVNW 313
           F P G  S +  +   IKN TF+SSA R GKGG+L++T  L T+  A+GYSPCS   VNW
Sbjct: 254 FPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTALGYSPCSFNLVNW 313

Query: 314 IAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIVRLQKATELITE 373
           +A+V Q E+VF+ PATKL KII+GTV+ IGVFV L+T PLAHWAV+PIVRLQKATELITE
Sbjct: 314 VAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATELITE 373

Query: 374 GRGLRASSPGAGSSNVSRRSSF-------FHRPSN------------------------- 401
           GRGLR S+P      +SR SSF       F  PS+                         
Sbjct: 374 GRGLRPSTP----RTISRASSFKRGFSSGFAVPSSLLQFNTAEAGSTTSVSGHGGSGHGS 429

Query: 402 -----CGSSIRSRVTDNHNEKGHDLHGEQIQHGF----FAMNGSINHSLAA--SIASSGN 450
                  SS++S +   + +        +I +       +M+GS+NH L    S+  +  
Sbjct: 430 GAAFSANSSMKSAINLGNEKMSPPEEENKIPNNHTDAKISMDGSLNHDLLGPHSLRHNDT 489

Query: 451 EALSDKSKGLTTSANLIEARVPVYRRFFSDELSELTDTFNTMTDALDQHYALLEDRVRAR 510
           +  S++S  LTTSANL EAR+P YRR FSDELS+LT+TFNTMTDALDQHYALLE+RVRAR
Sbjct: 490 DRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEERVRAR 549

Query: 511 TRQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQNSLKLIF 570
           T+QL             KTVFIANISHELRTPLNGILGMTAISMEE D++KI+NSLKLIF
Sbjct: 550 TKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIF 609

Query: 571 RSGXXXXXXXXXXXXFSKNVLKRTKLEKRNFSVTDVALQIKSIFGKVAKDQRVRLSITLY 630
           RSG            FSKNVL+RTKLEKR+F +TDVALQIKSIFGKVAKDQRVRLSI+L+
Sbjct: 610 RSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLF 669

Query: 631 PNLIRTMVLFGDSNRIIQIVMNLVSNALKFTPVDGKVNVYMSLLGEYDAERSENENHKKV 690
           PNLIRTMVL+GDSNRIIQIVMNLVSNALKFTPVDG V+V M LLGEYD E SE + +K+V
Sbjct: 670 PNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKELSEKKQYKEV 729

Query: 691 YVIPGT---EPXXXXXXXXXXXXXXXRFSIEXXXXXXXXXXXXKHSDTETTPGLNDTDEK 747
           Y+  GT   E                R S++              S  +      +T   
Sbjct: 730 YIKKGTEVTENLETTDKYDLPTLSNHRKSVDLESSATSLGSNRDTSTIQEEITKRNTVAN 789

Query: 748 QAXXXXXXXXXXXXXXXXXXXXXXXXXXYNDTVFHSQFKKTPKVCDDSSEELGVEVKDKK 807
           ++                          Y++ +F+SQF K P   D+    LG  +++ K
Sbjct: 790 ESIYKKVNDREKASNDDVSSIVSTTTSSYDNAIFNSQFNKAPGSDDEEGGNLGRPIENPK 849

Query: 808 KWVISIVVEDTGPGIDSSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMD 867
            WVISI VEDTGPGID SL ESVF PFVQGDQ LSRQYGGTGLGLSICRQLA MM+GTM 
Sbjct: 850 TWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMK 909

Query: 868 LKSKLGVGSRFTFTVPLTQTREINFDDIPAAFEDEFNPDSKKNRKVKF 915
           L+SK+GVGS+FTFT+PL QT+EI+F D+   FEDEFNP+S+KNR+VKF
Sbjct: 910 LESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDEFNPESRKNRRVKF 957

 Score =  241 bits (615), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 116/166 (69%), Positives = 135/166 (81%), Gaps = 6/166 (3%)

Query: 955  SVRLDRPFLQSTGTASSNTNLGTT------STINKILVAEDNDVNQEVIKRMLNLEGVHN 1008
            SV LDRPFLQSTGTA+S+ N+ T        T  KILV EDN VNQEVIKRMLNLEG+ N
Sbjct: 1055 SVNLDRPFLQSTGTATSSRNIPTVKDDDKNETSVKILVVEDNHVNQEVIKRMLNLEGIEN 1114

Query: 1009 IELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNYTHPIVALTA 1068
            IEL CDGQEA DKVK+L   GE+YN+IFMDVQMPK+DGLLSTKMIRRDL YT PIVALTA
Sbjct: 1115 IELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTA 1174

Query: 1069 FADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEFCPDKQPQEQDK 1114
            FADDSNI+ECL++GM+GFL+KPIKR +L+ I+ EFC   Q ++ +K
Sbjct: 1175 FADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAYQGKKNNK 1220

>AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL147C (SLN1)
          Length = 1103

 Score = 1013 bits (2620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/1123 (50%), Positives = 705/1123 (62%), Gaps = 70/1123 (6%)

Query: 11   FQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAAQLKSTQID 70
             + P + G+R QLT LV I+AL SLIILA +TGVYFT NY+ LR++RL++AA+L S+Q+D
Sbjct: 13   LKPPFKAGLRTQLTILVCIIALSSLIILACTTGVYFTSNYRTLRADRLHVAARLMSSQVD 72

Query: 71   QNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGLFSVATIYD 130
            Q+L  +YYQC  LS++DT+Q AL++Y AGN++  NW+++  ++  FL  S  F +A +YD
Sbjct: 73   QSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERSKTFYIAYLYD 132

Query: 131  ATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSS---LQSEGILTNPVLNGTSYLM 187
              +  VLS  NN T   + E +L RL PL  +K   +    +Q E +  N  LN    LM
Sbjct: 133  EMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLPYNKTLN----LM 188

Query: 188  SMSLPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYDQNETL 247
            SM+LP+ A  S I+   +V G++TIVMSAD +  V +DT+ L +S V+IL+ + +    L
Sbjct: 189  SMTLPVEA--STIIGRGNVVGFLTIVMSADPITAV-NDTSVLGESMVSILTGIPNDKGNL 245

Query: 248  SSYNFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYT--------KKV 299
              Y FVF P     S+     PIKN +FL  A        +  T   Y         KKV
Sbjct: 246  VKYRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGALGHDFKKV 305

Query: 300  AVGYSPCSVVFVNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVK 359
            AVGYS C    ++W+AVV Q E+VF+ PA KLTKII GTV+G+ VF+C+VTF LA WAVK
Sbjct: 306  AVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTFILASWAVK 365

Query: 360  PIVRLQKATELITEGRGLRASSPGAGSSNVSRRSSFFHRPSNCGSS-------------I 406
            PIVRLQKATE I  GRGLR  +    SS+   +++   R ++ GS              +
Sbjct: 366  PIVRLQKATEFIAAGRGLRTYNHSGRSSS---QNTSIDRSNSRGSDHSLPRELFEKKHHV 422

Query: 407  RSRVTDNHNEKGHDLHGEQIQHGFFAMNGSINHSLAASIASSGNEALSDKSKGLTTSANL 466
               VT+NH               +      ++H        +    LSD  KG T++ N 
Sbjct: 423  SPFVTENHAANSGSCSSMSDHERY------LHHIARYHDGETSTNILSDHEKGSTSATNW 476

Query: 467  IEARVPVYRRFFSDELSELTDTFNTMTDALDQHYALLEDRVRARTRQLXXXXXXXXXXXX 526
            I+ RVPVYRR F+DELSELTDTFNTMTD LD+ Y +LEDRVRART+QL            
Sbjct: 477  IDTRVPVYRRLFTDELSELTDTFNTMTDELDRQYVVLEDRVRARTKQLEAAKIQAEAANE 536

Query: 527  XKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQNSLKLIFRSGXXXXXXXXXXXXF 586
             KTVFIANI HELRTPLNGILGMTAI+M E+D +KIQNSLKLIFRSG            F
Sbjct: 537  AKTVFIANIFHELRTPLNGILGMTAIAMAEQDQEKIQNSLKLIFRSGELLLHILTELLTF 596

Query: 587  SKNVLKRTKLEKRNFSVTDVALQIKSIFGKVAKDQRVRLSITLYPNLIRTMVLFGDSNRI 646
            SKNVLKRTKLE+R+FS+ D+ALQ+KSIFGK+AKDQ V+LSI L PN IRTMVL+GDSNRI
Sbjct: 597  SKNVLKRTKLEERHFSIIDIALQVKSIFGKLAKDQHVKLSIYLMPNAIRTMVLWGDSNRI 656

Query: 647  IQIVMNLVSNALKFTPVDGKVNVYMSLLGEYDAERSENENHKKVYVIPGTEPXXXXXXXX 706
            IQIVMNLVSNALKFTPVDGKV+V + L+GEYD+ RSE  N  +VY++PGTE         
Sbjct: 657  IQIVMNLVSNALKFTPVDGKVDVRIKLVGEYDSARSEACNFSEVYILPGTEVT------- 709

Query: 707  XXXXXXXRFSIEXXXXXXXXXXXXKHSDTETTPGLNDTDEKQAXXXXXXXXXXXXXXXXX 766
                                    +    E  P  +DT E++                  
Sbjct: 710  -----------NSSVNNIPTVVEEEEKACEEEPTADDTPERK-----KKDSETVDDADAI 753

Query: 767  XXXXXXXXXYNDTVFHSQFKKTPKVCD--DSSEELGVEVKDK-KKWVISIVVEDTGPGID 823
                     Y+D V H+Q KK P   D  DS   + +   +K + WVI I V+DTGPGI+
Sbjct: 754  SISSSVATSYDDAVLHAQLKKIPTFIDLEDSDNNVTMSKLEKPRSWVIVIEVQDTGPGIE 813

Query: 824  SSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMDLKSKLGVGSRFTFTVP 883
             SLHESVF+PFVQGDQ LSRQYGGTGLGLSICRQLATMM GTM L+SK+G GS+FTFTVP
Sbjct: 814  PSLHESVFKPFVQGDQTLSRQYGGTGLGLSICRQLATMMKGTMKLESKVGSGSKFTFTVP 873

Query: 884  LTQTREINFDDIPAAFEDEFNPDSKKNRKVKFXXXXXXXXXXXXXXLMT-VGPXXXXXXX 942
            L QT  + F+D    FEDEFN  SKKNRKVKF                   G        
Sbjct: 874  LQQTGTVKFNDGDTLFEDEFNIFSKKNRKVKFQLNRSGKSRKGKMNNSNGAGSIAESAIE 933

Query: 943  XXXXXXXXXXXRSVRLDRPFLQSTGTASSNTNLGTTSTIN---KILVAEDNDVNQEVIKR 999
                        SVR+DRPFLQSTGTA+S  ++ T S+     +ILVAEDN+VNQEVIKR
Sbjct: 934  SFGKSESEASFGSVRVDRPFLQSTGTATSTRSVPTLSSAESSLRILVAEDNNVNQEVIKR 993

Query: 1000 MLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNY 1059
            ML+LEG HNI+L CDG++A  KV  LVE GEHY+LIFMDVQMP+MDGLL+TK++R+ L+Y
Sbjct: 994  MLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQMPRMDGLLTTKLLRQKLHY 1053

Query: 1060 THPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEE 1102
             +PIVALTAFADDSNI+ECL++GM+ FLAKPIKR  L+KI+ E
Sbjct: 1054 EYPIVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKILLE 1096

>NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1183

 Score =  919 bits (2376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/712 (65%), Positives = 547/712 (76%), Gaps = 30/712 (4%)

Query: 11  FQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAAQLKSTQID 70
            + P RLGIR QLT LVS+VAL SL+ILA++TGVYFT NYKNLRS+RLY+AAQLKS+QID
Sbjct: 11  LKPPFRLGIRTQLTVLVSVVALCSLVILAITTGVYFTSNYKNLRSDRLYIAAQLKSSQID 70

Query: 71  QNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGLFSVATIYD 130
           QNLNY+YYQ YWLSSRDTLQ  L NYVAGNKT  NW DS  VIQKFLTS+ LFS A +YD
Sbjct: 71  QNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSNNLFSNAQLYD 130

Query: 131 ATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNGTSYLMSMS 190
           ++F  VL+ATNNGTG+ IPES L +L PL+ N+PL SSL++ GILT+PVLNG++Y+MSMS
Sbjct: 131 SSFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVLNGSTYIMSMS 190

Query: 191 LPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYDQNETLSSY 250
           LPIFANPSIILT S VYGYITIVMSA+ LK VF+DTTALE+SNVAI+S VY+   TL++Y
Sbjct: 191 LPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGVYNNESTLNAY 250

Query: 251 NFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVAVGYSPCSVVF 310
           +FVFAP G PS ++  T  I N +FL++ALR+GKGG++++TKF YTK +AVGYSPC+  F
Sbjct: 251 HFVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIAVGYSPCTFSF 310

Query: 311 VNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIVRLQKATEL 370
           VNWIA+V Q E+VF+ P+TKL KIISGTVV IGVFV L+TFPLAHWAVKPIVRLQKATEL
Sbjct: 311 VNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKPIVRLQKATEL 370

Query: 371 ITEGRGLRASSPGAGSSNVSRRSSFFHRPSNCGSSIRSRVTDNHNEKGHDL----HGEQI 426
           ++EGRGL++++P  GS NVSR SS  H      S+I S  +  HN  G +L    +G   
Sbjct: 371 MSEGRGLKSTTP--GSKNVSRSSSIKHY---VRSNIPSTASSVHNFSGDNLSTTTNGHLN 425

Query: 427 QHGFFA-------MNGSINHSLAASIASSGNEA--------------LSDKSKGLTTSAN 465
           Q G          +    + + A  + S+ N +              LS++SK LTTSAN
Sbjct: 426 QRGLTPTPMPTTDLPSPSDSNFATEMISNANTSQRANSISRFTDHTDLSNRSKKLTTSAN 485

Query: 466 LIEARVPVYRRFFSDELSELTDTFNTMTDALDQHYALLEDRVRARTRQLXXXXXXXXXXX 525
           LIEARVP YRR FSDELS+LTDTFN MTDALDQHYALLEDRVRART+QL           
Sbjct: 486 LIEARVPDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTKQLEAAKIEAETAN 545

Query: 526 XXKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQNSLKLIFRSGXXXXXXXXXXXX 585
             KT+FIANISHELRTPLNGILGMTAISMEE DI KI++SLKLIFRSG            
Sbjct: 546 EAKTIFIANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRSGELLLHILTELLT 605

Query: 586 FSKNVLKRTKLEKRNFSVTDVALQIKSIFGKVAKDQRVRLSITLYPNLIRTMVLFGDSNR 645
           FSKNVLKRT LEKR+F +TDVALQIKSIFGKVAKDQRVRLSI L PN+IRTM+LFGDSNR
Sbjct: 606 FSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLPNIIRTMILFGDSNR 665

Query: 646 IIQIVMNLVSNALKFTPVDGKVNVYMSLLGEYDAERSENENHKKVYVIPGTE 697
           IIQIVMNLVSNALKFTPVDGKVNV + L+GEYD   S   N KKV V  GTE
Sbjct: 666 IIQIVMNLVSNALKFTPVDGKVNVRIKLMGEYDENLSRESNFKKVLVKSGTE 717

 Score =  234 bits (596), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 133/157 (84%), Gaps = 3/157 (1%)

Query: 955  SVRLDRPFLQSTGTASSNTNLGTTSTINK---ILVAEDNDVNQEVIKRMLNLEGVHNIEL 1011
            +V +DRPFLQSTGTA+S   + T     K   ILVAEDN VNQEVIKRMLNLEGV NIEL
Sbjct: 1015 TVNMDRPFLQSTGTATSTRTIQTVPDAGKKFKILVAEDNHVNQEVIKRMLNLEGVENIEL 1074

Query: 1012 VCDGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNYTHPIVALTAFAD 1071
              DGQ+A ++VK +VE GEH+++IFMDVQMPK+DGLLSTKMIR DL+YT+PIVALTAFAD
Sbjct: 1075 ARDGQDAFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVALTAFAD 1134

Query: 1072 DSNIRECLDAGMDGFLAKPIKRAQLRKIIEEFCPDKQ 1108
            DSNI+ECL+AGM+GFL+KPIKR +++ I+EE+CP+ Q
Sbjct: 1135 DSNIKECLEAGMNGFLSKPIKRPKVKTILEEYCPNWQ 1171

 Score =  214 bits (546), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 117/140 (83%)

Query: 776 YNDTVFHSQFKKTPKVCDDSSEELGVEVKDKKKWVISIVVEDTGPGIDSSLHESVFEPFV 835
           Y+D VF++QFKKTP++ +D    LG+E+ + K WVI+I V+DTGPGID SL +SVFEPFV
Sbjct: 804 YDDAVFNNQFKKTPELYEDEDGNLGIELTNPKTWVIAIEVQDTGPGIDPSLQKSVFEPFV 863

Query: 836 QGDQALSRQYGGTGLGLSICRQLATMMNGTMDLKSKLGVGSRFTFTVPLTQTREINFDDI 895
           QGDQ LSRQYGGTGLGLSICRQLA MMNGTM+LKS++GVGS FTFTVPL QTRE+  ++ 
Sbjct: 864 QGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSEVGVGSTFTFTVPLMQTRELELNED 923

Query: 896 PAAFEDEFNPDSKKNRKVKF 915
              FEDEFNP S+KNR+VKF
Sbjct: 924 DHPFEDEFNPASRKNRRVKF 943

>CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} similar
           to uniprot|P39928 Saccharomyces cerevisiae YIL147c SLN1
          Length = 1169

 Score =  879 bits (2271), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/690 (65%), Positives = 536/690 (77%), Gaps = 7/690 (1%)

Query: 11  FQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAAQLKSTQID 70
            + P R+GIRAQLTALVSIVA +SLIILAV+TGVYFT NYKNLRS+RLY+AAQLKS+Q+D
Sbjct: 14  LKPPFRIGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQLD 73

Query: 71  QNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGLFSVATIYD 130
           QNLNY+YYQCYWL+SRDTLQ ALA+YVAGNKT  NW +S NVIQKFL+SS LF ++ +YD
Sbjct: 74  QNLNYLYYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKFLSSSNLFFLSRVYD 133

Query: 131 ATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNGTSYLMSMS 190
             F PVL+ TNNGTG+ +PES  ++L PLS + PLPSSL + G+LT+PVLNGT YLMSMS
Sbjct: 134 YDFKPVLNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLMSMS 193

Query: 191 LPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYDQNETLSSY 250
           LPIFANPSII +   VYGYIT+VMSA+ L++VF+DTTALEKSNVAI+SA Y     + SY
Sbjct: 194 LPIFANPSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTKIDSY 253

Query: 251 NFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVAVGYSPCSVVF 310
            FVF P GV  SIL  T  + + +FL+ A +Q KGG++++TKF YTK VA+GY PCS  F
Sbjct: 254 RFVFPPYGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCSFNF 313

Query: 311 VNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIVRLQKATEL 370
           VNW+AVV Q+E+VF+ P+TKLTKIISGTVVGI VFV L+TFPLA WAVKPIVRLQKATEL
Sbjct: 314 VNWVAVVSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKATEL 373

Query: 371 ITEGRGLRASSPGAGSSNVSRRSSFFHRPSNCGSSIRSRVTDNHNEKGHDLHGEQIQHGF 430
           I EGRGLR +  G+GS + SR SS     ++     R  ++    EK H    +      
Sbjct: 374 IAEGRGLRPAGAGSGSRSGSRTSSMKKDINDLNFISRLSLS----EKNHRPAYDSASDSN 429

Query: 431 FAMNGSINHSLAASIAS---SGNEALSDKSKGLTTSANLIEARVPVYRRFFSDELSELTD 487
           +A +GS++H L  S AS   S N+  S +S+ LTTS NL EAR+P YRR FSDELS+LT+
Sbjct: 430 YATDGSLSHDLQTSQASNRPSDNDRSSSRSRFLTTSTNLNEARLPDYRRLFSDELSDLTN 489

Query: 488 TFNTMTDALDQHYALLEDRVRARTRQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGIL 547
           TFN MTDALDQHYALLEDRVRART+QL             KTVFIANISHELRTPLNGIL
Sbjct: 490 TFNAMTDALDQHYALLEDRVRARTKQLEAAKIQAEAANEAKTVFIANISHELRTPLNGIL 549

Query: 548 GMTAISMEERDIDKIQNSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTKLEKRNFSVTDVA 607
           GMTAISMEE DI KI+NSLKLIFRSG            FSKNVLKRT LEKRNF +TDVA
Sbjct: 550 GMTAISMEETDIAKIRNSLKLIFRSGELLLHILTELLTFSKNVLKRTALEKRNFCITDVA 609

Query: 608 LQIKSIFGKVAKDQRVRLSITLYPNLIRTMVLFGDSNRIIQIVMNLVSNALKFTPVDGKV 667
           LQIKSIFGKVAKDQ VRLSI+L PN+IRTMVL+GDSNRIIQIVMNLVSNALKFTPVDGKV
Sbjct: 610 LQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGKV 669

Query: 668 NVYMSLLGEYDAERSENENHKKVYVIPGTE 697
           NV + LLGEYD E ++ +N K+++ I  ++
Sbjct: 670 NVRIKLLGEYDEEATKADNFKQIHTIADSD 699

 Score =  237 bits (604), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 113/174 (64%), Positives = 141/174 (81%), Gaps = 8/174 (4%)

Query: 956  VRLDRPFLQSTGTASSNTNLGTTSTIN---KILVAEDNDVNQEVIKRMLNLEGVHNIELV 1012
            V LDRPFLQSTGTA+S+ N+ T + +    KILVAEDN VNQEVIKRMLNLEG++NI+L 
Sbjct: 991  VHLDRPFLQSTGTATSSRNVPTMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLA 1050

Query: 1013 CDGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNYTHPIVALTAFADD 1072
            CDGQ+A DKV+ LVE  + Y++IFMD+QMPK+DGLLSTKMIRRDLNY   IVALTAFADD
Sbjct: 1051 CDGQDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVALTAFADD 1110

Query: 1073 SNIRECLDAGMDGFLAKPIKRAQLRKIIEEFCPD-----KQPQEQDKEPKSSEN 1121
            SNI+EC++AGM+GFL+KPIKR +L+ I+EE+CP+     K  + +D + K  EN
Sbjct: 1111 SNIKECIEAGMNGFLSKPIKRPKLKMILEEYCPNWIEMKKSKENKDGDKKVEEN 1164

 Score =  202 bits (513), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 120/140 (85%)

Query: 776 YNDTVFHSQFKKTPKVCDDSSEELGVEVKDKKKWVISIVVEDTGPGIDSSLHESVFEPFV 835
           Y++ +F++QFKKTP + +DS++ LG E+ D+K WV +I VEDTGPGID  LHESVFEPFV
Sbjct: 769 YDNALFNTQFKKTPDLYEDSNDGLGTELADQKTWVFAIEVEDTGPGIDPKLHESVFEPFV 828

Query: 836 QGDQALSRQYGGTGLGLSICRQLATMMNGTMDLKSKLGVGSRFTFTVPLTQTREINFDDI 895
           QGDQ LSRQYGGTGLGLSICRQLATMM+GTM L+SK+GVGS+FTFTVPL QTR I FD+ 
Sbjct: 829 QGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLESKVGVGSKFTFTVPLKQTRVIKFDEE 888

Query: 896 PAAFEDEFNPDSKKNRKVKF 915
              FEDEFNP+SKKNR+VKF
Sbjct: 889 EDLFEDEFNPESKKNRRVKF 908

>Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON}
           YIL147C (REAL)
          Length = 1230

 Score =  865 bits (2236), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/740 (62%), Positives = 552/740 (74%), Gaps = 47/740 (6%)

Query: 1   MWMRQLMFGKFQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYM 60
           M +R     +F  P R+GIRAQLTALVSIVALVSLIILAV+TGVYFT NYKNLRS+RLY+
Sbjct: 1   MRLRLPSKSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYI 60

Query: 61  AAQLKSTQIDQNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSS 120
           AAQLKS+QIDQ LNY+YYQ Y+L+SRD LQ +L ++VAGNK+  NWVDS +V+QKFL+SS
Sbjct: 61  AAQLKSSQIDQTLNYLYYQAYYLASRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSS 120

Query: 121 GLFSVATIYDATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVL 180
            LF VA +YD++FT VL+ATNNGTG+ IPE  LD L PLS + PLPSSL++ GILT+PV+
Sbjct: 121 NLFYVAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVV 180

Query: 181 NGTSYLMSMSLPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAV 240
           N T YLMSMSLPIFANPSIILT S VYGYITI+MSA+ LK+VF+DTTALEKSNVAI+SA+
Sbjct: 181 NNTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAL 240

Query: 241 YDQNETLSSYNFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVA 300
           Y+     S Y+F+F P G  S++      IKN TF+SSA R GKGG+L++T     K +A
Sbjct: 241 YNNQGKASGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLA 300

Query: 301 VGYSPCSVVFVNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKP 360
           +GYSPCS   VNW+AVV Q E+VF+ PATKL KII+GTV+ IGVFV L+T PLAHWAV+P
Sbjct: 301 LGYSPCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360

Query: 361 IVRLQKATELITEGRGLRASSPGAGSSNVSRRSSF-------FHRPSN--------CGSS 405
           IVRLQKATELITEGRGLR S+P      VSR SSF       F  PS+         GS+
Sbjct: 361 IVRLQKATELITEGRGLRPSTP----RTVSRASSFKRGFGSGFTVPSSLLQFNTGESGST 416

Query: 406 IRSRV-------------TDNHNEKGHDLHGEQI-------------QHGFFAMNGSINH 439
           I +               T++  +   +L  E++                  +M+GS+NH
Sbjct: 417 ISASGHGGSGHGSGAAFSTESSMKSAINLGNEKLLPSEDEKKIPNNNTDAKVSMDGSLNH 476

Query: 440 SLAA--SIASSGNEALSDKSKGLTTSANLIEARVPVYRRFFSDELSELTDTFNTMTDALD 497
            L A  S+ ++  +  S++S  LTTSANL EAR+P YRR FSDELS+LT+TFNTMTDALD
Sbjct: 477 DLLAPNSLRNNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALD 536

Query: 498 QHYALLEDRVRARTRQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEER 557
           QHYALLEDRVRART+QL             KTVFIANISHELRTPLNGILGMTAISMEE 
Sbjct: 537 QHYALLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEET 596

Query: 558 DIDKIQNSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTKLEKRNFSVTDVALQIKSIFGKV 617
           D++KI+NSLKLIFRSG            FSKNVL+RTKLEKR+F +TDVALQIKSIFGKV
Sbjct: 597 DVNKIRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKV 656

Query: 618 AKDQRVRLSITLYPNLIRTMVLFGDSNRIIQIVMNLVSNALKFTPVDGKVNVYMSLLGEY 677
           AKDQRVRLSI+L+PNLIRTMVL+GDSNRIIQIVMNLVSNALKFTPVDG V+V M LLGEY
Sbjct: 657 AKDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEY 716

Query: 678 DAERSENENHKKVYVIPGTE 697
           D + SE +  K+V+V  GTE
Sbjct: 717 DKDLSEKKQFKEVHVKRGTE 736

 Score =  236 bits (603), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 138/175 (78%), Gaps = 7/175 (4%)

Query: 955  SVRLDRPFLQSTGTASSNTNLGT------TSTINKILVAEDNDVNQEVIKRMLNLEGVHN 1008
            SV LDRPFLQSTGTA+S+ N+ T        T  KILV EDN VNQEVIKRMLNLEG+ N
Sbjct: 1056 SVNLDRPFLQSTGTATSSRNVPTIQDNDKNDTSIKILVVEDNHVNQEVIKRMLNLEGIEN 1115

Query: 1009 IELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNYTHPIVALTA 1068
            IEL CDGQEA DKVK+L   G +YN+IFMDVQMPK+DGLLSTKMIRRDL Y  PIVALTA
Sbjct: 1116 IELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTA 1175

Query: 1069 FADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEFCPDKQPQE-QDKEPKSSEND 1122
            FADDSNI+ECL++GM+GFL+KPIKR +L+ I+ EFC   Q ++   +EPK ++ +
Sbjct: 1176 FADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAYQGKKITSEEPKKAKTE 1230

 Score =  210 bits (535), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 96/140 (68%), Positives = 114/140 (81%)

Query: 776 YNDTVFHSQFKKTPKVCDDSSEELGVEVKDKKKWVISIVVEDTGPGIDSSLHESVFEPFV 835
           Y+D +F+SQF K P   +D    LG  +++ K WVISI VEDTGPGID SL ESVF PFV
Sbjct: 818 YDDAIFNSQFNKAPGSDEDEGGNLGKPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFV 877

Query: 836 QGDQALSRQYGGTGLGLSICRQLATMMNGTMDLKSKLGVGSRFTFTVPLTQTREINFDDI 895
           QGDQ LSRQYGGTGLGLSICRQLA MMNGTM L+SK+GVGS+FTFT+PL QT+EI+F ++
Sbjct: 878 QGDQTLSRQYGGTGLGLSICRQLANMMNGTMRLESKVGVGSKFTFTLPLPQTKEISFANM 937

Query: 896 PAAFEDEFNPDSKKNRKVKF 915
              FEDEFNP+S+KNR+VKF
Sbjct: 938 DFPFEDEFNPESRKNRRVKF 957

>Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON}
           YIL147C (REAL)
          Length = 1221

 Score =  863 bits (2230), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/730 (63%), Positives = 542/730 (74%), Gaps = 47/730 (6%)

Query: 11  FQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAAQLKSTQID 70
           F  P R+GIRAQLTALVSIVALVSL ILAV+TGVYFT NYKNLRS+RLY+AAQLKS+Q+D
Sbjct: 11  FIPPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQVD 70

Query: 71  QNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGLFSVATIYD 130
           Q LNY+YYQ Y+L+SRD LQ +L +YVAGNK+  NWVDS +V+QKFL+SS LF VA +YD
Sbjct: 71  QTLNYLYYQAYYLASRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSSNLFYVARVYD 130

Query: 131 ATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNGTSYLMSMS 190
           ++FT VL+ATNNGTG+ IPE  LD L PLS + PLPSSL++ GILT+P++N T YLMSMS
Sbjct: 131 SSFTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIVNNTDYLMSMS 190

Query: 191 LPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYDQNETLSSY 250
           LPIFANPSIILT S VYGYITIVMSA+ LK+VF+DTTALEKSNVAI+SA Y+     S Y
Sbjct: 191 LPIFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISATYNAQGRASGY 250

Query: 251 NFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVAVGYSPCSVVF 310
           +FVF P G   SI     PI+N TF+SS  R GKGG+L++T    TK +A+GYSPCS   
Sbjct: 251 HFVFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLALGYSPCSFQL 310

Query: 311 VNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIVRLQKATEL 370
           VNW+AVV Q E+VF+ PATKLTKII+GTV+ IGVFV L+T PL HWAVKPIVRLQKATEL
Sbjct: 311 VNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKPIVRLQKATEL 370

Query: 371 ITEGRGLRASSPGAGSSNVSRRSSF-------FHRPS-----NCG--------------- 403
           ITEGRGLR S+P      VSR SSF       F  PS     N G               
Sbjct: 371 ITEGRGLRPSTP----RTVSRASSFRRGFSSGFTAPSSLLQFNTGEACSTTSANGHGSSG 426

Query: 404 ----------SSIRSRVTDNHNEKGHDLHGEQIQHGF----FAMNGSINHSLAA--SIAS 447
                     SS++S +   H +        +I +       +M+GS+NH L A  S+ +
Sbjct: 427 HGSGVALSTESSMKSAINLGHEKLSPSEEENKIPNNHNDVKISMDGSLNHDLLAPNSLRN 486

Query: 448 SGNEALSDKSKGLTTSANLIEARVPVYRRFFSDELSELTDTFNTMTDALDQHYALLEDRV 507
           +  +  S +S  LTTSANL EAR+P Y+R FSDELS+LT+TFNTMTDALDQHYALLEDRV
Sbjct: 487 NDTDRSSSRSHILTTSANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQHYALLEDRV 546

Query: 508 RARTRQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQNSLK 567
           RART+QL             KTVFIANISHELRTPLNGILGMTAISMEE D++KI+N+LK
Sbjct: 547 RARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNNLK 606

Query: 568 LIFRSGXXXXXXXXXXXXFSKNVLKRTKLEKRNFSVTDVALQIKSIFGKVAKDQRVRLSI 627
           LIFRSG            FSKNVL+RTKLE+R+F +TDVALQIKSIFGKVAKDQRVRLSI
Sbjct: 607 LIFRSGELLLHILTELLTFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQRVRLSI 666

Query: 628 TLYPNLIRTMVLFGDSNRIIQIVMNLVSNALKFTPVDGKVNVYMSLLGEYDAERSENENH 687
           +L+PNLIRTMVL+GDSNRIIQIVMNLVSNALKFTPVDG V+V M LLGEYD + SE    
Sbjct: 667 SLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDSSEKRQF 726

Query: 688 KKVYVIPGTE 697
           K+V+V  GTE
Sbjct: 727 KEVHVKKGTE 736

 Score =  235 bits (599), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 132/166 (79%), Gaps = 6/166 (3%)

Query: 955  SVRLDRPFLQSTGTASSNTNLGTTS------TINKILVAEDNDVNQEVIKRMLNLEGVHN 1008
            SV +DRPFLQSTGTA+S+ N+ T        T  KILV EDN VNQEVI+RMLNLEG+ N
Sbjct: 1056 SVNIDRPFLQSTGTATSSRNVPTVQGGDKDGTSIKILVVEDNHVNQEVIRRMLNLEGIDN 1115

Query: 1009 IELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNYTHPIVALTA 1068
            IEL CDGQEA DKVK+L   GE+YN+IFMDVQMPK+DGLLSTKMIRRDL Y  PIVALTA
Sbjct: 1116 IELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTA 1175

Query: 1069 FADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEFCPDKQPQEQDK 1114
            FADDSNI+ECL++GM+GFL+KPIKR +L  I+ EFC   Q ++  K
Sbjct: 1176 FADDSNIKECLESGMNGFLSKPIKRPKLNTILSEFCAAYQGKKNKK 1221

 Score =  204 bits (518), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 114/140 (81%)

Query: 776 YNDTVFHSQFKKTPKVCDDSSEELGVEVKDKKKWVISIVVEDTGPGIDSSLHESVFEPFV 835
           Y+D +F+SQF K      D S  +G  +++ K WVISI VEDTGPGI+ SL ESVF+PFV
Sbjct: 818 YDDAIFNSQFNKALDSDSDESGNVGRPIENPKTWVISIEVEDTGPGIEPSLQESVFQPFV 877

Query: 836 QGDQALSRQYGGTGLGLSICRQLATMMNGTMDLKSKLGVGSRFTFTVPLTQTREINFDDI 895
           QGDQ LSRQYGGTGLGLSICRQLA MM+GTM L+S++GVGS+FTFT+PL QT+EI+F +I
Sbjct: 878 QGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESQVGVGSKFTFTLPLHQTKEISFANI 937

Query: 896 PAAFEDEFNPDSKKNRKVKF 915
              FEDEFNP+SKKNR+VKF
Sbjct: 938 EFPFEDEFNPESKKNRRVKF 957

>Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON}
           YIL147C (REAL)
          Length = 1219

 Score =  853 bits (2203), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/730 (63%), Positives = 539/730 (73%), Gaps = 47/730 (6%)

Query: 11  FQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAAQLKSTQID 70
           F  P R+ IRAQLTALVSIVAL+SL+ILAV+TGVYFT NYKNLRS+RLY+AAQLKS+QID
Sbjct: 11  FTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQID 70

Query: 71  QNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGLFSVATIYD 130
           Q LNY+YYQ Y+L+SRD LQ +L  YVAGNK+  NWVDS +++QKFL+SS LF VA +YD
Sbjct: 71  QTLNYLYYQAYYLASRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSSNLFFVAKVYD 130

