Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0G06600g5.702ON1820182083780.0
TDEL0B021905.702ON1810182831620.0
SAKL0E14916g5.702ON1779183726760.0
Smik_11.3585.702ON1878157225460.0
YKR095W (MLP1)5.702ON1875158625410.0
Skud_11.3345.702ON1885156224720.0
Suva_11.3315.702ON1898156724310.0
Ecym_40185.702ON1769167623760.0
NCAS0A032005.702ON1788183922800.0
KLTH0E01056g5.702ON1771166522000.0
CAGL0G02497g5.702ON1780165721130.0
Kwal_55.196975.702ON1760140420960.0
KLLA0A00594g5.702ON1748168819710.0
AFR286W5.702ON1758173019430.0
NDAI0E050405.702ON1973168218290.0
NCAS0G002305.702ON1735182313461e-155
TBLA0E017305.702ON1820119612731e-145
Suva_9.395.702ON1682159111661e-131
Skud_9.195.702ON1680158011281e-126
YIL149C (MLP2)5.702ON1679156011091e-124
KAFR0D022205.702ON1674172210761e-119
Smik_9.205.702ON1682155610441e-115
KNAG0C065905.702ON165113999411e-102
KAFR0H002105.702ON145411336812e-71
KNAG0L021405.702ON160814076752e-70
NDAI0F002905.702ON15546545411e-54
Kpol_1043.705.702ON13214655241e-52
TPHA0E002305.702ON12844803244e-29
TPHA0D046105.702ON11832102555e-21
Kpol_2001.755.702ON10062491204e-05
KLTH0D09504g8.604ON7182371010.005
SAKL0E06930g2.315ON33985920.040
Ecym_41698.398ON53575910.075
SAKL0H03300g4.238ON1707219890.15
YDR192C (NUP42)8.398ON43090850.41
TDEL0A054908.604ON781154821.0
Skud_4.4578.398ON43070801.4
KAFR0A073602.98ON39060792.0
TDEL0E043605.193ON65977792.3
YFL008W (SMC1)8.68ON1225255773.5
Kpol_1042.194.199ON44192764.1
SAKL0H09328g8.570ON596119764.9
TDEL0E013304.238ON1657166765.0
KLLA0F20702g8.415ON90278765.5
NCAS0F005205.88ON108679765.7
TDEL0G043706.32ON760165756.2
KAFR0G020908.604ON732129747.7
SAKL0D06930g1.319ON690105747.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0G06600g
         (1820 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...  3231   0.0  
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...  1222   0.0  
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...  1035   0.0  
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...   985   0.0  
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...   983   0.0  
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...   956   0.0  
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...   941   0.0  
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...   919   0.0  
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...   882   0.0  
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...   852   0.0  
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...   818   0.0  
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...   811   0.0  
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...   763   0.0  
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...   753   0.0  
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...   709   0.0  
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...   523   e-155
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...   494   e-145
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...   453   e-131
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...   439   e-126
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...   431   e-124
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...   419   e-119
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...   406   e-115
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...   367   e-102
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...   266   2e-71
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...   264   2e-70
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...   213   1e-54
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...   206   1e-52
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...   129   4e-29
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...   102   5e-21
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    51   4e-05
KLTH0D09504g Chr4 (783223..785379) [2157 bp, 718 aa] {ON} weakly...    44   0.005
SAKL0E06930g Chr5 complement(573913..574932) [1020 bp, 339 aa] {...    40   0.040
Ecym_4169 Chr4 (359440..361047) [1608 bp, 535 aa] {ON} similar t...    40   0.075
SAKL0H03300g Chr8 (309151..314274) [5124 bp, 1707 aa] {ON} simil...    39   0.15 
YDR192C Chr4 complement(843569..844861) [1293 bp, 430 aa] {ON}  ...    37   0.41 
TDEL0A05490 Chr1 (962132..964477) [2346 bp, 781 aa] {ON} Anc_8.6...    36   1.0  
Skud_4.457 Chr4 complement(810243..811535) [1293 bp, 430 aa] {ON...    35   1.4  
KAFR0A07360 Chr1 complement(1485231..1486403) [1173 bp, 390 aa] ...    35   2.0  
TDEL0E04360 Chr5 complement(809654..811633) [1980 bp, 659 aa] {O...    35   2.3  
YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subun...    34   3.5  
Kpol_1042.19 s1042 (43301..43636,43639..44628) [1326 bp, 441 aa]...    34   4.1  
SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} simila...    34   4.9  
TDEL0E01330 Chr5 (260599..265572) [4974 bp, 1657 aa] {ON} Anc_4....    34   5.0  
KLLA0F20702g Chr6 complement(1927059..1929767) [2709 bp, 902 aa]...    34   5.5  
NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5....    34   5.7  
TDEL0G04370 Chr7 complement(789063..791345) [2283 bp, 760 aa] {O...    33   6.2  
KAFR0G02090 Chr7 complement(437389..439587) [2199 bp, 732 aa] {O...    33   7.7  
SAKL0D06930g Chr4 complement(573700..575772) [2073 bp, 690 aa] {...    33   7.7  

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] {ON}
            some similarities with uniprot|Q02455 Saccharomyces
            cerevisiae YKR095W MLP1 Myosin-like protein associated
            with the nuclear envelope, connects the nuclear pore
            complex with the nuclear interior; involved in the Tel1p
            pathway that controls telomere length; involved in the
            retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score = 3231 bits (8378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1673/1820 (91%), Positives = 1673/1820 (91%)

Query: 1    MSEGETGVANIVTSGDNHNDVSLGKLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKS 60
            MSEGETGVANIVTSGDNHNDVSLGKLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKS
Sbjct: 1    MSEGETGVANIVTSGDNHNDVSLGKLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKS 60

Query: 61   QNLRLNVTIDEIKTVSSKREEGLKNEIENLMKDNDSIRLERSQAQEESTQSSRDKQKIQN 120
            QNLRLNVTIDEIKTVSSKREEGLKNEIENLMKDNDSIRLERSQAQEESTQSSRDKQKIQN
Sbjct: 61   QNLRLNVTIDEIKTVSSKREEGLKNEIENLMKDNDSIRLERSQAQEESTQSSRDKQKIQN 120

Query: 121  EVESLQEKLSDLDQERETLKQDKREVVAVLEEKIKELESFRTESRKSLDDSKRLRQQVLE 180
            EVESLQEKLSDLDQERETLKQDKREVVAVLEEKIKELESFRTESRKSLDDSKRLRQQVLE
Sbjct: 121  EVESLQEKLSDLDQERETLKQDKREVVAVLEEKIKELESFRTESRKSLDDSKRLRQQVLE 180

Query: 181  LETTVQNLKSKELRDQSEIQTITQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDR 240
            LETTVQNLKSKELRDQSEIQTITQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDR
Sbjct: 181  LETTVQNLKSKELRDQSEIQTITQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDR 240

Query: 241  LTSESLSCKNELQLEKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSM 300
            LTSESLSCKNELQLEKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSM
Sbjct: 241  LTSESLSCKNELQLEKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSM 300

Query: 301  KQKLIDLLENQVKSLQGELNASLDKDNVELLASGERNTENEKLIQELITXXXXXXXXXXX 360
            KQKLIDLLENQVKSLQGELNASLDKDNVELLASGERNTENEKLIQELIT           
Sbjct: 301  KQKLIDLLENQVKSLQGELNASLDKDNVELLASGERNTENEKLIQELITLKENFEESERE 360

Query: 361  XXXXXXXXXXXIPGDDSQDDINNTSSFISLRNKDSSLRDMGILKKELIKERHQKERLQRQ 420
                       IPGDDSQDDINNTSSFISLRNKDSSLRDMGILKKELIKERHQKERLQRQ
Sbjct: 361  RLRLEALVQELIPGDDSQDDINNTSSFISLRNKDSSLRDMGILKKELIKERHQKERLQRQ 420

Query: 421  VESFIVELEYKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDS 480
            VESFIVELEYKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDS
Sbjct: 421  VESFIVELEYKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDS 480

Query: 481  ESSIHTLTRQRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDDPNSESDSQR 540
            ESSIHTLTRQRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDDPNSESDSQR
Sbjct: 481  ESSIHTLTRQRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDDPNSESDSQR 540

Query: 541  VISERLVEFNNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIV 600
            VISERLVEFNNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIV
Sbjct: 541  VISERLVEFNNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIV 600

Query: 601  SLQDYNANLESKVEILTKECDAFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLE 660
            SLQDYNANLESKVEILTKECDAFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLE
Sbjct: 601  SLQDYNANLESKVEILTKECDAFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLE 660

Query: 661  ARLTSLTVESSQNNKMLNNEIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTR 720
            ARLTSLTVESSQNNKMLNNEIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTR
Sbjct: 661  ARLTSLTVESSQNNKMLNNEIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTR 720

Query: 721  NENQQLVKRSQNLQSIFDRQDSRTAETVNELIACNSKLAVLETKVANLETEKELLQSSER 780
            NENQQLVKRSQNLQSIFDRQDSRTAETVNELIACNSKLAVLETKVANLETEKELLQSSER
Sbjct: 721  NENQQLVKRSQNLQSIFDRQDSRTAETVNELIACNSKLAVLETKVANLETEKELLQSSER 780

Query: 781  TSRENYLKLSEERNSLRIMVSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLD 840
            TSRENYLKLSEERNSLRIMVSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLD
Sbjct: 781  TSRENYLKLSEERNSLRIMVSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLD 840

Query: 841  AKTKEAEDMENSKRTQIQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVE 900
            AKTKEAEDMENSKRTQIQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVE
Sbjct: 841  AKTKEAEDMENSKRTQIQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVE 900

Query: 901  ESEARIQSYQVLSGSEVETSPESSLRKELEKTKINLSDTYAEIDQYKNXXXXXXXXXXXX 960
            ESEARIQSYQVLSGSEVETSPESSLRKELEKTKINLSDTYAEIDQYKN            
Sbjct: 901  ESEARIQSYQVLSGSEVETSPESSLRKELEKTKINLSDTYAEIDQYKNLLSTTEESLSQL 960

Query: 961  XXDYASGKQELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKK 1020
              DYASGKQELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKK
Sbjct: 961  TQDYASGKQELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKK 1020

Query: 1021 IATLETESKGSHQLKEEYDAQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISEL 1080
            IATLETESKGSHQLKEEYDAQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISEL
Sbjct: 1021 IATLETESKGSHQLKEEYDAQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISEL 1080

Query: 1081 REQSQKDRIAITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSLL 1140
            REQSQKDRIAITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSLL
Sbjct: 1081 REQSQKDRIAITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSLL 1140

Query: 1141 YDQIELFSKDNSDGVNGETAEVREILTNLRRERDILGTKLTVSQREEQTLRGSLASVENE 1200
            YDQIELFSKDNSDGVNGETAEVREILTNLRRERDILGTKLTVSQREEQTLRGSLASVENE
Sbjct: 1141 YDQIELFSKDNSDGVNGETAEVREILTNLRRERDILGTKLTVSQREEQTLRGSLASVENE 1200

Query: 1201 LDTTKRQLSQFQKEITTHSELIGQHEKIIEQLNQLNLLRESNITXXXXXXXXXXXXXXXX 1260
            LDTTKRQLSQFQKEITTHSELIGQHEKIIEQLNQLNLLRESNIT                
Sbjct: 1201 LDTTKRQLSQFQKEITTHSELIGQHEKIIEQLNQLNLLRESNITLRNAAEEENKKNRELQ 1260

Query: 1261 XXXXXXXXXILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPEDH 1320
                     ILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPEDH
Sbjct: 1261 EELNQLRERILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPEDH 1320

Query: 1321 KELKEKVSILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAK 1380
            KELKEKVSILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAK
Sbjct: 1321 KELKEKVSILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAK 1380

Query: 1381 SELEGKFEAEERKVHELQERLNAHGNDTETVESVQKELSDALEHSRELEQNLSATLQQNE 1440
            SELEGKFEAEERKVHELQERLNAHGNDTETVESVQKELSDALEHSRELEQNLSATLQQNE
Sbjct: 1381 SELEGKFEAEERKVHELQERLNAHGNDTETVESVQKELSDALEHSRELEQNLSATLQQNE 1440

Query: 1441 EITKKLNDEIDSLKLELHSLKEQSAATAKGEISEDLSNVVESMRRSFEEEKINFXXXXXX 1500
            EITKKLNDEIDSLKLELHSLKEQSAATAKGEISEDLSNVVESMRRSFEEEKINF      
Sbjct: 1441 EITKKLNDEIDSLKLELHSLKEQSAATAKGEISEDLSNVVESMRRSFEEEKINFLKEKTE 1500

Query: 1501 XXXXXXXXXHTLQVNGNEPQQQPVNYEEIKRQWESEQEESILKRIAEAEENLKKRIRLPT 1560
                     HTLQVNGNEPQQQPVNYEEIKRQWESEQEESILKRIAEAEENLKKRIRLPT
Sbjct: 1501 ELKKLEEEKHTLQVNGNEPQQQPVNYEEIKRQWESEQEESILKRIAEAEENLKKRIRLPT 1560

Query: 1561 EERIKQVVXXXXXXXXXXXXXXXXXXXXXXXXXDGNNSXXXXXXXXXXXXXFEAEVQAVK 1620
            EERIKQVV                         DGNNS             FEAEVQAVK
Sbjct: 1561 EERIKQVVEKKKAALEELYKKKLEESKSSLESSDGNNSDLKKQLEKDLQEKFEAEVQAVK 1620

Query: 1621 KKAFEEGKQQAAMKSTLLERKISKLESQLHGKXXXXXXXXXXXXXXXXPNLPSKIDEKSV 1680
            KKAFEEGKQQAAMKSTLLERKISKLESQLHGK                PNLPSKIDEKSV
Sbjct: 1621 KKAFEEGKQQAAMKSTLLERKISKLESQLHGKVDSPDKSSSETSSVPKPNLPSKIDEKSV 1680

Query: 1681 TTNQSVPNPLVSGEKVLKLDPSKXXXXXXXXXXXXXXXXXPQNNDTMGTSAFGFKPTFTL 1740
            TTNQSVPNPLVSGEKVLKLDPSK                 PQNNDTMGTSAFGFKPTFTL
Sbjct: 1681 TTNQSVPNPLVSGEKVLKLDPSKPTFNFSSFSGGNPFTSSPQNNDTMGTSAFGFKPTFTL 1740

Query: 1741 SNNSNKSSGTKIDSSSTENKPANPFSSFTETGASSPERESSNTAMTPTPGEGASTPSKRA 1800
            SNNSNKSSGTKIDSSSTENKPANPFSSFTETGASSPERESSNTAMTPTPGEGASTPSKRA
Sbjct: 1741 SNNSNKSSGTKIDSSSTENKPANPFSSFTETGASSPERESSNTAMTPTPGEGASTPSKRA 1800

Query: 1801 AEDDDNEVGSESKKPREENA 1820
            AEDDDNEVGSESKKPREENA
Sbjct: 1801 AEDDDNEVGSESKKPREENA 1820

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1810

 Score = 1222 bits (3162), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 770/1828 (42%), Positives = 1144/1828 (62%), Gaps = 51/1828 (2%)

Query: 1    MSEGETGVANIVTSGDNHNDVSLGKLSAFYGVPEDQL--VLIDGGILTILENKVLDFNEL 58
            MSE ET V      G +  D    +++ F G+ +D+L  VL D  +   L NK+ +FN L
Sbjct: 1    MSEKETLV------GSSGTDELSQRIAGFLGISDDELKPVLADHVLSDCLVNKLQEFNNL 54

Query: 59   KSQNLRLNVTIDEIKTVSSKREEGLKNEIENLMKDNDSIRLERSQAQEESTQSSRDKQKI 118
            +S NLRL+ T+DE+K + + + + LK E E L+++ND+ +  R++ +E+ +Q +++K   
Sbjct: 55   QSNNLRLHATVDELKALCTSKVDSLKKETERLIRENDTEKQRRNRLEEQVSQLTKEKTLA 114

Query: 119  QNEVESLQEKLSDLDQERETLKQDKREVVAVLEEKIKELESFRTESRKSLDDSKRLRQQV 178
              ++E+++ +L +  +++  LK +K+EVV +LEEKI ELE+ + ES++ ++D+K LRQQ+
Sbjct: 115  LGQMENVKFELQNTIEQKNVLKSNKQEVVKLLEEKISELEASKVESQELVNDNKNLRQQL 174

Query: 179  LELETTVQNLKSKELRDQSEIQTITQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDEL 238
            +E +  VQ LK   L D+SE++ + Q++ +L K+++WLE+EVTSKTEQLI  R++ND EL
Sbjct: 175  METQNEVQTLKCNGLGDKSELEIVKQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTEL 234

Query: 239  DRLTSESLSCKNELQLEKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEM 298
             +   E    KN+ QLEKS  + +  KN+E+++ LQ KL E+K LSD L  EKQEF+ EM
Sbjct: 235  QKSLQEVARLKNDYQLEKSSREFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREM 294

Query: 299  SMKQKLIDLLENQVKSLQGELNASLDKDNVELLASGERNTENEKLIQELITXXXXXXXXX 358
            S+KQKL+DL + Q++S + EL  + +K N    A   ++T+  + + +L           
Sbjct: 295  SLKQKLLDLQDEQLQSFKEELRLTEEKHN-STEADNLQSTQQARFMDDL-AQVRQQLEES 352

Query: 359  XXXXXXXXXXXXXIPGDDSQDDINNTSSFISLRNKDSSLRDMGILKKELIKERHQKERLQ 418
                         + GD  + D+++T++ +S+        D+G+LKK+LIKERHQKE LQ
Sbjct: 353  NHERLRLQAVVNEVMGDSEEFDLDSTAN-VSI---PKLYGDIGVLKKQLIKERHQKENLQ 408

Query: 419  RQVESFIVELEYKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVK 478
            RQ+ESF+VELEYK+PVINS KER+  LEKEL+D+ALLL+HTS+EKE++ RE E+ + K+K
Sbjct: 409  RQIESFVVELEYKVPVINSLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIK 468

Query: 479  DSESSIHTLTRQRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDDPNSESDS 538
              E + HTL RQR+DLA QVQFLL N ++Q DS G L+A+EV+FIK+I+ N++P++ESDS
Sbjct: 469  QLEINTHTLIRQRSDLARQVQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENPSNESDS 528

Query: 539  QRVISERLVEFNNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEA 598
            Q +I+ERLVEF +IATLQE+N ELLKT R LA++LE EEK+ N +I + E  TI EAKEA
Sbjct: 529  QSIITERLVEFKDIATLQERNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEA 588

Query: 599  IVSLQDYNANLESKVEILTKECDAFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRT 658
            I++LQ+ N+ +ESKV  + KE DA+KAI S+     +    A+     ++   ++E +++
Sbjct: 589  IITLQERNSEIESKVSTIEKERDAYKAILSQTSQSFDNLGDADRM---KDSQENQELIKS 645

Query: 659  LEARLTSLTVESSQNNKMLNNEIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLEL 718
            LE +L++LT E+S+NN++LN EI  LY+SKTQ++I  EKERSS+TL E+RLKL+Q TLE+
Sbjct: 646  LEDKLSTLTTETSKNNELLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEM 705

Query: 719  TRNENQQLVKRSQNLQSIFDRQDSRTAETVNELIACNSKLAVLETKVANLETEKELLQSS 778
            T+NEN +L++RS  LQSI  +Q++R  ETVN+ I+C SKL+VLE + ANL+ EK LLQSS
Sbjct: 706  TKNENAELIRRSHELQSILSKQEARNGETVNKYISCQSKLSVLEARAANLDAEKSLLQSS 765

Query: 779  ERTSRENYLKLSEERNSLRIMVSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARAR 838
              + R    K+S ERNSL +MV+QLQTLQSERE  LKE Q ++K  +  LE + ++ +  
Sbjct: 766  SDSLRREIQKISVERNSLNLMVTQLQTLQSERENLLKESQASHKAAIAQLEVQTSELKTE 825

Query: 839  LDAKTKEAEDMENSKRTQIQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQ 898
            + +K  E +  E++KR Q +W+Q+K+D + +++  ++ EL TKT  V  LE EV  L+K+
Sbjct: 826  ISSKDNEIKASEDAKRAQTKWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKK 885