Query: 131 ATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNGTSYLMSMS 190
           ++FT VL+ATNNGTG+ IP+   D L PLS +  LPSSL++ GILT+P+LN T YLMSMS
Sbjct: 131 SSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPILNSTDYLMSMS 190

Query: 191 LPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYDQNETLSSY 250
           LPIFANPSIILT S VYGYITI+MSA+ LK+VF+DTTALEKSNVAI+SAVY+      +Y
Sbjct: 191 LPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAVYNNQSKAYAY 250

Query: 251 NFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVAVGYSPCSVVF 310
           +FVF P G  SSI     PIKN TF+SSA + GKGG+L++T     K +A+GYSPCS   
Sbjct: 251 HFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLALGYSPCSFQL 310

Query: 311 VNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIVRLQKATEL 370
           VNW+AVV Q E+VF+ P+TKL KII+GTV+ IGVFV L+T PLAHWAV+PIVRLQKATEL
Sbjct: 311 VNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATEL 370

Query: 371 ITEGRGLRASSPGAGSSNVSRRSSF-------FHRPS-----NCGSSIRSRVTDNH---- 414
           ITEGRGLR S+P      VSR SSF       F  PS     N G +  +     H    
Sbjct: 371 ITEGRGLRPSTP----RTVSRTSSFKRGFSSGFAVPSSLLQFNSGEAGSTTSASGHGCSG 426

Query: 415 --------------------NEKGHDLHGEQI-----QHGFFAMNGSINHSLAA--SIAS 447
                               NEK   L  E+       +   +M+GS+NH L A  ++  
Sbjct: 427 RGSAAVMSTDSSMKSAMNIGNEKLSPLEEEKRTPNDHNNAKISMDGSLNHDLLAPNALRH 486

Query: 448 SGNEALSDKSKGLTTSANLIEARVPVYRRFFSDELSELTDTFNTMTDALDQHYALLEDRV 507
           S N+  S +S  LTTSANL EAR+P YRR FSDELS+LT+TFNTMTDALDQHYALLEDRV
Sbjct: 487 SDNDRSSSRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRV 546

Query: 508 RARTRQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQNSLK 567
           RART+QL             KTVFIANISHELRTPLNGILGMTAISMEE D++KI+NSLK
Sbjct: 547 RARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLK 606

Query: 568 LIFRSGXXXXXXXXXXXXFSKNVLKRTKLEKRNFSVTDVALQIKSIFGKVAKDQRVRLSI 627
           LIFRSG            FSKNVL+RTKLEKR+F +TDVALQIKSIFGKVAKDQRVRLSI
Sbjct: 607 LIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSI 666

Query: 628 TLYPNLIRTMVLFGDSNRIIQIVMNLVSNALKFTPVDGKVNVYMSLLGEYDAERSENENH 687
           +L+PN IRTMVL+GDSNRIIQIVMNLVSNALKFTPVDG V V M LLGEYD E SE +  
Sbjct: 667 SLFPNFIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKELSEKKQF 726

Query: 688 KKVYVIPGTE 697
           K+V+V  GTE
Sbjct: 727 KEVHVRKGTE 736

 Score =  241 bits (614), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 134/164 (81%), Gaps = 6/164 (3%)

Query: 955  SVRLDRPFLQSTGTASSNTNLGTTSTINK------ILVAEDNDVNQEVIKRMLNLEGVHN 1008
            SV LDRPFLQSTGTA+SN N+ T S  +K      ILV EDN VNQEVIKRMLNLEG+ N
Sbjct: 1056 SVNLDRPFLQSTGTATSNRNIPTVSNSDKSDSSIKILVVEDNHVNQEVIKRMLNLEGIEN 1115

Query: 1009 IELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNYTHPIVALTA 1068
            IEL CDGQ+A DKVK+L   GE YN+IFMDVQMPK+DGLLSTKMIRRDL YT PIVALTA
Sbjct: 1116 IELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTA 1175

Query: 1069 FADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEFCPDKQPQEQ 1112
            FADDSNI+ECL++GM+GFL+KPIKR +L+ I+ EFC   Q +++
Sbjct: 1176 FADDSNIKECLESGMNGFLSKPIKRPKLKTILIEFCAAYQGKKK 1219

 Score =  204 bits (518), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 113/140 (80%)

Query: 776 YNDTVFHSQFKKTPKVCDDSSEELGVEVKDKKKWVISIVVEDTGPGIDSSLHESVFEPFV 835
           Y+D +F+SQF K     DD   +LG  +++ K W ISI VEDTGPGID SL ESVF PFV
Sbjct: 818 YDDAIFNSQFNKALGSDDDEGGDLGKPIENPKTWAISIEVEDTGPGIDPSLQESVFHPFV 877

Query: 836 QGDQALSRQYGGTGLGLSICRQLATMMNGTMDLKSKLGVGSRFTFTVPLTQTREINFDDI 895
           QGDQ LSRQYGGTGLGLSICRQLA MM+GTM L+SK+GVGS+FTFT+PL QT+EI+F ++
Sbjct: 878 QGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESKVGVGSKFTFTLPLHQTKEISFANM 937

Query: 896 PAAFEDEFNPDSKKNRKVKF 915
              FEDEFNP+S++NR+VKF
Sbjct: 938 NFPFEDEFNPESRQNRRVKF 957

>KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1187

 Score =  846 bits (2186), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/720 (60%), Positives = 531/720 (73%), Gaps = 27/720 (3%)

Query: 3   MRQLMFGKFQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAA 62
           +++L     + P R+ IR QL A+VS+VA++SL+ILAV+TGVYFT +YKNLR+ RLY+AA
Sbjct: 15  LKRLAHLNTKPPYRISIRTQLIAVVSLVAILSLLILAVTTGVYFTSSYKNLRANRLYIAA 74

Query: 63  QLKSTQIDQNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGL 122
           QLKS+QIDQ L Y+YYQ YW+S+RDTLQ++LAN+VAGNK+ +NW  + +V++KFL+SS  
Sbjct: 75  QLKSSQIDQTLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSDY 134

Query: 123 FSVATIYDATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNG 182
           FS   +YD  F  VLS TNNGTGN I    L++L PLS N PL SSL++ GILT+PVLNG
Sbjct: 135 FSAVKVYDENFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVLNG 194

Query: 183 TSYLMSMSLPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYD 242
           TSYLMSMSLP+FANPSIIL+TS VYGYITI+M+AD L +VF+DTTA+EKSNVAI+SAVY+
Sbjct: 195 TSYLMSMSLPVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVYN 254

Query: 243 QNETLSSYNFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVAVG 302
               L +Y+    P G  +S+      +KN +FL+ AL+QGKGG++++T FLY K VAVG
Sbjct: 255 NQSELDAYHLALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAVG 314

Query: 303 YSPCSVVFVNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIV 362
           YSPCS    NW++VV Q+E+VF  P+TKLTKII+G VVGI VFV LVT PLA++AVKPIV
Sbjct: 315 YSPCSFELANWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPIV 374

Query: 363 RLQKATELITEGRGLRASSPGAGSSNVSRRSSFFHRPS---NCGSSIRSRVTDNHNEKGH 419
           RL+KATE+ITEGRGLR ++PG+GS  VSR SS     S   +  SS +S  T N N    
Sbjct: 375 RLKKATEIITEGRGLRPTTPGSGS--VSRTSSMRREKSPRTSIVSSRKSTATGNSNSLNE 432

Query: 420 D----------LHGEQI----QHGFFAMNGSINHSLAASIASS--------GNEALSDKS 457
           +          L  E +      G   +  ++N  L    ++S         N+ LS++S
Sbjct: 433 NSASLSSHPMVLTSENVLVTNHSGLSRIPVNMNQELLDRASASTVNTLTIDSNDRLSERS 492

Query: 458 KGLTTSANLIEARVPVYRRFFSDELSELTDTFNTMTDALDQHYALLEDRVRARTRQLXXX 517
           K L T  NL EARVP+ R+ F DELS+LT+TFNTMTDALD+HY LLEDRVRART+QL   
Sbjct: 493 KHLITFTNLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLEDRVRARTKQLEAA 552

Query: 518 XXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQNSLKLIFRSGXXXX 577
                     KTVFIANISHELRTPLNGILGMTAISMEE DI KI++SLKLIFRSG    
Sbjct: 553 KIQAEAANEAKTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSSLKLIFRSGELLL 612

Query: 578 XXXXXXXXFSKNVLKRTKLEKRNFSVTDVALQIKSIFGKVAKDQRVRLSITLYPNLIRTM 637
                   FSKNVL+RTKLEKRNF +TDVALQ+KSIFGKVAKDQ VRLSI L PN++RTM
Sbjct: 613 HILTELLTFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRLSIILSPNIMRTM 672

Query: 638 VLFGDSNRIIQIVMNLVSNALKFTPVDGKVNVYMSLLGEYDAERSENENHKKVYVIPGTE 697
           VL+GDSNRIIQ+VMNLVSNALKFTPVDGKV V + LLGEYD E S+N   +KVYV  GTE
Sbjct: 673 VLYGDSNRIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNSKFEKVYVKGGTE 732

 Score =  423 bits (1087), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 211/352 (59%), Positives = 241/352 (68%), Gaps = 22/352 (6%)

Query: 776  YNDTVFHSQFKKTPKVCDDSSEELGVEVKDKKKWVISIVVEDTGPGIDSSLHESVFEPFV 835
            Y+D +F+SQFKKTP + +D    LG E+  +K WV  I V DTGPGIDSSL ESVFEPFV
Sbjct: 815  YDDAIFNSQFKKTPDLYEDEDGNLGEELSQQKTWVFRIEVIDTGPGIDSSLQESVFEPFV 874

Query: 836  QGDQALSRQYGGTGLGLSICRQLATMMNGTMDLKSKLGVGSRFTFTVPLTQTREINFDDI 895
            QGDQ LSRQYGGTGLGLSICRQLATMMNGTM L+S +G GS+F FTVPLTQTR I  D+ 
Sbjct: 875  QGDQTLSRQYGGTGLGLSICRQLATMMNGTMTLESTVGSGSKFIFTVPLTQTRVIKLDES 934

Query: 896  PAAFEDEFNPDSKKNRKVKFXXXXXXXXXXXXXXLMTVGPXXXXXXXXXXXXXXXXXXRS 955
               +EDEFNP SK NRKVKF              L+T                       
Sbjct: 935  EHPYEDEFNPKSKMNRKVKFNVARSINSRRSRSSLITSNSSRIATVREESRLETRSNHSD 994

Query: 956  V-------------------RLDRPFLQSTGTASSNTNLGTTSTINK---ILVAEDNDVN 993
            V                    LDRPFLQSTGTA S+ N+ T +T+ K   +LVAEDN VN
Sbjct: 995  VSTSNKNESASPQPESGSNLNLDRPFLQSTGTAISSANVPTVATLGKTLNVLVAEDNHVN 1054

Query: 994  QEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMI 1053
            QEVIKRML+LEGV NI+L CDGQ+A D VK L E GE Y++IFMDVQMPK+DGL +TKMI
Sbjct: 1055 QEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMI 1114

Query: 1054 RRDLNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEFCP 1105
            R DL Y HPIVALTAFADDSNI+ECLDAGMDGFL+KPIKR QL+ I+ E+CP
Sbjct: 1115 RNDLKYEHPIVALTAFADDSNIKECLDAGMDGFLSKPIKRPQLKTILLEYCP 1166

>KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa]
           {ON} similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1177

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/705 (57%), Positives = 507/705 (71%), Gaps = 22/705 (3%)

Query: 10  KFQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAAQLKSTQI 69
           K + P  + IR QLTALV +VAL+SLIILAV TGVYFT ++K++R+ERLY+A+QLK++QI
Sbjct: 16  KLKPPFLISIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSMRAERLYVASQLKASQI 75

Query: 70  DQNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGLFSVATIY 129
           DQNL Y+YYQCY+LS+RD LQ AL  Y+AGN T  NW D+   + KFL SS LFS+A +Y
Sbjct: 76  DQNLYYLYYQCYYLSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNLFSLARVY 135

Query: 130 DATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNGTSYLMSM 189
           D++F  VL+A+NN +GN +PES L +L PLS N  LPSSL+ +G+LT+PVLN T YLMSM
Sbjct: 136 DSSFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLNDTGYLMSM 195

Query: 190 SLPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYDQNETLSS 249
           SLPIFANPSIIL+TS VYGYIT+V+SA+ LK VF+DTTALE S+V ++S VYD  E L+ 
Sbjct: 196 SLPIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYDNRE-LAG 254

Query: 250 YNFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVAVGYSPCSVV 309
           Y+ VF P G+PS I+ +   I N +FL  A +Q KGG+++ T FLY+K VA+GYSPCS  
Sbjct: 255 YHLVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIGYSPCSSD 314

Query: 310 FVNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIVRLQKATE 369
            V W+A++ Q E+ F+ P+T+L +II GT V I V  C VTFPL+HWAV+PIVRLQKATE
Sbjct: 315 LVQWVAIITQPESKFLYPSTRLARIIVGTCVAIAVVTCAVTFPLSHWAVQPIVRLQKATE 374

Query: 370 LITEGRGLRASSPGA-----GSSNVSRRSSFFHRPS--NCGSSIRS----------RVTD 412
           +IT GRGLR+ +         SS     SS  H  S    GS  RS          + T 
Sbjct: 375 IITAGRGLRSDNGSTLYSHKRSSTAESFSSALHPASIRRSGSVARSSKHKYIPESAKGTL 434

Query: 413 NHNEKGHDLHGEQIQHGFFAMNGSINHSLAASIASSGNEALSDKSKGLTTSANLIEARVP 472
           N N+   ++  + I++   A    ++     S+ S   E  S +S+   TS NLIEARVP
Sbjct: 435 NKND-FEEIQPDGIENNEDAALQKVHSPTPGSLFS---EQRSARSERYITSTNLIEARVP 490

Query: 473 VYRRFFSDELSELTDTFNTMTDALDQHYALLEDRVRARTRQLXXXXXXXXXXXXXKTVFI 532
            Y R FSDELSELT+TFNTMTD LD+HYALLEDRVRARTRQL             KTVFI
Sbjct: 491 TYNRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGANEAKTVFI 550

Query: 533 ANISHELRTPLNGILGMTAISMEERDIDKIQNSLKLIFRSGXXXXXXXXXXXXFSKNVLK 592
           ANISHELRTPLNGILGMTAI+M E D+ K+++SLKLIFRSG            FSKNVLK
Sbjct: 551 ANISHELRTPLNGILGMTAIAMAENDMQKVKSSLKLIFRSGELLLHIMTELLTFSKNVLK 610

Query: 593 RTKLEKRNFSVTDVALQIKSIFGKVAKDQRVRLSITLYPNLIRTMVLFGDSNRIIQIVMN 652
           RTKLE+R+F+V ++ALQ++SIFGK+AKDQ V L+I++ PN++RTMVL+GDSNRI+QIVMN
Sbjct: 611 RTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTISIIPNVLRTMVLWGDSNRIVQIVMN 670

Query: 653 LVSNALKFTPVDGKVNVYMSLLGEYDAERSENENHKKVYVIPGTE 697
           LVSNALKFTPVDG+VNV  +LLGEYD  ++ N    +  V+P  E
Sbjct: 671 LVSNALKFTPVDGRVNVKFTLLGEYDESKASNGCFDRAAVVPIQE 715

 Score =  397 bits (1019), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 194/345 (56%), Positives = 248/345 (71%), Gaps = 10/345 (2%)

Query: 776  YNDTVFHSQFKKTPKVCDDSSEELGVEVKDKKKWVISIVVEDTGPGIDSSLHESVFEPFV 835
            Y+D +FHS+ +K     +    E G  ++  ++  I++ V+DTGPGI+ +L ESVFEPFV
Sbjct: 837  YDDAIFHSRLRK----GNSGENEDGRPLEHPRRLAIAMEVQDTGPGIEPALQESVFEPFV 892

Query: 836  QGDQALSRQYGGTGLGLSICRQLATMMNGTMDLKSKLGVGSRFTFTVPLTQTREINFDDI 895
            QGDQ LSRQYGGTGLGLSICRQLA MMNG+M L SK+GVGS+FTFTVPLTQT+E+ F++ 
Sbjct: 893  QGDQTLSRQYGGTGLGLSICRQLAAMMNGSMSLDSKVGVGSKFTFTVPLTQTKELCFEED 952

Query: 896  PAAFEDEFNPDSKKNRKVKFXXXXXXXXXXXXXXLMTVGPXXXXXXXXXXXXXXXXXXRS 955
               FEDEFNPDSKKNRKVKF                                       S
Sbjct: 953  ENPFEDEFNPDSKKNRKVKFKVSKNNKRKKSHSSSSGQ----NSSVGTPTVSESEVSVGS 1008

Query: 956  VRLDRPFLQSTGTASSNTNLGTTSTINK--ILVAEDNDVNQEVIKRMLNLEGVHNIELVC 1013
            VR+DRPFLQSTGTA S  ++ TTS  NK  +LVAEDN+VNQEVIKRMLNLEG+ +++L C
Sbjct: 1009 VRVDRPFLQSTGTALSTRSVTTTSVANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLAC 1068

Query: 1014 DGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNYTHPIVALTAFADDS 1073
            DGQ+A DKVK   E G+ Y+LIFMDVQMP++DGL +T+MIR +L+YTHPIVALTA+ADD 
Sbjct: 1069 DGQDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAYADDR 1128

Query: 1074 NIRECLDAGMDGFLAKPIKRAQLRKIIEEFCPDKQPQEQDKEPKS 1118
            NI+EC+DAGM+GFLAKPI+R ++++I+ E+CP     + +K+ K+
Sbjct: 1129 NIKECIDAGMNGFLAKPIRRPKIKEILSEYCPTYFKADGEKKGKT 1173

>Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON}
           (141962..145090) [3129 nt, 1043 aa]
          Length = 1042

 Score =  687 bits (1773), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/690 (50%), Positives = 472/690 (68%), Gaps = 14/690 (2%)