Query: 899  VEESEARIQSYQVLSGSEVETSPESSLRKELEKTKINLSDTYAEIDQYKNXXXXXXXXXX 958
            +EES++RI SY+ L+ +    + +  LRK+LEKT I L   Y++ +++K           
Sbjct: 886  IEESDSRIASYKTLNDAGNGETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLK 945

Query: 959  XXXXDYASGKQELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQ 1018
                ++    + L+   E    EK QL+  V+ L +++  L          +E EKN + 
Sbjct: 946  NLSNEFEERTEALKSNAEKYLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEIL 1005

Query: 1019 KKIATLETESKGSHQLKEEYDAQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTIS 1078
            KK+ +LE+      Q+K+EYD ++ +LQ+DLEQQ ++AN AQ+NYEEELQK + VSK IS
Sbjct: 1006 KKLVSLESSEHSLGQVKKEYDQKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEVSKIIS 1065

Query: 1079 ELREQSQKDRIAITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNS 1138
            +LR + Q  R  I +LK SE+Q ++VLE  EKSW  QK E +  ++  ++ ++++S+QN 
Sbjct: 1066 QLRSEVQSGRSEIQQLKASEQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNK 1125

Query: 1139 LLYDQIELFSKDNSDGVNGETAEVREILTNLRRERDILGTKLTVSQREEQTLRGSLASVE 1198
            LL+ Q+EL SK   +  N       E+L +LRRERDIL TKLTVS+REE+ L     ++E
Sbjct: 1126 LLFSQVELLSKSEREFENKLLPGSSELLISLRRERDILETKLTVSKREEKLLHQKQVALE 1185

Query: 1199 NELDTTKRQLSQFQKEITTHSELIGQHEKIIEQLNQLNLLRESNITXXXXXXXXXXXXXX 1258
            +EL   +++L + Q+  + HS++  QHE I+EQLNQ+NLLRESN+T              
Sbjct: 1186 DELAEARKKLFKLQENDSNHSDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSD 1245

Query: 1259 XXXXXXXXXXXILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPE 1318
                       ILPL SEL+    S+ EKDQ++ L  +EA+RWKERS +IL +H++IDPE
Sbjct: 1246 LQSELNHLQSKILPLNSELSECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPE 1305

Query: 1319 DHKELKEKVSILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELRE 1378
            ++++L+E++S L+ +L+  +KEN +L+DRF RLKKQAHEKLN+SKIAQ  LS ++NEL+ 
Sbjct: 1306 EYRKLEEEISNLKKELEAKSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQG 1365

Query: 1379 AKSELEGKFEAEERKVHELQERLNAHGNDTETVESVQKELSDALEHSRELEQNLSATLQQ 1438
             K+++E   +  + KV  L++ L    +++   E ++ EL DALE  +E+E  L  T+  
Sbjct: 1366 TKTKMEEILKETQTKVLNLEKLLTERDSESANNEDLRHELDDALERCKEIEVKLGETVGS 1425

Query: 1439 NEEITKKLNDEIDSLKLELHSLKE-QSAATAKGEISEDLSNVVESMRRSFEEEKINFXXX 1497
            +E +T +LN+EI+SLK ++   KE ++ +T +G  S+ LSNVVESM+++FEEEKI F   
Sbjct: 1426 SEGLTSQLNEEINSLKEQVRIFKEKENDSTLEG--SQGLSNVVESMKKAFEEEKIKFIQE 1483

Query: 1498 XXXXXXXXXXXXHTLQVNGNEPQQQPVNYEEI---KRQWESEQEESILKRIAEAEENLKK 1554
                             + N    +PV+  ++   K+QWE E E    +RI EAEENLKK
Sbjct: 1484 KTEEYNKKFEEEKAKLSSENGSPAEPVSAPDVNSLKKQWEEEYEAISQQRIQEAEENLKK 1543

Query: 1555 RIRLPTEERIKQVVXXXXXXXXXXXXXXXXXXXXXXXXXDGNNSXXXXXXXXXXXXXFEA 1614
            RIR+PTEERIK+V+                         +G ++             FEA
Sbjct: 1544 RIRMPTEERIKKVL---DKRKTELEEEFQRRLKENNLQPEGGDAKEREELKKQLESEFEA 1600

Query: 1615 EVQAV----KKKAFEEGKQQAAMKSTLLERKISKLESQLHGKXXXXXXXXXXXXXXXXPN 1670
            + + +    KKKAFEEGKQQAAMKSTLLERKISKLESQL+                    
Sbjct: 1601 KYKEILASTKKKAFEEGKQQAAMKSTLLERKISKLESQLNSSNNPTPEKAAATSV----G 1656

Query: 1671 LPSKIDEKSVTTNQSVPNPLVSGEKVLKLDPSKXXXXXXXXXXXXXXXXXPQNNDTMGTS 1730
            LP+KIDE S T N +   P   GEKVLKL                     P NN+     
Sbjct: 1657 LPTKIDE-SRTENMATGTPAF-GEKVLKLSDKPAFSFQPSSKSNPFTSALPGNNN----- 1709

Query: 1731 AFGFKPTFTLSNNSNKSSGTKIDSSSTENKPANPFS--SFTETGASSPERESS------N 1782
             FG KPTF+ +  S++        S+  N  A P S  S +++  S PE++ S      N
Sbjct: 1710 VFGMKPTFSFTPGSSQPESRPTFGSTGFNTTAEPESNRSSSQSEESIPEKQESASVQGQN 1769

Query: 1783 TAMTPTPGEGASTPSKRAAED--DDNEV 1808
              +    G   +T  KR A+D  DD E 
Sbjct: 1770 GKVAEEAGSNVTTTQKRPADDQPDDEET 1797

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} similar
            to uniprot|Q02455 Saccharomyces cerevisiae YKR095W MLP1
            Myosin-like protein associated with the nuclear envelope
            connects the nuclear pore complex with the nuclear
            interior involved in the Tel1p pathway that controls
            telomere length involved in the retention of unspliced
            mRNAs in the nucleus
          Length = 1779

 Score = 1035 bits (2676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 696/1837 (37%), Positives = 1081/1837 (58%), Gaps = 105/1837 (5%)

Query: 10   NIVTSGDNHNDVSLGKLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTI 69
            N  T+     ++ +  +S+F  +   ++  +D  ++  L  K   F +LK+QNL+ +VT+
Sbjct: 5    NSPTTPSVIGEIDVTTISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVTL 64

Query: 70   DEIKTVSSKREEGLKNEIENLMKDNDSIRLERSQAQEESTQSSRDKQKIQNEVESLQEKL 129
            DE+K+ S +R E  K ++E + ++ +S+R E+   ++E  +   +K     EV  L+ +L
Sbjct: 65   DELKSSSERRSEAFKLQLEKINENTESLRKEKDAFEDEKFKLIDEKANASKEVNLLKSQL 124

Query: 130  SDLDQERETLKQDKREVVAVLEEKIKELESFRTESRKSLDDSKRLRQQVLELETTVQNLK 189
            ++L Q+ E  +  K++VV +L EKI +LE+ + E+++ L ++K LR+QVLELE  VQ  K
Sbjct: 125  TELKQQNEIFRSSKQDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTFK 184

Query: 190  SKELRDQSEIQTITQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDRLTSESLSCK 249
            S +LR ++E+Q +TQ + +L+ N+QWLE+E+ SK+E+  S R++ + EL    SE  S +
Sbjct: 185  SNDLRGKAEMQRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNSIR 244

Query: 250  NELQLEKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLE 309
            +EL++E+S +Q + ++  +L++ LQ+K+ E+K L DS   EKQEF  EM++KQ+LIDLLE
Sbjct: 245  SELEIERSSSQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLE 304

Query: 310  NQVKSLQGELNASLDKDNVELLASGERNTENEKLIQELITXXXXXXXXXXXXXXXXXXXX 369
             Q++S + EL ++ +K    +  S   + E EK+I+ELI                     
Sbjct: 305  KQIESFKTELESARNKS---VSNSDHVDAEREKIIEELIETKKKLEISESKAVKLEETVD 361

Query: 370  XXIPGDDSQDDINNTSSFISLRNKDSSLR----DMGILKKELIKERHQKERLQRQVESFI 425
              +   D +    NTS  +SL +K+S +     D+G+LKK LI+ER QKE+LQ QVE+F+
Sbjct: 362  ELL-STDGERGAGNTSK-VSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFV 419

Query: 426  VELEYKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIH 485
            +ELE+K+PV+NSFKERT MLEKEL+DVAL+L+ TS +KE++E E  ++  K+ D E+ IH
Sbjct: 420  LELEHKVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIH 479

Query: 486  TLTRQRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDDPNSESDSQRVISER 545
            +L RQR+DLAHQVQ LL+ +SV+ DS G L+ EE +FIK+I+N+ +   E D+QR+ISER
Sbjct: 480  SLVRQRSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQDAQRIISER 539

Query: 546  LVEFNNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQDY 605
            LV F ++  LQEKNMELL ++R LA+KLE+EEK+   K +  E++T+KEAKEAI++LQ+Y
Sbjct: 540  LVRFESMVELQEKNMELLNSIRNLADKLEAEEKESKSKSKEVESETVKEAKEAILTLQEY 599

Query: 606  NANLESKVEILTKECDAFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLEARLTS 665
            N +LES++EI+ KE DAFK + S  G+  NG  + N ++ NR+    EEK++ LE  L+S
Sbjct: 600  NKSLESQLEIIAKERDAFKILASDKGTS-NGPSNVNSSE-NRHLVLAEEKIKELENHLSS 657

Query: 666  LTVESSQNNKMLNNEIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQ 725
            LT ES++N K+LN EIH LYR++   S+ LEKERSS+ L E+R KLI +TLE+T+ EN +
Sbjct: 658  LTEESAKNIKLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDE 717

Query: 726  LVKRSQNLQSIFDRQDSRTAETVNELIACNSKLAVLETKVANLETEKELLQSSERTSREN 785
            L KR  +LQ    +QDS+T +T+  LI+C S+L+ L++++ N ++E++LL+S +   ++ 
Sbjct: 718  LRKRFHSLQENILKQDSKTQQTIESLISCKSQLSALQSQLNNSQSERDLLRSIQENLKKE 777

Query: 786  YLKLSEERNSLRIMVSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLDAKTKE 845
               LSEERN++RI+++QLQTLQ+ERE  L+E Q  ++   + LE E +D   +LDAK+KE
Sbjct: 778  NESLSEERNNMRILITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAKSKE 837

Query: 846  AEDMENSKRTQIQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVEESEAR 905
              D  ++K +Q +WYQ+K D +  E  + +++L +K   +  LE +V  L  ++EESEAR
Sbjct: 838  ISDYISTKDSQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEAR 897

Query: 906  IQSYQVLSGSEVETSPESSLRKELEKTKINLSDTYAEIDQYKNXXXXXXXXXXXXXXDYA 965
            IQ++  L+ SE   S   +LR+ELEKT+I L+D Y++++QYK+                 
Sbjct: 898  IQAFNALNYSESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALE 957

Query: 966  SGKQELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKKIATLE 1025
              K E   ++ETL  E+   +D V  L + ++ L   L       E++ +   + +  L+
Sbjct: 958  QSKAEYTEKIETLTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLEDLK 1017

Query: 1026 TESKGSHQLKEEYDAQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISELREQSQ 1085
             +      +K EY+ +I K+Q DL QQ S+AN AQ+NYE+ELQK ++VSK IS LR ++Q
Sbjct: 1018 AKQSELDNMKAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRAEAQ 1077

Query: 1086 KDRIAITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSLLYDQIE 1145
            K +     L+N+ E  ++ LEQ+E SW  Q  +YE +L  + Q +EDL+ Q+ +LYDQI+
Sbjct: 1078 KYKSETETLRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYDQID 1137

Query: 1146 LFSKD---NSDGVNGETAEVREILTNLRRERDILGTKLTVSQREEQTLRGSLASVENELD 1202
              SK    +S+ +   + E R +LT+LRRE+DIL TKL VS REE+ LR  L  +E++L+
Sbjct: 1138 FLSKGKPTSSEDLMPISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIESDLE 1197

Query: 1203 TTKRQLSQFQKEITTHSELIGQHEKIIEQLNQLNLLRESNITXXXXXXXXXXXXXXXXXX 1262
             ++ +LS+ Q+  + +S  +   E+I+ QLNQLNLLRESNIT                  
Sbjct: 1198 GSRIELSKLQRAASGNSATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGERSRELKAE 1257

Query: 1263 XXXXXXXILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPEDHKE 1322
                   + PLES++  L  SV EKD Q++L  EEA RWK+RSQ+ILHK++RIDPE+H++
Sbjct: 1258 LDALYGKVQPLESKVTLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERIDPEEHQK 1317

Query: 1323 LKEKVSILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAKSE 1382
            L +KVS L+ ++   + EN+ELD RF RLK+QAHEKLN++K AQ+TL++QLN+L+  K +
Sbjct: 1318 LADKVSELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEK 1377

Query: 1383 LEGKFEAEERKVHELQERLNAHGNDTETVESVQK-ELSDALEHSR----ELEQNLSATLQ 1437
            LE    +++ +V  L+ ++     D E  +S +K +L + LE+S+    E E  L     
Sbjct: 1378 LENDLGSQKEEVKNLESKI----TDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQVTS 1433

Query: 1438 QNEEITKKLNDEIDSLKLELHSLKE---------QSAATAKGEISEDLSNVVESMRRSFE 1488
             +  + K+LN+ I+SL  ++  L+E          +  +   E+ E+ S +VE+++  FE
Sbjct: 1434 SSALLEKELNERIESLMNKIKLLEEDLEKAKTESPNDGSQSSELVENTSKIVENLKIEFE 1493