Query: 3   MRQLMFGKFQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAA 62
           +R      +++P ++ +R QLT LV  VA++SL+ILA+STGVYFT NY++LR ++LY+AA
Sbjct: 2   LRACNVSIWKAPYKVKLRTQLTTLVCFVAIISLLILAISTGVYFTKNYRDLRLQQLYIAA 61

Query: 63  QLKSTQIDQNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGL 122
           +LKS+QIDQ +N +YYQC WL+ RD ++ AL +Y AGN++  NW  + +V+  FL SS +
Sbjct: 62  RLKSSQIDQTINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVV 121

Query: 123 FSVATIYDATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNG 182
           F   T+YD+ F  +L+ TNN T ++IP+  L  L+PLSG   LPS L + G+LT+PVLN 
Sbjct: 122 FLTTTLYDSQFNLILNETNNETNDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLND 181

Query: 183 TSYLMSMSLPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYD 242
           ++YLMSMSLPI ANPS+ L+ S V+GY+T+VMSA++++ V +DTTALEKS VA++S+   
Sbjct: 182 STYLMSMSLPIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNT 241

Query: 243 QNETLSSYNFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVAVG 302
              +   Y+FVF P G    I+    P++N TFLS A    +GG++ ++K LY+K VA+G
Sbjct: 242 NGTSGQEYHFVFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIG 301

Query: 303 YSPCSVVFVNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIV 362
           Y PCS    NW+  V Q E VFM  + KLTKII+GTV+ I VFVC++TFPL+ W+V+PIV
Sbjct: 302 YWPCSFGLANWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIV 361

Query: 363 RLQKATELITEGRGLRASSPGAGSSNVSRRSSFFHRPSNCGSSIRSRVTDNHNEKGHDLH 422
           RLQKATE+I++  G           N   RS+      +  SS R      HN   ++L+
Sbjct: 362 RLQKATEVISKRDG-----------NEVHRSNSSSSSRSTFSSNRRSKDGRHNSSSYNLY 410

Query: 423 GEQIQHGFFAMNGSINHSLAASIASSGNEALSDKSKGLTTSANLIEARVPVYRRFFSDEL 482
            E ++   +   G  N S  +    +  +  S  S  +    NL + +VP  RRF  DEL
Sbjct: 411 -EDVEK--YTEIGKANKSTESLSKENITDYSSSNSSAIVMRKNLADFQVPASRRFVKDEL 467

Query: 483 SELTDTFNTMTDALDQHYALLEDRVRARTRQLXXXXXXXXXXXXXKTVFIANISHELRTP 542
           SELT+T+  MTDALD+H  LLE RV+ RT+QL             KTVFIAN++HELRTP
Sbjct: 468 SELTETYKLMTDALDEHSQLLEYRVKERTKQLEAAKIEAESANEAKTVFIANVTHELRTP 527

Query: 543 LNGILGMTAISMEERDIDKIQNSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTKLEKRNFS 602
           LNGILGMTAI+MEE D+++IQ+SLKLI+RSG            FSKNVLK+TKLEK +F 
Sbjct: 528 LNGILGMTAIAMEETDMERIQSSLKLIYRSGELLLHILTELLTFSKNVLKQTKLEKTHFC 587

Query: 603 VTDVALQIKSIFGKVAKDQRVRLSITLYPNLIRTMVLFGDSNRIIQIVMNLVSNALKFTP 662
           V D+ALQI+SIFGK++KDQ V+LSI + PN +R+MVL+GD NRI+Q++MNLVSNALKFTP
Sbjct: 588 VIDLALQIESIFGKISKDQHVKLSIFILPNKLRSMVLWGDQNRILQVIMNLVSNALKFTP 647

Query: 663 VDGKVNVYMSLLGEYDAERSENENHKKVYV 692
           VDGK+ V + LLGEYD +RS  EN+K VY+
Sbjct: 648 VDGKITVNIKLLGEYDKDRSAAENYKDVYM 677

 Score =  340 bits (873), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 170/335 (50%), Positives = 222/335 (66%), Gaps = 21/335 (6%)

Query: 777  NDTVFHSQFKKTPKVCDDSSEELGVEVKDKKKWVISIVVEDTGPGIDSSLHESVFEPFVQ 836
            N+T++ ++FK       D+ + +GV +  K+KWVIS+ VEDTGPGI+ SL +SVFEPFVQ
Sbjct: 721  NNTIYSNKFKNGSNF-QDTDDAIGVPLDKKRKWVISVEVEDTGPGIEPSLQKSVFEPFVQ 779

Query: 837  GDQALSRQYGGTGLGLSICRQLATMMNGTMDLKSKLGVGSRFTFTVPLTQTREINFDDIP 896
            GDQ LSRQYGGTGLGLSICRQLA +M+GTM L+S++GVGS+F FTVPL QTREI F+   
Sbjct: 780  GDQTLSRQYGGTGLGLSICRQLANLMHGTMKLESEVGVGSKFIFTVPLLQTREIEFNGNE 839

Query: 897  AAFEDEFNPDSKKNRKVKFXXXXXXXXXXXXX--XLMTVGPXXXXXXXXXXXXXXXXXXR 954
              FEDEFN +SKKNR+VKF                 + V P                   
Sbjct: 840  LVFEDEFNINSKKNREVKFQEITDEVDQVNIEGNSGVEVEPGKCTEPKKSTESES----- 894

Query: 955  SVRLDRPFLQSTGTASSNTNLGTTSTIN----KILVAEDNDVNQEVIKRMLNLEGVHNIE 1010
                     Q+   + S+  +G +   +    K+L+ EDN VNQ V+ RML LEG+ N  
Sbjct: 895  ---------QAVVPSKSSQEMGNSIKYDVKNFKLLIVEDNKVNQLVVIRMLKLEGIENFT 945

Query: 1011 LVCDGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNYTHPIVALTAFA 1070
            + CDGQEA++K+K++   GE+Y L+ MD+QMPK+DG+ +TK+IR++L Y  PIVALTAFA
Sbjct: 946  IACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPKVDGITATKIIRQELKYDKPIVALTAFA 1005

Query: 1071 DDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEFCP 1105
            DDSNI+ C  +GMDGFLAKPIKR QL+ I+ EFCP
Sbjct: 1006 DDSNIQACYKSGMDGFLAKPIKREQLKGILTEFCP 1040

>Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON}
           similar to Ashbya gossypii AFR284W
          Length = 1125

 Score =  686 bits (1769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/712 (53%), Positives = 474/712 (66%), Gaps = 33/712 (4%)

Query: 4   RQLMFGKFQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAAQ 63
           R++    F+ P + G+  QLT LV I+AL SLIILAV+TGVYFT NYK+LR++RL +AAQ
Sbjct: 16  RRIRKHMFRPPYKAGLSTQLTILVCIIALCSLIILAVTTGVYFTTNYKSLRADRLTVAAQ 75

Query: 64  LKSTQIDQNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGLF 123
           L S QI+Q LN +YYQCYWLSSRD++Q AL +Y  GN +  N  ++  V+ KFL SS   
Sbjct: 76  LTSAQINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSI 135

Query: 124 SVATIYDATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNGT 183
               +YD+ F  VLS + N TGN I +  L  L+PLS N PLPSS+  +G+L+NPV NG+
Sbjct: 136 FRTHLYDSAFNEVLSVSTNSTGNIIGDDLLRDLLPLSSNSPLPSSIIDDGMLSNPVFNGS 195

Query: 184 SYLMSMSLPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYDQ 243
           S+ MSMSLP+ A  SI+   S   GYIT+VMSAD + +V     AL  S V++L+ VYD+
Sbjct: 196 SFFMSMSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDE 255

Query: 244 NETLSSYNFVFAPLGVPSSILAETI-PIKNGTFLSSALRQGKGGALERTKFLYTKKVAVG 302
           N  L+SY  +F P  V    L E + PI N +FL +A      G++ +T   Y   VAVG
Sbjct: 256 NNILNSYQVLFPPSIVQVPRLLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVG 315

Query: 303 YSPCSVVFVNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIV 362
           Y+ CS   VNW+AVV Q EAVF+ P+TKLTKII GTV+GI  F+C+VTF +A+WAVKPIV
Sbjct: 316 YAACSFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIV 375

Query: 363 RLQKATELITEGRGL-----------------RASSPGAGSSNVSRRSSFFHRPSNCGSS 405
           RLQKATELI  GRGL                 R++S G+ S  +         P +  + 
Sbjct: 376 RLQKATELIAAGRGLRSYRHSSRSSSRTTSINRSNSKGSPSPTLREGDGLRKTPPSPYTP 435

Query: 406 IRSRVTDNHNEKGHDLHGEQIQHGFFAMNGSINHSLAASIASSGNEALSDKSKGLTTSAN 465
           + S V  N +  G +   +            I  ++   + SS     S++    TTSAN
Sbjct: 436 MHSHVEPNPSGIGREYSVD------------IARAIGIEVPSSHP---SERVDAFTTSAN 480

Query: 466 LIEARVPVYRRFFSDELSELTDTFNTMTDALDQHYALLEDRVRARTRQLXXXXXXXXXXX 525
            IE RVPVYRR FSDELSELTDTFN+MTD LD+HYALLEDRVRART+QL           
Sbjct: 481 WIETRVPVYRRLFSDELSELTDTFNSMTDELDRHYALLEDRVRARTKQLEAAKIQAESAN 540

Query: 526 XXKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQNSLKLIFRSGXXXXXXXXXXXX 585
             KT+FIANISHELRTPLNGILGMTAI+M E D++K+QNSLKLIFRSG            
Sbjct: 541 EAKTMFIANISHELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSGELLLHILTELLT 600

Query: 586 FSKNVLKRTKLEKRNFSVTDVALQIKSIFGKVAKDQRVRLSITLYPNLIRTMVLFGDSNR 645
           FSKN+LKR KLE+RNFS+ DVALQ+KSIFGK+AKDQ V+ SI L PNLIR MVL+GDSNR
Sbjct: 601 FSKNILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNLIRKMVLWGDSNR 660

Query: 646 IIQIVMNLVSNALKFTPVDGKVNVYMSLLGEYDAERSENENHKKVYVIPGTE 697
           IIQIVMNLVSNALKFTPVDGKV++ + LLGEYD E SE  N+ +V++  GTE
Sbjct: 661 IIQIVMNLVSNALKFTPVDGKVSLRIKLLGEYDEEESEKCNNAEVFIKQGTE 712

 Score =  384 bits (986), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 198/335 (59%), Positives = 241/335 (71%), Gaps = 5/335 (1%)

Query: 776  YNDTVFHSQFKKTPKVCDDSSEELGVEVKDKKK--WVISIVVEDTGPGIDSSLHESVFEP 833
            Y+D +FHS+FKK P V D    +L    K +KK  WVISI VEDTGPGID SL ESVF+P
Sbjct: 767  YDDAIFHSRFKKIPAVLDVDEGDLSSIGKSEKKKVWVISIEVEDTGPGIDPSLQESVFKP 826

Query: 834  FVQGDQALSRQYGGTGLGLSICRQLATMMNGTMDLKSKLGVGSRFTFTVPLTQTREINFD 893
            FVQGDQ LSRQYGGTGLGLSICRQL+TMM GTM L S++GVGS+F FTVPL QT  +   
Sbjct: 827  FVQGDQTLSRQYGGTGLGLSICRQLSTMMKGTMKLHSEVGVGSKFIFTVPLRQTGTVEDL 886

Query: 894  DIPAAFEDEFNPDSKKNRKVKFXXXXXXXXXXXXXXLMTVGPXXXXXXXXXXXXXXXXXX 953
            D    FEDEFN  SK NR+VKF              +  +                    
Sbjct: 887  DDEDLFEDEFNAQSKINRRVKFKLNKGGKSRQSSLSVPEISGVPDSPLNSMGRSESELSV 946

Query: 954  RSVRLDRPFLQSTGTASSNTNLGTTSTIN---KILVAEDNDVNQEVIKRMLNLEGVHNIE 1010
             SVR+DRPFLQSTGTA+S  ++ T  ++    K+LVAEDN+VNQEVIKRML LEG+++IE
Sbjct: 947  SSVRVDRPFLQSTGTATSTRSIPTVGSLESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIE 1006

Query: 1011 LVCDGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNYTHPIVALTAFA 1070
            L CDG+EAL+KV  L    +HYN++FMDVQMPKMDGL++T+ IR++LNYT+PIVALTAFA
Sbjct: 1007 LACDGEEALEKVANLTNQYDHYNIVFMDVQMPKMDGLIATRNIRKELNYTYPIVALTAFA 1066

Query: 1071 DDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEFCP 1105
            DDSNI+ CL++GMDGFL+KPIKR +LRKI+ E+CP
Sbjct: 1067 DDSNIKVCLESGMDGFLSKPIKREKLRKILLEYCP 1101

>TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1068

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/690 (51%), Positives = 471/690 (68%), Gaps = 14/690 (2%)

Query: 14  PIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAAQLKSTQIDQNL 73
           P  + +RAQL  L  IV+++SL+IL++STGVYFT+NYK+LR+E+L++AAQLKS+Q+DQ+L
Sbjct: 13  PYPMNLRAQLITLCCIVSIISLLILSISTGVYFTNNYKSLRAEQLFIAAQLKSSQLDQSL 72

Query: 74  NYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGLFSVATIYDATF 133
           NY+YYQ  W    D L +AL  Y +GNKT  NWV+S + +  FLTSS +FS ATIYD  F
Sbjct: 73  NYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSIFSRATIYDTNF 132

Query: 134 TPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNGTSYLMSMSLPI 193
             + + +NNGTG HIP+  + +L PLS ++ LP+S+ + G LT+PVLN ++YLMS+SLPI
Sbjct: 133 MEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNTSNYLMSLSLPI 192

Query: 194 FANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYDQNETLSS-YNF 252
           F NPSIIL+ S VYGY+TI+  A S+  VF+DTTALE SNVAI+SA Y  + T +  Y+F
Sbjct: 193 FGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYRNSTTYADGYHF 252

Query: 253 VFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVAVGYSPCSVVFVN 312
           VF P G  +S++    P+ N +FL  A  +   G++  T F Y+  VAVGYS C+    N
Sbjct: 253 VFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAVGYSTCTFSLAN 312

Query: 313 WIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIVRLQKATELIT 372
           W+AVV Q E+VF     KLTKIISGTVVGI   VC VTF ++++ VKPI++L++ATELI+
Sbjct: 313 WVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPIIKLKQATELIS 372

Query: 373 EGRGLRASSPGAGSSNVSRRSSFFHRPSNCGSSIRSRVTDNH-NEKGHDL----HGEQIQ 427
            GRGLR         N+S R+S     ++  ++I     D + NEK   L      E+ +
Sbjct: 373 RGRGLRPYY-----ENLSDRTS--QDNTSTRTTIDLSDLDGYTNEKEKSLPTCTEDERSK 425

Query: 428 HGFFAMNGSINHSLAASIA-SSGNEALSDKSKGLTTSANLIEARVPVYRRFFSDELSELT 486
                 + SI  +L   +  SS +  LS  S     + +    RVPV+  + +DEL+EL 
Sbjct: 426 SLSNIASKSIFTTLRKILGFSSRSGMLSPTSTNFIVNNDTKTVRVPVHSTYITDELTELK 485

Query: 487 DTFNTMTDALDQHYALLEDRVRARTRQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGI 546
           +TFN M D+LD+H  LLE+RV+ART++L             KTVFIANISHELRTPLNGI
Sbjct: 486 ETFNIMADSLDEHSNLLEERVKARTKELEAAKIVAEATNEAKTVFIANISHELRTPLNGI 545

Query: 547 LGMTAISMEERDIDKIQNSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTKLEKRNFSVTDV 606
           LGMTAI++EE D +K+Q SLKLI+RSG            FSKNVL++TKLEK +F + D+
Sbjct: 546 LGMTAIALEEDDNEKLQGSLKLIYRSGELLLHILTELLTFSKNVLQKTKLEKIHFCIHDI 605

Query: 607 ALQIKSIFGKVAKDQRVRLSITLYPNLIRTMVLFGDSNRIIQIVMNLVSNALKFTPVDGK 666
           ALQIKSIFGK+AKDQ V  SI + PNLIRTMV FGDSNRIIQ++MNLVSNALKFTP+DG 
Sbjct: 606 ALQIKSIFGKIAKDQGVNFSILISPNLIRTMVFFGDSNRIIQVIMNLVSNALKFTPIDGN 665

Query: 667 VNVYMSLLGEYDAERSENENHKKVYVIPGT 696
           V+V + LLGEYD E+S   N+ KVY+  GT
Sbjct: 666 VDVRIKLLGEYDEEKSSLNNYDKVYIKEGT 695

 Score =  312 bits (799), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 160/307 (52%), Positives = 204/307 (66%), Gaps = 12/307 (3%)

Query: 797  EELGVEVKDKKKWVISIVVEDTGPGIDSSLHESVFEPFVQGDQALSRQYGGTGLGLSICR 856
            E LGV +   KKWVIS+ VEDTGPGI  +L +SVFEPFVQGDQ LSRQYGGTGLGLSICR
Sbjct: 767  ELLGVPIPKPKKWVISVDVEDTGPGISPTLQKSVFEPFVQGDQTLSRQYGGTGLGLSICR 826

Query: 857  QLATMMNGTMDLKSKLGVGSRFTFTVPLTQTREINFDDIPAAFEDEFNPDSKKNRKVKFX 916
            QLA++M+GTM+L S  G+GS+FTFTVPL Q R+I F +   AFEDEFN +SKKNRKV F 
Sbjct: 827  QLASIMHGTMELDSTTGLGSKFTFTVPLLQERKIIFSETEKAFEDEFNFNSKKNRKVNF- 885

Query: 917  XXXXXXXXXXXXXLMTVGPXXXXXXXXXXXXXXXXXXRSVRLDRPFLQSTGTASSNTNLG 976
                         + + G                    +       L+ T    S  N+ 
Sbjct: 886  ---------KTDKVTSRGIPSKAAEKNDDANTNGQTTLNAEAKSKTLKPTHITISEDNID 936

Query: 977  TTSTINKILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIF 1036
                  K+L+ EDN VNQEVIKR+L LE +  IE   DGQEA+D VK+ +   + +++IF
Sbjct: 937  QHDF--KVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIF 994