Query: 1489 EEKINFXXXXXX--XXXXXXXXXHTLQVNGNEPQQQ--------PVNYEEIKRQWESEQE 1538
            EEK                      L+    E ++Q        PVN +EIK++WE E E
Sbjct: 1494 EEKAKMISDKESELREQFEEEKASILEAKEQELREQLATQKLDPPVNIDEIKKKWEEEYE 1553

Query: 1539 ESILKRIAEAEENLKKRIRLPTEERIKQVVXXXXXXXXXXXXXXXXXXXXXXXXXDGNNS 1598
            +   +RI E+ E LKKRIRLPTEE+I ++V                            ++
Sbjct: 1554 QKTSQRIRESNEQLKKRIRLPTEEKINKIVEKKRLELEAEFEANVQKKAEEIAKSKSASN 1613

Query: 1599 XXXXXXXXXXXXXFEAEVQAVKKK-----------AFEEGKQQAAMKSTLLERKISKLES 1647
                          E   Q ++KK           AFEEGKQQA+MKST LE+KI+KLE+
Sbjct: 1614 SNSTEVLEKHKQDLENLKQEMQKKFDEDIAQIKKRAFEEGKQQASMKSTFLEKKIAKLET 1673

Query: 1648 QLHGKXXXXXXXXXXXXXXXXPNLPSKIDEKSVTTNQSVPNPLVSGEKVLKLDPSKXXXX 1707
            Q+                     +P   D  S T  +S P    + + V +L P      
Sbjct: 1674 QIKAHDSA---------------IPIN-DNSSATPAESGP----TTQDVKQLTP------ 1707

Query: 1708 XXXXXXXXXXXXXPQNNDTMGTSAFGFKPTFTLSNNSNKSSGTKIDSSSTENKPANPFSS 1767
                         P        + F F   F                 +T N   NPF+ 
Sbjct: 1708 ----ILNNQAAILPGKPLPFNPAHFAFGMPF---------------GQTTSNSFQNPFN- 1747

Query: 1768 FTETGASSPERESSNTAMTPTPGEGASTPSKRAAEDD 1804
                  S P  ++ N+   P+      +P K+  E+D
Sbjct: 1748 ------SQPPEQTPNSPKRPSEEPVGGSPEKKPKEND 1778

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score =  985 bits (2546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 633/1572 (40%), Positives = 982/1572 (62%), Gaps = 57/1572 (3%)

Query: 12   VTSGDNHNDVSLGKLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTIDE 71
            V + DN  D  L  +++F+G   +Q+  I+  ++  L +K+L FNELKS+NL++ V+ DE
Sbjct: 11   VQNSDN-TDERLKAIASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSENLQITVSFDE 69

Query: 72   IKTVSSKREEGLKNEIENLMKDNDSIRLERSQAQEESTQSSRDKQKIQNEVESLQEKLSD 131
            +KT SSK+ + LK E+ENL+K ND IR ER    ++      +K KI NE+ES++ +  D
Sbjct: 70   LKTNSSKKIDNLKKEMENLIKQNDGIRKERDDTCDKLESEKNEKTKISNELESIKRRADD 129

Query: 132  LDQERETLKQDKREVVAVLEEKIKELESFRTESRKSLDDSKRLRQQVLELETTVQNLKSK 191
            L +E++ L+ +++  + +L+E++KELE  R+++ +S ++ KRLR  +++LET  Q+L + 
Sbjct: 130  LIEEKKELQCNQQRTLKILDERLKELEIARSDNNRSDNECKRLRSTIIDLETKQQDLITS 189

Query: 192  ELRDQSEIQTITQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDRLTSESLSCKNE 251
            +L  ++E++   Q L ILQ  + WLE+E+ SK EQ +S R+K D  +  + +E    +++
Sbjct: 190  DLNSRAELERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSD 249

Query: 252  LQLEKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLENQ 311
             Q+EK++N V+T KN+EL+KSLQEKL+E+K LSD L  EKQEF+ E+++KQ+L+DLLE+Q
Sbjct: 250  FQVEKTKNDVLTQKNDELSKSLQEKLLEIKSLSDCLSSEKQEFSTEINLKQRLVDLLESQ 309

Query: 312  VKSLQGELNAS--LDKDNVELLASGERNTENEKLIQELITXXXXXXXXXXXXXXXXXXXX 369
            + +++ EL+++  L+  N     S +  +E E L++EL                      
Sbjct: 310  LNAVKEELDSTRGLETSN----DSKKHMSEKEDLVKEL-----QLTKEELAQCKSECIRL 360

Query: 370  XXIPGDDSQDDINNTSSFISLRNKDSSLRDMGILKKELIKERHQKERLQRQVESFIVELE 429
              I G+  ++  ++TS          S  D  +LKK+LIKE+  KE LQ Q+ESFI+ELE
Sbjct: 361  SSIIGETDEESGSSTS---------RSSSDFILLKKQLIKEKRAKEHLQNQIESFILELE 411

Query: 430  YKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIHTLTR 489
            +K+P+INSFKERT  LE ELN+ ALLL+HTSNEK  + RE  A S+K+K  E+ I TL +
Sbjct: 412  HKVPIINSFKERTDTLENELNNAALLLEHTSNEKNAKIRELSAKSEKLKQCENDIQTLIK 471

Query: 490  QRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNND-DPNSESDSQRVISERLVE 548
            QR DL  QVQ+LL+  SV  DS G L  EE+ FI+ I+ ND D  +E+DSQ++++ERLVE
Sbjct: 472  QRLDLCRQVQYLLITNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVE 531

Query: 549  FNNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQDYNAN 608
            F +I  LQEKN ELLK VR LA++LES E +  + +Q  E++TI EAKEAI++L+     
Sbjct: 532  FRSIIELQEKNTELLKIVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAEKEQ 591

Query: 609  LESKVEILTKECDAFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLEARLTSLTV 668
            LESKVE L KEC+  KA+ S   +++   L++   Q N    + E +++ L++ ++ +T 
Sbjct: 592  LESKVEELEKECENSKALLS---NEETSHLNSTIQQLNETKRNLECQIQDLQSNISQITR 648

Query: 669  ESSQNNKMLNNEIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQLVK 728
            ES++N  +LN EI +LY SK+ ISI+L KE+SS+ L EER KL+ +TL+LT+ EN QL K
Sbjct: 649  ESTENMSLLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRK 708

Query: 729  RSQNLQSIFDRQDSRTAETVNELIACNSKLAVLETKVANLETEKELLQSSERTSRENYLK 788
            R   LQS   +QDS+T ET+NE I+C SKL + ET++ NL+ E++L   SE+  ++   K
Sbjct: 709  RFDCLQSTILKQDSKTQETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQK 768

Query: 789  LSEERNSLRIMVSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLDAKTKEAED 848
            LS E+  LRIMV+QLQTLQ ERE  L E + +Y+  +D LE    + +     K +  + 
Sbjct: 769  LSSEKTGLRIMVTQLQTLQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQ 828

Query: 849  MENSKRTQIQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVEESEARIQS 908
            +E    + I+WYQ+K++ +  +++ +   +  K   +  L+ +V+ LEK+++E++ R+ +
Sbjct: 829  LEEDNNSSIEWYQNKIEVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHT 888

Query: 909  YQVLSGSEVETSPESSLRKELEKTKINLSDTYAEIDQYKNXXXXXXXXXXXXXXDYASGK 968
            Y V+ G    T  + SLRKELEK+KI+L+D Y++I +YK                +    
Sbjct: 889  YNVIDG----TINDDSLRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESS 944

Query: 969  QELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKKIATLETES 1028
            ++   +++ L NEKS L++ ++ L E +  L   L   NK  + EK   +KKI+ L+  +
Sbjct: 945  KDFSNRIKNLTNEKSSLEEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNN 1004

Query: 1029 KGSHQLKEEYDAQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISELREQSQKDR 1088
            K    +K EY++++ K+Q+DL+QQ  +AN AQ NYE+ELQK ++VSKTISELREQ    R
Sbjct: 1005 KEVEAVKSEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYR 1064

Query: 1089 IAITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSLLYDQIELFS 1148
            + +  L  S  Q+   L++NE+SW++Q++    QLE+S   +EDL++QN LLYDQIEL++
Sbjct: 1065 VQVNTLTLSRNQLESTLKENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYT 1124

Query: 1149 KDNSDGV--NGETAEVREILTNLRRERDILGTKLTVSQREEQTLRGSLASVENELDTTKR 1206
              +  GV    +   +  IL +LRRERDIL TK+TV++R+ + LR  ++ ++ EL   + 
Sbjct: 1125 TADK-GVTDTNDKPALNSILLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEART 1183

Query: 1207 QLSQFQKEITTHSELIGQHEKIIEQLNQLNLLRESNITXXXXXXXXXXXXXXXXXXXXXX 1266
            +L   + E      +I QHE I+E+LNQLNLLRESNIT                      
Sbjct: 1184 KLDNSRLEEEKRPTIIQQHEDIMEKLNQLNLLRESNITLRNELENNNEEKRVLQSELDKL 1243

Query: 1267 XXXILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPEDHKELKEK 1326
               I P+ESEL  L  S+ EK+Q+L L KEE +RWK+RSQ+IL KH ++   D+++L+ +
Sbjct: 1244 KQDIAPIESELAALKYSMQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHE 1303

Query: 1327 VSILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAKSELEGK 1386
            +  L+ KLDE  ++  E ++RFNRL++QA E+L +SK++  TL+ Q+N+L+ AK +LE  
Sbjct: 1304 IDSLKVKLDEKTRQGAEAEERFNRLRRQAQERLKTSKLSLDTLTEQVNDLKNAKIKLEKS 1363

Query: 1387 FEAEERKVHELQERLNAHG-NDTETVESVQKELSDALEHSRELEQNLSATLQQNEEITKK 1445
             +    K+ EL+   NA    D   ++++++   DA   S+E +  L       +   KK
Sbjct: 1364 LDDANTKIEELE---NAKAEQDNNQLDAIKRLQQDAENSSKEFKTKLEEKATFYDSTIKK 1420

Query: 1446 LNDEIDSLKLELHSLK--EQSAATAKGEISEDLSNVVESMRRSFEEEKINFXXXXXXXXX 1503
            LN+EI +L+ E+   +  +Q   +       DLS +VESM+++FEE+KINF         
Sbjct: 1421 LNEEIITLREEIEKQRRIQQQLQSEPANEQNDLSKIVESMKKTFEEDKINFIREK----- 1475

Query: 1504 XXXXXXHTLQVN-----GNEPQQQP--VNYEEIKRQWESEQEESILKRIAEAEENLKKRI 1556
                   T +VN       E   QP  +N +E+K +W++E EE ++ RI EAEE LKKRI
Sbjct: 1476 -------TKEVNEKILEAQERLNQPSNINIDELKIKWKAEHEEEVVNRIREAEEALKKRI 1528

Query: 1557 RLPTEERIKQVV 1568
            RLPTEE+I +++
Sbjct: 1529 RLPTEEKISKII 1540

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
            MLP1Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved with Tel1p in telomere length
            control; involved with Pml1p and Pml39p in nuclear
            retention of unspliced mRNAs
          Length = 1875

 Score =  983 bits (2541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 643/1586 (40%), Positives = 1005/1586 (63%), Gaps = 60/1586 (3%)

Query: 1    MSEGETGVANIVTSGDNHNDVSLGKLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKS 60
            MS+ +T + +I  +G+N +D  L  +++F+G   +Q+   DG ++  L +K+L FNELKS
Sbjct: 1    MSDHDTPMESI-QNGEN-SDERLNAIASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKS 58

Query: 61   QNLRLNVTIDEIKTVSSKREEGLKNEIENLMKDNDSIRLERSQAQEESTQSSRDKQKIQN 120
            +NL++ V+ DE+K  S K+ +GLK E+EN++++ND IR ER+    +      +K K+ +
Sbjct: 59   ENLKVTVSFDELKASSLKKIDGLKTEMENVIRENDKIRKERNDTFVKFESVENEKMKLSS 118

Query: 121  EVESLQEKLSDLDQERETLKQDKREVVAVLEEKIKELESFRTESRKSLDDSKRLRQQVLE 180
            E+E ++ KL DL +E++  + +++  + +L+E++KE+E  R E+ +S  + K+LR  +++
Sbjct: 119  ELEFVKRKLDDLTEEKKETQSNQQRTLKILDERLKEIELVRVENNRSNSECKKLRSTIMD 178

Query: 181  LETTVQNLKSKELRDQSEIQTITQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDR 240
            LET  Q   + +L  ++E++  TQ LT+LQ N+ WLE+E+ SK EQ +S R+K D  +  
Sbjct: 179  LETKQQGYITNDLNSRTELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILD 238

Query: 241  LTSESLSCKNELQLEKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSM 300
            + +E    +N+ Q+E++ N V+  KN EL+KSLQEKL+E+K LSDSL  EKQEF+ EMS+
Sbjct: 239  IRNELNRLRNDFQMERTNNDVLKQKNNELSKSLQEKLLEIKGLSDSLNSEKQEFSAEMSL 298

Query: 301  KQKLIDLLENQVKSLQGELNASLDKDNVELLA--SGERNTENEKLIQEL-ITXXXXXXXX 357
            KQ+L+DLLE+Q+ +++ ELN+  + +  +++A  S ++  ENE L++EL +T        
Sbjct: 299  KQRLVDLLESQLNAVKEELNSIRELNTAKVIADDSKKQTPENEDLLKELQLTKEKLAQCE 358