Query: 1037 MDVQMPKMDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQL 1096
            MD+QMP +DG  +T++IR +LNY +PIVALTAFADDSN +EC ++GM+ FLAKPIKR +L
Sbjct: 995  MDIQMPNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFEL 1054

Query: 1097 RKIIEEF 1103
            ++II+EF
Sbjct: 1055 KEIIKEF 1061

>TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5.700
           YIL147C
          Length = 1140

 Score =  593 bits (1528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/717 (45%), Positives = 461/717 (64%), Gaps = 30/717 (4%)

Query: 2   WMRQLMFGK--FQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLY 59
           W  +L   K   + P R  +RAQLT LV IVA++SL  LA+ TGVYFT +YK+L   RLY
Sbjct: 6   WKIKLKMNKQTVKPPYRFSLRAQLTILVCIVAIISLTTLAIITGVYFTTHYKDLNVNRLY 65

Query: 60  MAAQLKSTQIDQNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTS 119
           +A+QLKS+QIDQ LNY+YYQCYW++SR+T+Q  + +   G    +  ++S +V+ KF+ +
Sbjct: 66  IASQLKSSQIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGT 125

Query: 120 SGLFSVATIYDATFTPVLSATNNGTGNHIPESTLDRLMPLSG-NKPLPSSLQSEGILTNP 178
           S LF    IYD     ++++TNN +G+++  S L RL+PLS  N  +P  + + GILT+P
Sbjct: 126 SDLFYYTMIYDKNLKSIMNSTNNESGSNVEPSILSRLLPLSSTNTTIPPLINNTGILTDP 185

Query: 179 VLNGTSYLMSMSLPI---FANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVA 235
           +LN T YLMSMSLPI   ++  + I   S++YGY+T+VMSA+SLK+VF+DT  L  S  A
Sbjct: 186 ILNSTKYLMSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTA 245

Query: 236 ILSAVYDQNETLSSY-NFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFL 294
           +LSA+Y  N+TL  Y +FVF P  +  SI+ E   IKNGTF   A  + K G+ ++ K +
Sbjct: 246 LLSAIY-TNDTLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDKNKSGSKKKVKLV 304

Query: 295 YTKKVAVGYSPCSVVFVNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLA 354
             K  A+GY+P +     W+AVV   +  F   + KLTKII GTVVGI VFV L++ PL+
Sbjct: 305 NKKNYAIGYAPTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLS 364

Query: 355 HWAVKPIVRLQKATELITEGRGLR-------ASSPGAGSSNVSRRSSFFHRPSNCGSSIR 407
           +WAV+PIVRLQ+A+ELIT+ RGLR         S    + + +   ++  +  +   +++
Sbjct: 365 YWAVQPIVRLQRASELITKRRGLRNLNDDSFDDSNDDHTYDSNDDHTYESKLISSTPTLK 424

Query: 408 SRVTDNHNEKGHDLHGEQIQHGFFAMNGSINHSLAASIASSGNEALSDKSKGLTTSANLI 467
           +  ++ H+EK     G+         N    +S      ++ N+  +   + ++ S ++ 
Sbjct: 425 NSDSNIHDEKSGRTRGD--------ANSGTLNSNNTITNNTNNKDFNRLRRNVSVSTHVS 476

Query: 468 -----EARVPVYRRFFSDELSELTDTFNTMTDALDQHYALLEDRVRARTRQLXXXXXXXX 522
                E +VPVYR+ F DEL+ELTDTFN M++ALD+HYALLE RV  RT+QL        
Sbjct: 477 LSEFDEIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTKQLEAAKVQAE 536

Query: 523 XXXXXKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQNSLKLIFRSGXXXXXXXXX 582
                KTVFIANISHELRTPLNGILGMT+ S+EE DI KI++ LKLIFRSG         
Sbjct: 537 AANEAKTVFIANISHELRTPLNGILGMTSTSLEENDIKKIKDGLKLIFRSGELLLNILTE 596

Query: 583 XXXFSKNVLKRTKLEKRNFSVTDVALQIKSIFGKVAKDQRVRLSITLYP-NLIRTMVLFG 641
              FSKNVL +TKLE R F++ ++  QIK+IF K+ + Q V+L I L P   +++++ +G
Sbjct: 597 LLTFSKNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRLLPKKFLKSLLFYG 656

Query: 642 DSNRIIQIVMNLVSNALKFTP-VDGKVNVYMSLLGEYDAERSENENHKKVYVIPGTE 697
           DSNRI+Q++MNL+SNA+KFTP V+GKV V M LLGEYD E S+ EN+ KV + P T+
Sbjct: 657 DSNRILQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPSTQ 713

 Score =  267 bits (682), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 150/323 (46%), Positives = 198/323 (61%), Gaps = 24/323 (7%)

Query: 802  EVKDKKKWVISIVVEDTGPGIDSSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATM 861
            +++  KKWVI   V D GPGID +LH+SVF+PFVQGDQ LSRQYGGTGLGLSIC+QL  M
Sbjct: 823  QIEGNKKWVIRFEVIDNGPGIDQNLHDSVFKPFVQGDQTLSRQYGGTGLGLSICKQLCEM 882

Query: 862  MNGTMDLKSKLGVGSRFTFTVPLTQ---TREINFDDIPAAFEDEFNPDSKKNRKVKFXX- 917
            M GT++L+S+LG GS+F +T+PL Q   T++ N D+     E++ N ++  +  +     
Sbjct: 883  MKGTLELESELGKGSKFIYTIPLLQVGGTKKDNDDN-----EEDHNDNTNSSVDIDIIED 937

Query: 918  --XXXXXXXXXXXXLMTVGPXXXXXXXXXXXXXXXXXXRSV-RLDRPFLQSTGTASS--- 971
                          L ++                     +V  LD+  LQ T   +    
Sbjct: 938  TPVSITSSSQTHSDLNSLQSNSTNEVGLDDSFSEAENDSTVASLDKSVLQKTRMDAQKVE 997

Query: 972  --------NTNLGTTSTINKILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVK 1023
                    + N G  S + K+LVAEDN VNQEVIKRML LE + +IEL  DG EA +KVK
Sbjct: 998  ANEIDDIDHCNKGIPSKL-KVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVK 1056

Query: 1024 QLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLDAGM 1083
            + + + + Y++IFMD+QMPKMDGL ST  IR++L Y   IVALTAFAD+SNI+EC DAGM
Sbjct: 1057 KNLLSYKKYDIIFMDIQMPKMDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGM 1116

Query: 1084 DGFLAKPIKRAQLRKIIEEFCPD 1106
            DGF+ KPIKR  L  ++EEF  D
Sbjct: 1117 DGFIEKPIKRVALHTLLEEFQQD 1139

>NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1259

 Score =  566 bits (1459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/399 (67%), Positives = 334/399 (83%), Gaps = 3/399 (0%)

Query: 11  FQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAAQLKSTQID 70
            + P R+GIRAQLTALVSIVA VSL+ILA++TGVYFT NYKNLRS+RLY+AAQLKS+QID
Sbjct: 9   LKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKSSQID 68

Query: 71  QNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGLFSVATIYD 130
           Q LNY+YYQCY++SSRDTLQ AL NYVAGNK+  NW DS +++QKFL+SS LFSVA +YD
Sbjct: 69  QTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVAKVYD 128

Query: 131 ATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNGTSYLMSMS 190
           A+FT VL+ TNNGTG+ IP+S L +L+PLS N PL SSL++ GILT+PVLN ++YLMSMS
Sbjct: 129 ASFTTVLNVTNNGTGDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSSTYLMSMS 188

Query: 191 LPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYDQNETLSSY 250
           LPIFANPS+IL  S VYGY+T+VMSA+ L+ VF+DTTALEKSNVAI+SAVY+    L++Y
Sbjct: 189 LPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNVSALTAY 248

Query: 251 NFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVAVGYSPCSVVF 310
            FVFAP+G PS I+  T  + NG+FLSSALR+GKGG+L+ TKF Y+K VA+GYSPC+  F
Sbjct: 249 RFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIGYSPCTFSF 308

Query: 311 VNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIVRLQKATEL 370
           VNW+AVV Q+E+VF+ P+TKL KII+GTVV IGVFV ++TFPLAHWAVKPIVRLQKATEL
Sbjct: 309 VNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRLQKATEL 368

Query: 371 ITEGRGLRASSPGAGSSNVSRRSSFFHRPSNCGSSIRSR 409
           I+EGRGL++++P + S  VSR +S    PS   S  R+R
Sbjct: 369 ISEGRGLKSTNPDSRS--VSRNNS-LKLPSRNTSHYRNR 404

 Score =  549 bits (1414), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 299/494 (60%), Positives = 331/494 (67%), Gaps = 38/494 (7%)

Query: 448 SGNEALSDKSKGLTTSANLIEARVPVYRRFFSDELSELTDTFNTMTDALDQHYALLEDRV 507
           S +   S KS  LTTSANLIEARVP YRR FSDELS+LTDTFNTMTDALDQHYALLEDRV
Sbjct: 508 SDHTEFSTKSGHLTTSANLIEARVPDYRRLFSDELSDLTDTFNTMTDALDQHYALLEDRV 567

Query: 508 RARTRQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQNSLK 567
           RART+QL             KTVFIANISHELRTPLNGILGMTAISMEE DI KI++SLK
Sbjct: 568 RARTKQLEAAKIEAERANEAKTVFIANISHELRTPLNGILGMTAISMEETDISKIRSSLK 627

Query: 568 LIFRSGXXXXXXXXXXXXFSKNVLKRTKLEKRNFSVTDVALQIKSIFGKVAKDQRVRLSI 627
           LIFRSG            FSKNVLKRT LEKR+F +TDVALQIKSIFGKVAKDQRV+LSI
Sbjct: 628 LIFRSGELLLHILTELLTFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVKLSI 687

Query: 628 TLYPNLIRTMVLFGDSNRIIQIVMNLVSNALKFTPVDGKVNVYMSLLGEYDAERSENENH 687
           TL PN IRTMVL+GDSNRIIQIVMNLVSNALKFTPVDGKVNV + L+GEYD   S   N 
Sbjct: 688 TLTPNTIRTMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVNVKVKLIGEYDEALSAKNNF 747

Query: 688 KKVYVIPGTEPXXXXXXXXXXXXXXXRFSIEXXXXXXXXXXXXKHSDTETTPGLNDT--- 744
           K+VYV  GTE                   IE             ++ + TT G + T   
Sbjct: 748 KEVYVKQGTELLGCSN------------PIEKTNESIPSPKSENNNSSSTTSGKDTTNSE 795

Query: 745 ----DEKQAXXXXXXXXXXXXXXXXXXXXXXXXXXYNDTV------------------FH 782
               DEK A                            D+V                  F+
Sbjct: 796 TSFEDEKSADDLDDEKIATKDAENENTDDTENLDEQTDSVCDNISLVSTSTSSYDDAIFN 855

Query: 783 SQFKKTPKVC-DDSSEELGVEVKDKKKWVISIVVEDTGPGIDSSLHESVFEPFVQGDQAL 841
           SQFKK+P +  DD + + GV ++D K WVI I VEDTGPGID +L ESVF+PFVQGDQ L
Sbjct: 856 SQFKKSPGLYDDDENNDAGVLIEDPKTWVIQISVEDTGPGIDKTLQESVFQPFVQGDQTL 915

Query: 842 SRQYGGTGLGLSICRQLATMMNGTMDLKSKLGVGSRFTFTVPLTQTREINFDDIPAAFED 901
           SRQYGGTGLGLSICRQLA MM+GTM LKS++GVGS FTFTVPL QTREINFDD+   FED
Sbjct: 916 SRQYGGTGLGLSICRQLANMMHGTMKLKSEVGVGSTFTFTVPLKQTREINFDDMEHPFED 975

Query: 902 EFNPDSKKNRKVKF 915
           EFNP+S+KNRKVKF
Sbjct: 976 EFNPESRKNRKVKF 989

 Score =  238 bits (608), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 116/166 (69%), Positives = 134/166 (80%), Gaps = 10/166 (6%)

Query: 956  VRLDRPFLQSTGTASSNTNLGTTSTINK---------ILVAEDNDVNQEVIKRMLNLEGV 1006
            V LDRPFLQSTGTA+S+ N+   S  NK         ILVAEDN VNQEVIKRMLNLEGV
Sbjct: 1094 VSLDRPFLQSTGTATSSRNVPVLSESNKDEDPAQNIKILVAEDNHVNQEVIKRMLNLEGV 1153

Query: 1007 HNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNYTHPIVAL 1066
            + I+L CDGQEA DKVK L E  + YN+IFMDVQMPK+DGLLSTKMIR+DL+Y HPIVAL
Sbjct: 1154 NKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVAL 1213

Query: 1067 TAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEFCPD-KQPQE 1111
            TAFADDSNI+ECL++GM+GFL+KPIKR +LR II+E+CP  K P E
Sbjct: 1214 TAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEYCPGWKSPTE 1259

>TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5.700
           YIL147C
          Length = 1214

 Score =  339 bits (869), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 169/235 (71%), Positives = 193/235 (82%)

Query: 464 ANLIEARVPVYRRFFSDELSELTDTFNTMTDALDQHYALLEDRVRARTRQLXXXXXXXXX 523
           + ++E +VPVYRR F DELSELTDTFNTM+DALDQHYALLE+RVRART+QL         
Sbjct: 472 STILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLEAAKIEAEA 531

Query: 524 XXXXKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQNSLKLIFRSGXXXXXXXXXX 583
               KTVFIANISHELRTPLNGILGMTAISMEE DID I++SLKLIFRSG          
Sbjct: 532 ANEAKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGELLLHILTEL 591

Query: 584 XXFSKNVLKRTKLEKRNFSVTDVALQIKSIFGKVAKDQRVRLSITLYPNLIRTMVLFGDS 643
             FSKNVL+RTKLE+R+F +TDVALQIKSIFGKVAKDQ V+LSI L PN IRT+VL+GDS
Sbjct: 592 LTFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDS 651

Query: 644 NRIIQIVMNLVSNALKFTPVDGKVNVYMSLLGEYDAERSENENHKKVYVIPGTEP 698
           NRIIQIVMNLVSNALKFTP+DGKV+V MSLLGEYD E+S+  ++K+V+V  GTEP
Sbjct: 652 NRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTEP 706

 Score =  330 bits (845), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 198/417 (47%), Positives = 235/417 (56%), Gaps = 87/417 (20%)

Query: 776  YNDTVFHSQFKKTPKVCDDSSEELGVEVKDKKKWVISIVVEDTGPGIDSSLHESVFEPFV 835
            Y++TVF+ QFKK   + D   E LGVE+K+ K WVI I VEDTGPGI  +L ESVFEPFV
Sbjct: 782  YDETVFNDQFKKITGLQDHDEERLGVEIKEPKTWVICIEVEDTGPGIHPALQESVFEPFV 841

Query: 836  QGDQALSRQYGGTGLGLSICRQLATMMNGTMDLKSKLGVGSRFTFTVPLT--------QT 887
            QGDQALSRQYGGTGLGLSICRQLATMMNGTM L+SK+G GS+FTFTVPLT        + 
Sbjct: 842  QGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGSGSKFTFTVPLTQTREIVIGED 901

Query: 888  REIN--FDD---------------IPAAFEDEFNPDSKKNRKVK------FXXXXXXXXX 924
             +IN  FDD               IP++        S K+RK K      F         
Sbjct: 902  EDINEFFDDEFNIYSKKNRKVKFAIPSSPGTTLANSSLKSRKSKGSLNSSFVGEIQNVNE 961

Query: 925  XXXXXLMTVGPXXXXXXXXXXXXXXXXXXRSV-RLDRPFLQSTGTASSN----------- 972
                   +                      S+  LDRPFLQSTGTA+S            
Sbjct: 962  AEEDAYNSKDINSSGELKIRHISTSTSNNNSIPSLDRPFLQSTGTATSTMKIPVLKDFSN 1021

Query: 973  -------TNLGTTSTINK--------------------------------ILVAEDNDVN 993
                   TN    S ++K                                ILV EDN VN
Sbjct: 1022 SATKDNVTNDEGKSDLSKKGNSGGTIIQEGVTQNNSSIIIDEEEEDEGIRILVTEDNHVN 1081

Query: 994  QEVIKRMLNLEGVHNIELVCDGQEALDKVKQLV-----ENGEHYNLIFMDVQMPKMDGLL 1048
            QEVIKRML LE + NI+L CDG+EA  KVK++      +   +Y+LIFMDVQMP+MDGL 
Sbjct: 1082 QEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDVQMPRMDGLE 1141

Query: 1049 STKMIRRDLNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEFCP 1105
            STK+IR +L YT PIVALTAFAD+SNI+ECLD GMDGFL+KPIKR +L+ I+ EFCP
Sbjct: 1142 STKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDILNEFCP 1198

>Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W
            (REAL)
          Length = 625

 Score = 71.2 bits (173), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 52/169 (30%), Positives = 88/169 (52%), Gaps = 12/169 (7%)

Query: 955  SVRLDRPFLQSTGTASSNTNLGTTSTINK---ILVAEDNDVNQEVIKRMLNLEGVHNIEL 1011
            +V L  P L    + + N   GTT T+ K   +L+ ED+ V+ ++  + L   G   +++
Sbjct: 350  TVSLQLPNLPDENSLTPNAQ-GTTVTLRKGFHVLLVEDDAVSIQLCSKFLRKYGC-TVQV 407

Query: 1012 VCDGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNYTHPIVALTAFAD 1071
            V DG  A+  +++       Y+L+ MD+ MP +DG  +T ++R   N T PI+A+T    
Sbjct: 408  VTDGLSAISTLEKF-----RYDLVLMDIVMPNLDGATATSIVRSFDNET-PIIAMTGNIM 461

Query: 1072 DSNIRECLDAGMDGFLAKPIKRAQLRKIIEEFCPDKQP-QEQDKEPKSS 1119
            + ++   L  GM+  LAKP  R  L  I+  +  D+ P  EQ   P++S
Sbjct: 462  NQDLITYLQHGMNDILAKPFTRDDLHSILIRYLKDRIPLCEQQLPPRNS 510

>Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar to
            Ashbya gossypii ADL388W
          Length = 496

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 70/126 (55%), Gaps = 7/126 (5%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +L+ ED+ V  ++  + L   G  ++E+V DG  A++ V++       Y+L+ MD+ MP 
Sbjct: 331  VLLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLSAIETVEKF-----QYDLVLMDIVMPN 384

Query: 1044 MDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEF 1103
            +DG  +T +IR   N T PI+A+T   +D ++   L  GM+  LAKP  +  L  ++  +
Sbjct: 385  LDGATATSVIRSFDNQT-PIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRY 443

Query: 1104 CPDKQP 1109
              D+ P
Sbjct: 444  LKDRVP 449

>ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YHR206W (SKN7) and YJR147W
            (HMS2)
          Length = 482

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 70/126 (55%), Gaps = 7/126 (5%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +L+ ED+ V  ++  + L   G  ++E+V DG  A++ V++       Y+L+ MD+ MP 
Sbjct: 320  VLLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLSAIETVEKF-----QYDLVLMDIVMPN 373

Query: 1044 MDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEF 1103
            +DG  +T +IR   N T PI+A+T   +D ++   L  GM+  LAKP  +  L  ++  +
Sbjct: 374  LDGATATSVIRSFDNQT-PIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLVRY 432

Query: 1104 CPDKQP 1109
              D+ P
Sbjct: 433  LKDRIP 438

>KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON}
            Anc_4.385 YJR147W
          Length = 615

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 75/139 (53%), Gaps = 7/139 (5%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +L+ ED+ ++ ++  + L   G   +++V DG  A+  ++        Y+L+ MD+ MP 
Sbjct: 405  VLLVEDDAISIQLCSKFLRKYGC-TVQVVTDGLSAITTLE-----NSRYDLVLMDIVMPN 458

Query: 1044 MDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEF 1103
            +DG  +T +IR   N T PI+A+T   DD ++   L  GM+  LAKP  R  L  ++  +
Sbjct: 459  LDGATATSIIRSFDNQT-PIIAMTGNIDDGDLITYLQHGMNDILAKPFTRDDLHSMLIRY 517

Query: 1104 CPDKQPQEQDKEPKSSEND 1122
              D+ P  + K   +SE++
Sbjct: 518  LKDRTPLCEQKRQLASESN 536

>TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}
            Anc_4.385 YJR147W
          Length = 547

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 75/135 (55%), Gaps = 10/135 (7%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +L+ ED+ V  ++  + L   G   +E+V DG  A+  +++       Y+L+ MD+ MP 
Sbjct: 336  VLLVEDDAVCIQLCSKFLRKYGC-TVEVVTDGLSAISTLEKF-----RYDLVLMDIVMPN 389

Query: 1044 MDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEF 1103
            +DG  +T ++R   N+T PI+A+T   +D ++   L  GM+  LAKP  +  L  ++  +
Sbjct: 390  LDGATATSIVRSFDNHT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLIRY 448

Query: 1104 CPDKQP---QEQDKE 1115
              D+ P   Q++++E
Sbjct: 449  LKDRVPLVKQQEERE 463

>KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4.385
            YJR147W
          Length = 545

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 69/126 (54%), Gaps = 7/126 (5%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +L+ ED+ ++ ++  + L   G   +E+V DG  A+  +++       Y+L+ MD+ MP 
Sbjct: 355  VLLVEDDAISIQLCSKFLRKYGC-TVEVVTDGLSAISTLEKF-----RYDLVLMDIVMPN 408

Query: 1044 MDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEF 1103
            +DG  +T +IR   N T PI+A+T   +D ++   L  GM+  LAKP  R  L  ++  +
Sbjct: 409  LDGATATSIIRSFDNQT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTRDDLHSMLIRY 467

Query: 1104 CPDKQP 1109
              D+ P
Sbjct: 468  LKDRVP 473

>Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206W
            (REAL)
          Length = 617

 Score = 68.2 bits (165), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 86/169 (50%), Gaps = 12/169 (7%)

Query: 955  SVRLDRPFLQSTGTASSNTNLGTTSTINK---ILVAEDNDVNQEVIKRMLNLEGVHNIEL 1011
            +V L  P L    + + N   G   T+ K   +L+ ED+ V+ ++  + L   G   +++
Sbjct: 349  TVSLQMPNLPDENSLTPNAQ-GNAVTLRKGFHVLLVEDDAVSIQLCSKFLRKYGC-TVQV 406

Query: 1012 VCDGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNYTHPIVALTAFAD 1071
            V DG  A+  +++       Y+L+ MD+ MP +DG  +T ++R   N T PI+A+T    
Sbjct: 407  VTDGLSAISTLEKF-----RYDLVLMDIVMPNLDGATATSIVRSFDNET-PIIAMTGNIM 460

Query: 1072 DSNIRECLDAGMDGFLAKPIKRAQLRKIIEEFCPDKQP-QEQDKEPKSS 1119
            + ++   L  GM+  LAKP  R  L  I+  +  D+ P  EQ   P++S
Sbjct: 461  NQDLITYLQHGMNDILAKPFTRDDLHSILIRYLKDRIPLCEQQLPPRNS 509

>TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4.385
            YJR147W
          Length = 587

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 70/126 (55%), Gaps = 7/126 (5%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +L+ ED++V  ++  + L   G   + +V DG  A+     ++EN   ++L+ MD+ MP 
Sbjct: 418  VLLVEDDEVCIQLCSKFLRKYGC-TVRVVTDGLTAI----SVLEN-HRFDLVLMDIVMPN 471

Query: 1044 MDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEF 1103
            +DG  +T ++R   NYT PI+A+T   +D ++   L  GM+  LAKP  +  L  ++  +
Sbjct: 472  LDGATATSIVRNFDNYT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKRDLHSMLVRY 530

Query: 1104 CPDKQP 1109
              DK P
Sbjct: 531  LRDKVP 536

>KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} similar to
            uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and some
            similarites with YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 475

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 76/140 (54%), Gaps = 12/140 (8%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +L+ ED+ V  ++  + L   G  ++E+V DG  A+  +++     + ++L+ MD+ MP 
Sbjct: 331  VLLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLSAISTLEK-----QRFDLVLMDIVMPN 384

Query: 1044 MDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEF 1103
            +DG  +T ++R   N T PI+A+T   DD ++   L  GM+  LAKP  +  L  ++  +
Sbjct: 385  LDGATATSIVRSFDNET-PIIAMTGNIDDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRY 443

Query: 1104 CPDKQP-----QEQDKEPKS 1118
              D+ P     Q  + +PK+
Sbjct: 444  LKDRIPLSEQRQNSNNDPKA 463

>CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} similar to
            uniprot|P38889 Saccharomyces cerevisiae YHR206w SKN7
            transcription factor
          Length = 630

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 68/126 (53%), Gaps = 7/126 (5%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +L+ ED+ V+ ++  + L   G   +++V DG  A+  +++       Y+L+ MD+ MP 
Sbjct: 407  VLLVEDDSVSIQLCSKFLRKYGC-TVQVVTDGLSAISNLEKF-----RYDLVLMDIVMPN 460

Query: 1044 MDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEF 1103
            +DG  +T ++R   N T PI+A+T   +D ++   L  GM+  LAKP  R  L  I+   
Sbjct: 461  LDGATATSIVRSFDNQT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTRNDLHSILIRH 519

Query: 1104 CPDKQP 1109
              D+ P
Sbjct: 520  LKDRIP 525

>SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} similar
            to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
            weakly similar to YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 465

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 70/126 (55%), Gaps = 7/126 (5%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +L+ ED+ V  ++  + L   G  ++E+V DG  A+  +++       Y+L+ MD+ MP 
Sbjct: 309  VLLVEDDSVCIQLCSKFLLKYGC-SVEVVTDGLSAISTLEKF-----RYDLVLMDIVMPN 362

Query: 1044 MDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEF 1103
            +DG  +T ++R   N T PI+A+T   +D ++   L+ GM+  LAKP  +  L  ++  +
Sbjct: 363  LDGATATSIVRSFDNQT-PIIAMTGNIEDQDLVTYLEHGMNDILAKPFTKDDLHSMLIRY 421

Query: 1104 CPDKQP 1109
              D+ P
Sbjct: 422  LKDRVP 427

>NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4.385
          Length = 609

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 74/140 (52%), Gaps = 7/140 (5%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +L+ ED+ V+  +  + L   G   +E+V DG  A+  +++       Y+L+ MD+ MP 
Sbjct: 383  VLLVEDDAVSIRLCSKFLRKYGC-TVEVVTDGLSAISTLEKF-----RYDLVLMDIVMPN 436

Query: 1044 MDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEF 1103
            +DG  +T +IR   N T PI+A+T   +D ++   L  GM+  LAKP  +  L  ++  +
Sbjct: 437  LDGATATSIIRNFDNQT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLIRY 495

Query: 1104 CPDKQPQEQDKEPKSSENDN 1123
              D+ P    ++ + +  D+
Sbjct: 496  LKDRIPLRDQQKVQGTPGDD 515

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
            (REAL)
          Length = 623

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 74/137 (54%), Gaps = 8/137 (5%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +L+ ED+ V+ ++  + L   G   +++V DG  A+  +++       Y+L+ MD+ MP 
Sbjct: 381  VLLVEDDVVSIQLCSKFLRKYGC-TVQVVTDGLSAISTLEKF-----RYDLVLMDIVMPN 434

Query: 1044 MDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEF 1103
            +DG  +T ++R   N T PI+A+T    + ++   L  GM+  LAKP  R  L  I+  +
Sbjct: 435  LDGATATSIVRSFDNET-PIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRY 493

Query: 1104 CPDKQP-QEQDKEPKSS 1119
              D+ P  EQ   P++S
Sbjct: 494  LKDRIPLCEQQLPPRNS 510

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
            response regulator and transcription factor; physically
            interacts with the Tup1-Cyc8 complex and recruits Tup1p
            to its targets; part of a branched two-component
            signaling system; required for optimal induction of
            heat-shock genes in response to oxidative stress;
            involved in osmoregulation
          Length = 622

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 74/137 (54%), Gaps = 8/137 (5%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +L+ ED+ V+ ++  + L   G   +++V DG  A+  +++       Y+L+ MD+ MP 
Sbjct: 379  VLLVEDDAVSIQLCSKFLRKYGC-TVQVVSDGLSAISTLEKY-----RYDLVLMDIVMPN 432

Query: 1044 MDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEF 1103
            +DG  +T ++R   N T PI+A+T    + ++   L  GM+  LAKP  R  L  I+  +
Sbjct: 433  LDGATATSIVRSFDNET-PIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRY 491

Query: 1104 CPDKQP-QEQDKEPKSS 1119
              D+ P  EQ   P++S
Sbjct: 492  LKDRIPLCEQQLPPRNS 508

>Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..11491)
            [1650 nt, 550 aa]
          Length = 549

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 69/126 (54%), Gaps = 7/126 (5%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +L+ ED+DV+ ++  + L   G   +++V DG  A+  +++       ++L+ MD+ MP 
Sbjct: 384  VLLVEDDDVSIQLCSKFLRKYGC-TVQVVTDGLAAISILEKF-----RFDLVLMDIVMPN 437

Query: 1044 MDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEF 1103
            +DG  +T +IR   N T PI+A+T   +  ++   L  GM+  LAKP  R  L  I+  +
Sbjct: 438  LDGATATSIIRNFDNRT-PIIAMTGSIEHQDLITYLQHGMNDILAKPFTRKDLYSILIRY 496

Query: 1104 CPDKQP 1109
              D+ P
Sbjct: 497  LKDRVP 502

>KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 464

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 74/138 (53%), Gaps = 7/138 (5%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +L+ ED+ +  ++  + L   G   +E+V DG  A+  +++       Y+L+ MD+ MP 
Sbjct: 307  VLLVEDDSICIQLCSKFLMKYGC-TVEVVTDGLSAISTLEKF-----RYDLVLMDIVMPN 360

Query: 1044 MDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEF 1103
            +DG  +T ++R   N T PI+A+T   +D ++   L  GM+  LAKP  +  L  ++  +
Sbjct: 361  LDGATATSIVRSFDNQT-PIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRY 419

Query: 1104 CPDKQPQEQDKEPKSSEN 1121
              ++ P  + +   SS++
Sbjct: 420  LRNRVPLSEQRAGSSSKD 437

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 647

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 70/133 (52%), Gaps = 11/133 (8%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +L+ ED+ V  ++  + L   G   +E+V DG  A+  +++       Y+L+ MD+ MP 
Sbjct: 378  VLLVEDDAVCIQLCSKFLRKYGC-TVEVVTDGLAAISTLEKF-----RYDLVLMDIVMPN 431

Query: 1044 MDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEF 1103
            +DG  +T ++R   +   PI+A+T   +D ++   L  GM+  LAKP  +  L  ++  +
Sbjct: 432  LDGATATSIVRS-FDIHTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLIRY 490

Query: 1104 CPDKQP----QEQ 1112
              D+ P    QEQ
Sbjct: 491  LRDRVPLIKQQEQ 503

>NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385
          Length = 597

 Score = 62.8 bits (151), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 69/135 (51%), Gaps = 9/135 (6%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +L+ ED+ V+ ++  + L   G   +E+V DG  A+  ++        Y+L+ MD+ MP 
Sbjct: 426  VLLVEDDAVSIQLCSKFLRKSGC-TVEVVTDGLAAISILEAF-----RYDLVLMDIVMPN 479

Query: 1044 MDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEF 1103
            +DG  +T +I R+ +   PI+A+T   +D ++   L  GM   LAKP  R  L  ++   
Sbjct: 480  LDGATATSII-RNFDKETPIIAMTGNIEDQDLITYLQHGMTDILAKPFTRDDLLSMLIRH 538

Query: 1104 CPDKQP--QEQDKEP 1116
               + P  + Q  EP
Sbjct: 539  LSKRIPLCERQQSEP 553

>Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar to
            Ashbya gossypii ADR343C
          Length = 795

 Score = 62.0 bits (149), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 74/150 (49%), Gaps = 35/150 (23%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +L+ EDN +NQ ++   L    + + E+  +G EA++K +Q    G H  LI MD+Q+P 
Sbjct: 551  VLIVEDNIINQAILVSFLKRHRI-SYEIAKNGAEAVEKWRQ---GGIH--LILMDLQLPL 604

Query: 1044 MDGLLSTKMIR-------------------RDLN-------YTHP--IVALTAFADDSNI 1075
            + GL +TK IR                   RD +       +  P  IVALTAF+  ++ 
Sbjct: 605  LSGLEATKQIRDMEKLNGINKFHKSDLKPGRDTSLDLDRSKFRSPVIIVALTAFSSHADR 664

Query: 1076 RECLDAGMDGFLAKPIKRAQL-RKIIEEFC 1104
            RE L AG + +L KP+    L  KI E  C
Sbjct: 665  REALVAGCNDYLTKPVNLDWLSSKITEWGC 694

>TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}
            Anc_4.385 YJR147W
          Length = 510

 Score = 61.6 bits (148), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 70/129 (54%), Gaps = 7/129 (5%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +L+ ED++V+ ++  + L   G   +++V DG  A+  +++       ++L+ MD+ MP 
Sbjct: 352  VLLVEDDEVSIQLCSKFLIKYGC-TVQVVTDGLAAISTLEKY-----RFDLVLMDIVMPN 405

Query: 1044 MDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEF 1103
            +DG  +T +IR   N T PI+A+T   +  ++   L  GM+  LAKP  R  L  ++  +
Sbjct: 406  LDGATATSIIRNFDNET-PIIAMTGSIEHQDLITYLQHGMNDILAKPFTRRDLYSMLTRY 464

Query: 1104 CPDKQPQEQ 1112
              ++ P  Q
Sbjct: 465  LKNRVPLSQ 473

>Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206W
            (SKN7) - transcription factor involved in oxidative
            stress response [contig 376] FULL
          Length = 461

 Score = 61.2 bits (147), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 69/126 (54%), Gaps = 7/126 (5%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +L+ ED+ +  ++  + L ++    +E+V DG  A+  +++       ++L+ MD+ MP 
Sbjct: 304  VLLVEDDSICIQLCSKFL-MKYACTVEVVTDGLSAISTLEKF-----RFDLVLMDIVMPN 357

Query: 1044 MDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEF 1103
            +DG  +T ++R   N T PI+A+T   +D ++   L  GM+  LAKP  +  L  ++  +
Sbjct: 358  LDGATATSIVRSFDNQT-PIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRY 416

Query: 1104 CPDKQP 1109
              ++ P
Sbjct: 417  LRNRVP 422

>KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.230
            YLR006C
          Length = 648

 Score = 60.8 bits (146), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/127 (34%), Positives = 69/127 (54%), Gaps = 13/127 (10%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +L+ EDN +NQ ++   L    + + ++  +G+EA+D  K   E G H  LIFMD+Q+P 
Sbjct: 519  VLIVEDNVINQAILGSFLRKHKI-SYKVAKNGKEAVDIWK---EGGLH--LIFMDLQLPV 572

Query: 1044 MDGLLSTKMIR-----RDLNYTHP--IVALTAFADDSNIRECLDAGMDGFLAKPIKRAQL 1096
            + G+ + K IR     R  +   P  IVALTA     + R+ L +G + +L KP+    L
Sbjct: 573  LSGIDAAKQIRDCEKKRTASQNAPVIIVALTASNSIEDKRKALISGCNDYLTKPVNLHWL 632

Query: 1097 RKIIEEF 1103
             K I E+
Sbjct: 633  SKKITEW 639

>Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {ON}
            YLR006C (REAL)
          Length = 695

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 72/147 (48%), Gaps = 33/147 (22%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +L+ EDN +NQ ++   L    + + +L  +GQEA++  K   E G H  LIFMD+Q+P 
Sbjct: 488  VLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWK---EGGLH--LIFMDLQLPV 541

Query: 1044 MDGLLSTKMIR-----------RDLNYTHP----------------IVALTAFADDSNIR 1076
            + G+ + K IR           + LN ++P                IVALTA     + R
Sbjct: 542  LSGIEAAKQIRDFEKQNGIGIQKSLNNSYPNHEKLPCKKFSQAPVIIVALTASNSQMDKR 601

Query: 1077 ECLDAGMDGFLAKPIKRAQLRKIIEEF 1103
            + L +G + +L KP+    L K I E+
Sbjct: 602  KALVSGCNDYLTKPVNLHWLSKKITEW 628

>Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa] {ON}
            YLR006C (SSK1) - Two-component signal transducer that
            with Sln1p regulates osmosensing MAP kinase
            cascade(suppressor of sensor kinase) [contig 94] FULL
          Length = 587

 Score = 60.1 bits (144), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 80/174 (45%), Gaps = 32/174 (18%)

Query: 957  RLDRPFLQSTGTASSNTNLGTTSTINKI--LVAEDNDVNQEVIKRMLNLEGVHNIELVCD 1014
            R D PFL+S     +  ++       KI  LV EDN +NQ ++   L    + + ++  +
Sbjct: 392  REDSPFLRSAMETFTTESITRDKVFPKISVLVVEDNMINQTILSSFLRKHKI-SYKVAKN 450

Query: 1015 GQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRR-----DLNYTHP------- 1062
            G EA+D+ K   E G H  LI MD++MP + G+ + K IRR      +    P       
Sbjct: 451  GIEAVDRWK---EGGMH--LILMDLEMPLLSGIDAAKEIRRLEKLNGIGSGKPSTGEHAP 505

Query: 1063 -----------IVALTAFADDSNIRECLDAGMDGFLAKPIKRAQL-RKIIEEFC 1104
                       IVALTA    S+  E L AG + +L KP+    L RKI E  C
Sbjct: 506  AKRSTSKAPVIIVALTASNSQSDKTEALLAGCNDYLTKPVNLDWLTRKITEWGC 559

>YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON}
            SSK1Cytoplasmic response regulator; part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism; required for mitophagy;
            dephosphorylated form is degraded by the
            ubiquitin-proteasome system; potential Cdc28p substrate
          Length = 712

 Score = 59.7 bits (143), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 71/147 (48%), Gaps = 33/147 (22%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +L+ EDN +NQ ++   L    + + +L  +GQEA++  K   E G H  LIFMD+Q+P 
Sbjct: 506  VLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWK---EGGLH--LIFMDLQLPV 559

Query: 1044 MDGLLSTKMIR-----------RDLNYTHP----------------IVALTAFADDSNIR 1076
            + G+ + K IR           + LN +H                 IVALTA     + R
Sbjct: 560  LSGIEAAKQIRDFEKQNGIGIQKSLNNSHSNLEKGTSKRFSQAPVIIVALTASNSQMDKR 619

Query: 1077 ECLDAGMDGFLAKPIKRAQLRKIIEEF 1103
            + L +G + +L KP+    L K I E+
Sbjct: 620  KALLSGCNDYLTKPVNLHWLSKKITEW 646

>KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5.230
            YLR006C
          Length = 620

 Score = 58.5 bits (140), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 66/126 (52%), Gaps = 13/126 (10%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +L+ EDN +NQ ++   L    + + ++  +G+EA++  K     G H  LIFMD+Q+P 
Sbjct: 477  VLIVEDNVINQAILGGFLRKHKI-SYKVAKNGKEAVEMWKN---GGLH--LIFMDLQLPV 530

Query: 1044 MDGLLSTKMIRRDLNYTHP------IVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLR 1097
            + G+ + K I RD     P      IVALTA     + R  L +G + +L KP+    L 
Sbjct: 531  LSGIDAAKQI-RDFEKERPSCAPVIIVALTASNSAEDKRNALVSGCNDYLTKPVNLHWLS 589

Query: 1098 KIIEEF 1103
            K I E+
Sbjct: 590  KKITEW 595

>KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some
            similarities with uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 595

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 69/144 (47%), Gaps = 29/144 (20%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +LV EDN +NQ ++   L    +H  ++  +G EA+D+ K   E G H  LI MD++MP 
Sbjct: 408  VLVVEDNMINQAILSSFLRKHKIH-YKVAKNGVEAVDRWK---EGGMH--LILMDLEMPL 461

Query: 1044 MDGLLSTKMIRR--------------------DLNYTHP--IVALTAFADDSNIRECLDA 1081
            + G+ + K IR+                     L    P  IVALTA    ++  E L A
Sbjct: 462  LSGIDAAKEIRKLEKQNGIGTGDPLGKHAELKGLTCKAPVIIVALTASNSQTDKTEALLA 521

Query: 1082 GMDGFLAKPIKRAQL-RKIIEEFC 1104
            G + +L KP+    L RKI E  C
Sbjct: 522  GCNDYLTKPVNLDWLTRKITEWGC 545

>TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.230
            YLR006C
          Length = 730

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 71/140 (50%), Gaps = 26/140 (18%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +L+ EDN +NQ +++  L    + + ++  +GQEA+D+ K   E G   +LIFMD+Q+P 
Sbjct: 503  VLIVEDNVINQAILRSFLKKHKI-SYKVAKNGQEAVDRWK---EGG--IDLIFMDLQLPV 556

Query: 1044 MDGLLSTKMIR--RDLNY---THP---------------IVALTAFADDSNIRECLDAGM 1083
              G+ + K IR    LN    T P               IVA TA    ++ RE L +G 
Sbjct: 557  FSGMDAAKKIRDLEKLNASSETLPDSKEGDKKRSKAPVIIVAFTASNTRADKREALLSGC 616

Query: 1084 DGFLAKPIKRAQLRKIIEEF 1103
            + +L KP+    L K I E+
Sbjct: 617  NDYLTKPVNLHWLSKKINEW 636

>Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {ON}
            YLR006C (REAL)
          Length = 702

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 71/147 (48%), Gaps = 33/147 (22%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +L+ EDN +NQ ++   L    + + +L  +GQEA++  K   E G H  LIFMD+Q+P 
Sbjct: 495  VLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWK---EGGLH--LIFMDLQLPV 548

Query: 1044 MDGLLSTKMIR-----------RDLNYTHP----------------IVALTAFADDSNIR 1076
            + G+ + K IR           + LN +H                 IVALTA     + R
Sbjct: 549  LSGIEAAKQIRDFEKQNGIGIQKGLNNSHSNFDKGTSKKFSQAPVIIVALTASNSQMDKR 608

Query: 1077 ECLDAGMDGFLAKPIKRAQLRKIIEEF 1103
            + L +G + +L KP+    L K I E+
Sbjct: 609  KALLSGCNDYLTKPVNLHWLSKKITEW 635

>Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}
            complement(9754..11898) [2145 nt, 715 aa]
          Length = 714

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 46/150 (30%), Positives = 70/150 (46%), Gaps = 36/150 (24%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +L+ EDN +NQ ++   L    + + ++  +G+EA+DK K   E G H  LIFMD+Q+P 
Sbjct: 513  VLIVEDNVINQTILASFLRKHKI-SYKVAKNGREAVDKWK---EGGLH--LIFMDLQLPV 566

Query: 1044 MDGLLSTKMIRR---------------------------DLNYTHP---IVALTAFADDS 1073
            + G+ + K IR                            D N T     IVA TA    +
Sbjct: 567  LSGIDAAKEIREYEKHKGIGIQKASSTTSTTNLEDTKKIDKNSTGAPVIIVAFTASNSLT 626

Query: 1074 NIRECLDAGMDGFLAKPIKRAQLRKIIEEF 1103
            + RE L +G + +L KP+    L K I E+
Sbjct: 627  DKREALISGCNDYLTKPVNLHWLSKKITEW 656

>ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} similar to
            uniprot|Q07084 Saccharomyces cerevisiae YLR006C SSK1
            Cytoplasmic response regulator part of a two- component
            signal transducer that mediates osmosensing via a
            phosphorelay mechanism dephosphorylated form is degraded
            by the ubiquitin-proteasome system potential Cdc28p
            substrate
          Length = 776

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 76/180 (42%), Gaps = 39/180 (21%)

Query: 957  RLDRPFLQSTGTASSNTNLGTTSTIN-------KILVAEDNDVNQEVIKRMLNLEGVHNI 1009
            RL R F    G++      G  S  +        +L+ EDN +NQ ++   L    +   
Sbjct: 533  RLSRSFAPKNGSSREKPFPGEWSATSDKVFPKINVLIVEDNVINQTILSSFLRKHKIF-Y 591

Query: 1010 ELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRR-------------- 1055
            ++  +GQEA+D  +   E G H  LIFMD+Q+P + G+ + K IR               
Sbjct: 592  KVAKNGQEAIDVWR---EGGIH--LIFMDLQLPVLSGIDAAKKIRELEREHGIGIQKSRK 646

Query: 1056 ------------DLNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEF 1103
                         +N    IVA TA    S+ +E L +G + +L KP+    L   I E+
Sbjct: 647  TPHIESNKINKDQINAPVIIVAFTASKSQSDKKEALISGCNDYLTKPVNLHWLSNKINEW 706

>Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {ON}
            YLR006C (REAL)
          Length = 712

 Score = 55.8 bits (133), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 71/147 (48%), Gaps = 33/147 (22%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +L+ EDN +NQ ++   L    + + +L  +GQEA++  K   E G H  LIFMD+Q+P 
Sbjct: 505  VLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWK---EGGLH--LIFMDLQLPV 558

Query: 1044 MDGLLSTKMIR-----------RDLNYTH--------------P--IVALTAFADDSNIR 1076
            + G+ + K IR           +  N +H              P  IVALTA     + R
Sbjct: 559  LSGIEAAKQIRDFEKQNGIGIQKTPNNSHYNFEKSASKRFSQAPVIIVALTASNSQMDKR 618

Query: 1077 ECLDAGMDGFLAKPIKRAQLRKIIEEF 1103
            + L +G + +L KP+    L K I E+
Sbjct: 619  KALLSGCNDYLTKPVNLHWLSKKITEW 645

>CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {ON}
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006c SSK1 two-component signal transducer
          Length = 667

 Score = 55.8 bits (133), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 68/147 (46%), Gaps = 33/147 (22%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +L+ EDN +NQ ++   L    + + ++  +G+EA+DK K+      + +LIFMD+Q+P 
Sbjct: 465  VLIVEDNVINQAILGSFLRKNKI-SYKIAKNGKEAVDKWKE-----GNLHLIFMDLQLPV 518

Query: 1044 MDGLLSTKMIRR---------------------------DLNYTHPIVALTAFADDSNIR 1076
            + G+ + K IR                              N    IVALTA     + R
Sbjct: 519  LSGIEAAKKIRELEKERGIANQSERVSTPGSLSSINMNGSTNSPVIIVALTASNSQEDKR 578

Query: 1077 ECLDAGMDGFLAKPIKRAQLRKIIEEF 1103
            E L +G + +L KP+    L K I E+
Sbjct: 579  EALISGCNDYLTKPVNLLWLSKKITEW 605

>ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR006C
            (SSK1)
          Length = 749

 Score = 55.1 bits (131), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/150 (30%), Positives = 72/150 (48%), Gaps = 35/150 (23%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +L+ EDN +NQ ++   L    + + E+  +G EA++K ++    G H  LI MD+Q+P 
Sbjct: 511  VLIVEDNIINQAILSSFLRKHKI-SYEIAKNGVEAVEKWRK---GGIH--LILMDLQLPL 564

Query: 1044 MDGLLSTKMIRR-----------------------DLN---YTHP--IVALTAFADDSNI 1075
            + G+ + K IR                        +LN   +  P  IVALTAF+  ++ 
Sbjct: 565  LSGIDAAKQIRNLERASGICAFQKHCEARSQETYSELNRAKFRAPVIIVALTAFSSHADR 624

Query: 1076 RECLDAGMDGFLAKPIKRAQL-RKIIEEFC 1104
             E L AG + +L KP+    L  KI E  C
Sbjct: 625  NEALVAGCNDYLTKPVNLDWLSNKITEWGC 654

>NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {ON}
            Anc_5.230 YLR006C
          Length = 762

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 67/139 (48%), Gaps = 25/139 (17%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +L+ EDN +NQ ++   L    + + ++  +G+EA+D  K   E G H  LIFMD+Q+P 
Sbjct: 547  VLIVEDNVINQAILGSFLRKHKI-SYKVAKNGKEAVDIWK---EGGLH--LIFMDLQLPV 600

Query: 1044 MDGLLSTKMIRR----------------DLNYTHP---IVALTAFADDSNIRECLDAGMD 1084
            + G+ + + IR                   N T     IVALTA     + R  L +G +
Sbjct: 601  LSGIEAARQIRAFEKENGIGIQEHSNSLKKNKTKAPVIIVALTASNSQDDKRNALISGCN 660

Query: 1085 GFLAKPIKRAQLRKIIEEF 1103
             +L KP+    L K I E+
Sbjct: 661  DYLTKPVNLHWLSKKITEW 679

>TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {ON}
            Anc_5.230 YLR006C
          Length = 670

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 70/148 (47%), Gaps = 34/148 (22%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +L+ EDN +NQ ++   L    + +  +  +G+EA++K K   E G H  LIFMD+Q+P 
Sbjct: 473  VLIVEDNVINQTILASFLRKHKI-SYRIAKNGREAVEKWK---EGGIH--LIFMDLQLPV 526

Query: 1044 MDGLLSTKMIR-----RDLNYTHP-----------------------IVALTAFADDSNI 1075
            M G+ + K IR     + +   +P                       +VA TA    ++ 
Sbjct: 527  MSGIDAAKEIRECEKLKGIGIRNPMASSSSLSIVESVEKPVLGAPVIMVAFTASNSLTDK 586

Query: 1076 RECLDAGMDGFLAKPIKRAQLRKIIEEF 1103
            RE L +G + +L KP+    L K I E+
Sbjct: 587  REALVSGCNDYLTKPVNLHWLSKKITEW 614

>NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {ON}
            Anc_5.230 YLR006C
          Length = 890

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/172 (29%), Positives = 81/172 (47%), Gaps = 36/172 (20%)

Query: 962  FLQSTGTASSNTNL-GTTSTINKI------LVAEDNDVNQEVIKRMLNLEGVHNIELVCD 1014
            F  S  + S +T L G T+T  K+      L+ EDN +NQ ++   L    + + ++  +
Sbjct: 643  FTYSISSISHDTLLSGITTTSEKVFPKINVLIVEDNVINQAILGSFLRKHKI-SYKVAKN 701

Query: 1015 GQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIR----------RDLNYTHP-- 1062
            G+EA+D  K   E G H  LIFMD+Q+P + G+ + + IR          ++ N      
Sbjct: 702  GKEAVDIWK---EGGLH--LIFMDLQLPVLSGIEAARQIRDFEKEKGIGIQENNLKQKII 756

Query: 1063 -----------IVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEF 1103
                       IVALTA     + R+ L +G + +L KP+    L K I E+
Sbjct: 757  PASNINQAPVIIVALTASNSLDDKRKALLSGCNDYLTKPVNLHWLSKKITEW 808

>TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {ON}
            Anc_5.230 YLR006C
          Length = 765

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 67/150 (44%), Gaps = 36/150 (24%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            IL+ EDN +NQ ++   L    +   ++  +G+EA+DK K   E G H  LIFMD+Q+P 
Sbjct: 567  ILIVEDNVINQTILGSFLRKNKIF-YKVAKNGREAVDKWK---EGGIH--LIFMDLQLPV 620

Query: 1044 MDGLLSTKMIRR----------------------------DLNYTHP--IVALTAFADDS 1073
            + G  + K IR+                              +   P  IVA TA    +
Sbjct: 621  LSGTDAAKEIRQYEKKIGIGIQKKQSSSSDLSLSESFLNTKSSACAPVIIVAFTASNSLA 680

Query: 1074 NIRECLDAGMDGFLAKPIKRAQLRKIIEEF 1103
            + R  L AG + +L KP+    L K I E+
Sbjct: 681  DKRAALIAGCNDYLTKPVNLHWLSKKITEW 710

>KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 635

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 43/71 (60%), Gaps = 6/71 (8%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +L+ EDN +NQ ++   L   G+ + ++  DG EA++K K   E   H  LI MD+Q+P 
Sbjct: 396  VLIVEDNAINQAILALFLRKNGI-SYKVAKDGVEAIEKWK---EGDSH--LILMDLQLPL 449

Query: 1044 MDGLLSTKMIR 1054
            + GL +TK IR
Sbjct: 450  LSGLEATKKIR 460

>Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp,
            1571 aa] {ON} ANNOTATED BY YGOB -
          Length = 1571

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 46/87 (52%), Gaps = 6/87 (6%)

Query: 1029 GEHYNLIFMDVQMPKMDGLLSTKMIRR--DLNYTHPIVALTAFADDSNIRECLDAGMDGF 1086
            G  ++LI   +++PK+  +   K+IR    +N T PIVALT +  D+   +  D      
Sbjct: 1481 GVKFDLIITAMKLPKLGAIDIAKLIRHTNSVNCTTPIVALTVYYHDAKESKVFD----DV 1536

Query: 1087 LAKPIKRAQLRKIIEEFCPDKQPQEQD 1113
            L KP+   QLRK++ ++   K   E+D
Sbjct: 1537 LEKPVSVEQLRKLVSKYALLKSQNEED 1563

>SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 738

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 52/94 (55%), Gaps = 7/94 (7%)

Query: 961  PFLQSTGTASSNTNLGTTSTINKILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALD 1020
            P   +T   + NT       IN +L+ EDN +NQ ++   L    + + ++  +G+EA+D
Sbjct: 442  PSPDTTKKNTKNTRENVFPKIN-VLIVEDNVINQAILGSFLRKHKI-SYKVAKNGREAVD 499

Query: 1021 KVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIR 1054
            K KQ    G H  LI +D+Q+P + G+ +TK IR
Sbjct: 500  KWKQ---GGIH--LILLDLQLPILSGIEATKEIR 528

>ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YFL033C (RIM15)
          Length = 1569

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 51/96 (53%), Gaps = 7/96 (7%)

Query: 1020 DKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRR--DLNYTHPIVALTAFADDSNIRE 1077
            D++ +   +G  ++LI   +++PK+  +  T+++R+   +N T PIVA+T    D+    
Sbjct: 1471 DEIVRRATSGVRFDLIITTLKLPKIGAVDITRLLRQTTSINCTTPIVAVTVNYHDAGTHI 1530

Query: 1078 CLDAGMDGFLAKPIKRAQLRKIIEEFCPDKQPQEQD 1113
                  D  L +PI   QLRK++ ++   K  Q +D
Sbjct: 1531 -----FDDVLERPIGTEQLRKLVSKYALFKSQQHED 1561

>NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {ON}
            Anc_8.34
          Length = 1598

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 78/157 (49%), Gaps = 15/157 (9%)

Query: 962  FLQSTGTASSNTNLGTTST--INKILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEAL 1019
            + + +G  SS   +G+T       IL+ E   +++  +K+ L   G     ++  G  A 
Sbjct: 1439 YRRESGRGSSGAGIGSTGIGYHMDILLCEPIPIHRYRMKKDLESLGC---TVLTAG--AA 1493

Query: 1020 DKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRR--DLNYTHPIVALTAFADDSNIRE 1077
            D++    +    ++LI   +++PK+      K+++R    N T PIVA+T +      +E
Sbjct: 1494 DELISRADGQIKFDLIMTPLRLPKVGSSDIIKLLKRANGANSTTPIVAVTNY-----YQE 1548

Query: 1078 CLDAGM-DGFLAKPIKRAQLRKIIEEFCPDKQPQEQD 1113
             + +G+ D  + KPI   +LRK+I ++   K  QE+D
Sbjct: 1549 AMASGVFDDVMEKPISIKELRKLIAKYALKKSQQEED 1585

>TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON}
            Anc_8.34 YFL033C
          Length = 1602

 Score = 40.8 bits (94), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 53/99 (53%), Gaps = 8/99 (8%)

Query: 1018 ALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRR--DLNYTHPIVALTAFADDSNI 1075
            A D++     +G  ++LI   +++PK+  +   ++++    +N T P+VA+T +      
Sbjct: 1499 AGDELVSRATSGVKFDLIITALKLPKLGAVDIVRLLKHTNSINATTPVVAVTNY-----Y 1553

Query: 1076 RECLDAGM-DGFLAKPIKRAQLRKIIEEFCPDKQPQEQD 1113
            +E +   + D  L KP+   QLRKI  ++  +K  Q++D
Sbjct: 1554 QEAVSGNVFDDVLEKPVAYDQLRKIAAKYTLEKVQQQED 1592

>SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] {ON}
            similar to uniprot|Q75BQ3 Ashbya gossypii ACR218W
            ACR218Wp and some similarites with YFL033C uniprot|P43565
            Saccharomyces cerevisiae YFL033C RIM15
            Glucose-repressible protein kinase involved in signal
            transduction during cell proliferation in response to
            nutrients specifically the establishment of stationary
            phase originally identified as a regulator of IME2
          Length = 1588

 Score = 40.0 bits (92), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 56/119 (47%), Gaps = 15/119 (12%)

Query: 1006 VHNIELVCD---------GQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRR- 1055
            +H   LV D         G  A D++ +    G  ++LI   +++PK+  +   K++R  
Sbjct: 1450 IHRYRLVKDLESLGCSVVGVGAGDELVRRATAGVKFDLIITALKLPKLGAVDIAKLLRHT 1509

Query: 1056 -DLNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEFCPDKQPQEQD 1113
               N   PIVA+TA+  ++   +  D      L KP+   Q+R +I ++   K  +++D
Sbjct: 1510 NSANCNTPIVAVTAYYGEAESTQVFD----DVLEKPVGIEQIRCLIAKYALQKSQEDED 1564

>KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 421

 Score = 38.9 bits (89), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 37/81 (45%), Gaps = 15/81 (18%)

Query: 811 ISIVVEDTGPGIDSSLHESVFEPFV------QGDQALS---------RQYGGTGLGLSIC 855
           + I + D G GID  + + VF+         + D  +S         +   G G GL +C
Sbjct: 325 LEIRIRDFGGGIDPQVEDRVFDYSFSTTVKEEKDSGMSDYVLPGQEVQNVAGMGFGLPMC 384

Query: 856 RQLATMMNGTMDLKSKLGVGS 876
           +    + NGT+D++S  G G+
Sbjct: 385 KAYLELFNGTLDIQSLWGWGT 405

>Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} similar to
            Ashbya gossypii ACR218W
          Length = 1694

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 65/134 (48%), Gaps = 16/134 (11%)

Query: 984  ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPK 1043
            +L+ E   +++  + R L L G  ++  V  G    D++ +   +G  ++LI   +++PK
Sbjct: 1564 VLLCEPIPIHRYRLARDLELLGC-SVVAVGTG----DEIVRRATSGVRFDLIITTLKLPK 1618

Query: 1044 MDGLLSTKMIRR--DLNYTHPIVALTAFADD--SNIRECLDAGMDGFLAKPIKRAQLRKI 1099
            +  +   +++R    +N   PIVA+     D  SNI        D  L +PI   QLRK+
Sbjct: 1619 IGAIDIARLLRHTTSINCNTPIVAVAVNYHDVGSNI-------FDDVLERPIGVEQLRKM 1671

Query: 1100 IEEFCPDKQPQEQD 1113
            + ++   K  Q+ +
Sbjct: 1672 VSKYALLKSQQQHE 1685

>Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556)
            [4554 bp, 1517 aa] {ON}
            (101912..102910,102960..102968,103011..106556) [4554 nt,
            1518 aa]
          Length = 1517

 Score = 37.4 bits (85), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 62/131 (47%), Gaps = 14/131 (10%)

Query: 997  IKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRD 1056
            I R     G+ ++        A D++ +   +G  ++LI   +++PK+  +   K+++  
Sbjct: 1394 IHRYCTTSGLESLGCTVVAVGAGDELVRRATSGVKFDLIITALRIPKLGAVDIVKLLKHT 1453

Query: 1057 --LNYTHPIVALTAF---ADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEFCPDKQPQE 1111
              +N T PIVA T +   A ++N+           L KPI    LRK+I ++   K   +
Sbjct: 1454 NGINSTTPIVAATCYFEEASNTNV-------FSDVLEKPISIQTLRKLISKYALIK--SQ 1504

Query: 1112 QDKEPKSSEND 1122
            + +E   S+ND
Sbjct: 1505 RQEESIQSDND 1515

>YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}
            RIM15Glucose-repressible protein kinase involved in
            signal transduction during cell proliferation in response
            to nutrients, specifically the establishment of
            stationary phase; identified as a regulator of IME2;
            substrate of Pho80p-Pho85p kinase
          Length = 1770

 Score = 37.0 bits (84), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 22/98 (22%), Positives = 52/98 (53%), Gaps = 6/98 (6%)

Query: 1018 ALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRD--LNYTHPIVALTAFADDSNI 1075
            A D++     +G  ++LI   +++PK+  +   +++++    N T PIVA+T +  ++  
Sbjct: 1666 AGDELVSRATSGVSFDLIMTALKLPKLGAIDIVQLLKQTNGANSTTPIVAITNYFQEAAT 1725

Query: 1076 RECLDAGMDGFLAKPIKRAQLRKIIEEFCPDKQPQEQD 1113
                D      L KP+K  +L+K++ ++   K  ++++
Sbjct: 1726 SRVFD----DVLEKPVKLDELKKLVAKYALKKSQEDEE 1759

>CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} similar
            to uniprot|P43565 Saccharomyces cerevisiae YFL033c RIM15
            protein kinase involved in expression of meiotic genes
          Length = 1682

 Score = 36.2 bits (82), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 49/97 (50%), Gaps = 8/97 (8%)

Query: 1018 ALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRD--LNYTHPIVALTAFADDSNI 1075
            A D++     +G  ++LI   +++PK+  +   K+I+    +N   PI+A+T F      
Sbjct: 1573 AGDELVSRANSGVKFDLIVTALKLPKLGAIDIVKLIKHTNGINSRTPIIAITNF-----Y 1627

Query: 1076 RECLDAGM-DGFLAKPIKRAQLRKIIEEFCPDKQPQE 1111
             E + A + D  L KPI   ++R ++ ++   K  +E
Sbjct: 1628 HEAISAKVFDDVLEKPIMLDEIRHLVAKYALKKSQEE 1664

>Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON}
            YFL033C (REAL)
          Length = 1758

 Score = 36.2 bits (82), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 54/99 (54%), Gaps = 8/99 (8%)

Query: 1018 ALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRD--LNYTHPIVALTAFADDSNI 1075
            A D++     +G  ++LI   +++PK+  +   +++R+    N T PIVA+T +      
Sbjct: 1654 AGDELVSRATSGVSFDLIMTALKLPKLGAIDIVQLLRQTNGANSTTPIVAITNY-----F 1708

Query: 1076 RECLDAGM-DGFLAKPIKRAQLRKIIEEFCPDKQPQEQD 1113
            +E + + + D  L KP+   +L+K++ ++   K  ++++
Sbjct: 1709 QEAITSKVFDDVLEKPVNLDELKKLVAKYALKKSQEDEE 1747

>SAKL0F08184g Chr6 (623521..624759) [1239 bp, 412 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 412

 Score = 35.8 bits (81), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 36/81 (44%), Gaps = 15/81 (18%)

Query: 811 ISIVVEDTGPGIDSSLHESVFEPFVQGDQALSRQYG---------------GTGLGLSIC 855
           + I + D G GI   + + +FE      QA ++  G               G G GL +C
Sbjct: 317 LEIRIRDFGGGIPPEVEDRMFEYSYSTVQANTKDTGMSAYVIPGEEVNNVSGMGFGLPMC 376

Query: 856 RQLATMMNGTMDLKSKLGVGS 876
           +    M +G++D++S  G G+
Sbjct: 377 KAYLEMFDGSLDIQSLYGWGT 397

>KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} similar
            to uniprot|P43565 Saccharomyces cerevisiae YFL033C RIM15
            Glucose-repressible protein kinase involved in signal
            transduction during cell proliferation in response to
            nutrients specifically the establishment of stationary
            phase originally identified as a regulator of IME2
          Length = 1524

 Score = 36.2 bits (82), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 50/93 (53%), Gaps = 6/93 (6%)

Query: 1032 YNLIFMDVQMPKMDGLLSTKMIRR--DLNYTHPIVALTAFADDSNIRECLDAGMDGFLAK 1089
            ++LIF  +++PK+  +   K++R    +N T  I+A+TA+  ++  + C     D  L +
Sbjct: 1434 FDLIFTALKLPKLGAIDIVKLLRNTNSVNSTTSIIAVTAYFQEAQ-QAC---AFDEVLER 1489

Query: 1090 PIKRAQLRKIIEEFCPDKQPQEQDKEPKSSEND 1122
            P+   QLR ++ ++   K  + ++     +E++
Sbjct: 1490 PVSVQQLRSLLLKYSLKKSQESEENSISDAEHE 1522

>NDAI0B01430 Chr2 (331560..334751) [3192 bp, 1063 aa] {ON} Anc_2.582
           YKL057C
          Length = 1063

 Score = 35.8 bits (81), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 58/131 (44%), Gaps = 7/131 (5%)

Query: 168 SLQSEGILTNPVL-NGTSYLMSMSLPIFANPSIILTTSHVYGYIT------IVMSADSLK 220
           S Q +G    P+L N  SYL S++  +F      +T+S    YI       I+++     
Sbjct: 193 STQDDGKELQPILFNDNSYLKSVATLLFRRNKDNITSSKAISYIVFEQKFLIILTQSCHL 252

Query: 221 NVFDDTTALEKSNVAILSAVYDQNETLSSYNFVFAPLGVPSSILAETIPIKNGTFLSSAL 280
            +++ +T +   N  +      QN T+  Y+ + + L + ++ LA  +P +NG F    L
Sbjct: 253 KIWNLSTFILVQNYELPKDFQQQNTTIRGYDLIGSYLSIFNNNLAIFLPFENGMFQLGNL 312

Query: 281 RQGKGGALERT 291
                G L  T
Sbjct: 313 LFDSNGNLSYT 323

>Kwal_47.18151 s47 (709368..710612) [1245 bp, 414 aa] {ON} YIL042C -
           Hypothetical ORF [contig 197] FULL
          Length = 414

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%)

Query: 847 GTGLGLSICRQLATMMNGTMDLKSKLGVGS 876
           G G GL +C+    M NGT+D++S  G G+
Sbjct: 370 GMGFGLPMCKAYMEMFNGTLDIQSLWGWGT 399

>TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8.34
            YFL033C
          Length = 1972

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 44/84 (52%), Gaps = 6/84 (7%)

Query: 1032 YNLIFMDVQMPKMDGLLSTKMIRRD--LNYTHPIVALTAFADDSNIRECLDAGMDGFLAK 1089
            ++LI   +++PK+D +   K+I++   +N   PI+A T +  ++      +  M+    K
Sbjct: 1884 FDLIITALKLPKIDAVDIVKLIKQTNGINSLTPIIAATNYTQEAETCHVFNDIME----K 1939

Query: 1090 PIKRAQLRKIIEEFCPDKQPQEQD 1113
            PI+   LR+++  +   K   E+D
Sbjct: 1940 PIQLDILRRVVSRYALQKSQIEED 1963

>Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON}
            YFL033C (REAL)
          Length = 1760

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 54/99 (54%), Gaps = 8/99 (8%)

Query: 1018 ALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRD--LNYTHPIVALTAFADDSNI 1075
            A D++     +G  ++LI   +++PK+  +   +++++    N T PIVA+T +      
Sbjct: 1656 AGDELVSRATSGVSFDLIMTALKLPKLGAIDIVQLLKQTNGANSTTPIVAITNY-----F 1710

Query: 1076 RECLDAGM-DGFLAKPIKRAQLRKIIEEFCPDKQPQEQD 1113
            +E + + + D  L KP+   +L+K++ ++   K  ++++
Sbjct: 1711 QEAITSKVFDDVLEKPVNLDELKKLVAKYALKKSQEDEE 1749

>KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8.34
            YFL033C
          Length = 1450

 Score = 34.3 bits (77), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 44/84 (52%), Gaps = 8/84 (9%)

Query: 1032 YNLIFMDVQMPKMDGLLSTKMIRRD--LNYTHPIVALTAFADDS-NIRECLDAGMDGFLA 1088
            ++LI   +++P +      K+++R   +N   PIVA T +  D+ N +       D  + 
Sbjct: 1358 FDLIVTTLRLPNVYATDIIKLVKRANCVNSDTPIVAATNYYQDAVNTK-----FFDDVVE 1412

Query: 1089 KPIKRAQLRKIIEEFCPDKQPQEQ 1112
            KP+ R +LRK++ ++   K  +E+
Sbjct: 1413 KPLSREKLRKLVSKYALKKSQEEE 1436

>TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4.385
            YJR147W
          Length = 791

 Score = 33.5 bits (75), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 48/102 (47%), Gaps = 12/102 (11%)

Query: 1011 LVCDGQEALDKVKQLVENGEHYNLIFMD-----VQMPKMDGLLSTKMIRRDLNYTHPIVA 1065
            +  D  +   K K+ + N + Y+L+ +D     + +P ++ +LS+      + Y  PI+ 
Sbjct: 516  ITVDIMQDWPKTKEKILN-KCYDLVIIDAHVKFLNVPILESMLSS------IQYHPPIIL 568

Query: 1066 LTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEFCPDK 1107
            +T+  +D  +   L  G++  L KP    +L K +     DK
Sbjct: 569  MTSSLNDQQLIFYLQHGINSILEKPFHSHKLLKFLVNLLKDK 610

>ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] {ON}
            similar to uniprot|Q75BQ3 Ashbya gossypii ACR218W
            ACR218Wp and some similarites with YFL033C uniprot|P43565
            Saccharomyces cerevisiae YFL033C RIM15
            Glucose-repressible protein kinase involved in signal
            transduction during cell proliferation in response to
            nutrients specifically the establishment of stationary
            phase originally identified as a regulator of IME2
          Length = 1604

 Score = 33.1 bits (74), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 70/155 (45%), Gaps = 15/155 (9%)

Query: 962  FLQSTGTASSNTNLGTTSTINKILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDK 1021
            + + +G  SSNT          +LV E   +++  + R L   G   I  V  G E + +
Sbjct: 1455 YRRRSGRKSSNTE--DVRYYMDVLVCEPISIHRYRVTRELEDLGCAVI-AVGAGDELIGR 1511

Query: 1022 VKQLVENGEHYNLIFMDVQMPKMDG--LLSTKMIRRDLNYTHPIVALTAFADDSNIRECL 1079
                  +G  ++LI   +++PK+    ++S        N T P+VALT +      +E +
Sbjct: 1512 AT----SGIKFDLIMTALKLPKLGAADIVSLLKYTNGTNSTTPVVALTNY-----YQEAV 1562

Query: 1080 DAGM-DGFLAKPIKRAQLRKIIEEFCPDKQPQEQD 1113
               + +  L KP+    LRKI+ ++   K  Q+++
Sbjct: 1563 SLNLFNDVLEKPVLADSLRKIVAKYALKKSQQQEE 1597

>Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {ON}
            YFL033C (RIM15) - Trehalose-associated protein kinase
            related to S. pombe cek1+ [contig 244] FULL
          Length = 1521

 Score = 33.1 bits (74), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 40/72 (55%), Gaps = 8/72 (11%)

Query: 1032 YNLIFMDVQMPKMDGLLSTKMIR--RDLNYTHPIVALTAFADDSNIRECLDAGM-DGFLA 1088
            ++LIF  +++PK+  +   K++R    +N T  I+A+TA+      +E   AG+ +  L 
Sbjct: 1431 FDLIFTALKLPKLGAIDIVKLLRNTNSVNSTTSIIAVTAY-----YQEAQQAGVFEDVLE 1485

Query: 1089 KPIKRAQLRKII 1100
            +P    QLR ++
Sbjct: 1486 RPATVQQLRSLL 1497

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 105,863,231
Number of extensions: 4282310
Number of successful extensions: 14269
Number of sequences better than 10.0: 106
Number of HSP's gapped: 14493
Number of HSP's successfully gapped: 166
Length of query: 1166
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1045
Effective length of database: 39,606,813
Effective search space: 41389119585
Effective search space used: 41389119585
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)