Query: 358  XXXXXXXXXXXXXXIPGDDSQDDINNTSSFISLRNKDSSLRDMGILKKELIKERHQKERL 417
                             D++ +D  N S+      K SS  D   LKK+LIKER  KE L
Sbjct: 359  KECLRLSSI-------TDEADEDNENLSA------KSSS--DFIFLKKQLIKERRTKEHL 403

Query: 418  QRQVESFIVELEYKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKV 477
            Q Q+E+FIVELE+K+P+INSFKERT MLE ELN+ ALLL+HTSNEK  + +E  A ++K+
Sbjct: 404  QNQIETFIVELEHKVPIINSFKERTDMLENELNNAALLLEHTSNEKNAKVKELNAKNQKL 463

Query: 478  KDSESSIHTLTRQRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDDPN-SES 536
             + E+ + TLT+QR DL  Q+Q+LL+  SV  DS G L  EE+ FI+ I+  DD   +ES
Sbjct: 464  VECENDLQTLTKQRLDLCRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITES 523

Query: 537  DSQRVISERLVEFNNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAK 596
            DSQ+V++ERLVEF NI  LQEKN ELLK VR LA+KLES+EK   + +Q  E++T+ EAK
Sbjct: 524  DSQKVVTERLVEFKNIIQLQEKNAELLKVVRNLADKLESKEKKSKQSLQKIESETVNEAK 583

Query: 597  EAIVSLQDYNANLESKVEILTKECDAFK-AICSRNGSDQNGSLSANGTQGNRNGSSDEEK 655
            EAI++L+    +LES++E L KE +  K ++ + + S  N ++    T+  R+  S   +
Sbjct: 584  EAIITLKSEKMDLESRIEELQKELEELKTSVPNEDASYSNVTIKQ-LTETKRDLES---Q 639

Query: 656  LRTLEARLTSLTVESSQNNKMLNNEIHELYRSKTQISIELEKERSSKTLTEERLKLIQHT 715
            ++ L+ R++ +T ES++N  +LN EI +LY SK+ ISI+L KE+SS+ L EER KL+ +T
Sbjct: 640  VQDLQTRISQITRESTENMSLLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNT 699

Query: 716  LELTRNENQQLVKRSQNLQSIFDRQDSRTAETVNELIACNSKLAVLETKVANLETEKELL 775
            L+LT+ EN QL KR   LQ+   +QDS+T ET+NE ++C SKL+++ET++ NL+ E++L 
Sbjct: 700  LDLTKAENDQLRKRFDYLQNTILKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLR 759

Query: 776  QSSERTSRENYLKLSEERNSLRIMVSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADA 835
               E+  ++   KLS E++SLRIMV+QLQTLQ ERE  L+E + + ++ +D LE   ++ 
Sbjct: 760  VHLEKNLKQELNKLSPEKDSLRIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSEL 819

Query: 836  RARLDAKTKEAEDMENSKRTQIQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKL 895
            +     K    + +E    + I+WYQ+K++++  + + +   + +K   +  L+ +V+ L
Sbjct: 820  KKETSQKDHHIKQLEEDNNSNIEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSL 879

Query: 896  EKQVEESEARIQSYQVLSGSEVETSPESSLRKELEKTKINLSDTYAEIDQYKNXXXXXXX 955
            EK++EE + R+ +Y V+     ET  + SLRKELEK+KINL+D Y++I +YK+       
Sbjct: 880  EKEIEEDKIRLHTYNVMD----ETINDDSLRKELEKSKINLTDAYSQIKEYKDLYETTSQ 935

Query: 956  XXXXXXXDYASGKQELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKN 1015
                         ++   Q++ L +EK+ L+D ++ L E +  L   L    K  E EK 
Sbjct: 936  SLQQTNSKLDESFKDFTNQIKNLTDEKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKA 995

Query: 1016 TLQKKIATLETESKGSHQLKEEYDAQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSK 1075
              +K+I+ L+  +K    +K EY++++ K+Q DL+QQ  +AN AQ NYE+ELQK ++VSK
Sbjct: 996  DFKKRISILQNNNKEVEAVKSEYESKLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSK 1055

Query: 1076 TISELREQSQKDRIAITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLST 1135
            TISELREQ    +  +  L  S +Q+   L++NEKSWS+QKE    QL+ S   +EDLS+
Sbjct: 1056 TISELREQLHTYKGQVKTLNLSRDQLENALKENEKSWSSQKESLLEQLDLSNSRIEDLSS 1115

Query: 1136 QNSLLYDQIELFS---KDNSDGVNGETAEVREILTNLRRERDILGTKLTVSQREEQTLRG 1192
            QN LLYDQI++++   K+ ++  NG    +  IL  LRRERDIL TK+TV++R+ + LR 
Sbjct: 1116 QNKLLYDQIQIYTAADKEVNNSTNG--PGLNNILITLRRERDILDTKVTVAERDAKMLRQ 1173

Query: 1193 SLASVENELDTTKRQLSQFQKEITTHSELIGQHEKIIEQLNQLNLLRESNITXXXXXXXX 1252
             ++ ++ EL   + +L   + E   HS +I QH+ I+E+LNQLNLLRESNIT        
Sbjct: 1174 KISLMDVELQDARTKLDNSRVEKENHSSIIQQHDDIMEKLNQLNLLRESNITLRNELENN 1233

Query: 1253 XXXXXXXXXXXXXXXXXILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKH 1312
                             + P+ESEL  L  S+ EK+Q+L L KEE +RWK+RSQ+IL KH
Sbjct: 1234 NNKKKELQSELDKLKQNVAPIESELTALKYSMQEKEQELKLAKEEVHRWKKRSQDILEKH 1293

Query: 1313 DRIDPEDHKELKEKVSILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQ 1372
            +++   D+++L+ ++  L+ +L+   ++  E +++FNRL++QA E+L +SK++Q +L+ Q
Sbjct: 1294 EQLSSSDYEKLESEIENLKEELENKERQGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQ 1353

Query: 1373 LNELREAKSELEGKFEAEERKVHELQERLNAHGNDTETVESVQKELSDALEHSRELEQNL 1432
            +N LR+AK+ LE        ++ ELQ    A GN+   +E+++K   DA + SREL+  L
Sbjct: 1354 VNSLRDAKNVLENSLSEANARIEELQNAKVAQGNN--QLEAIRKLQEDAEKASRELQAKL 1411

Query: 1433 SATLQQNEEITKKLNDEIDSLKLELH---SLKEQSAATAKGEISEDLSNVVESMRRSFEE 1489
              +    E     LN+EI +LK E+     +++Q  AT+  E   DLSN+VESM++SFEE
Sbjct: 1412 EESTTSYESTINGLNEEITTLKEEIEKQRQIQQQLQATSANE-QNDLSNIVESMKKSFEE 1470

Query: 1490 EKINFXXXXXXXXXXXXXXXHTLQVN-----GNEPQQQP--VNYEEIKRQWESEQEESIL 1542
            +KI F                T +VN       E   QP  +N EEIK++WESE E+ + 
Sbjct: 1471 DKIKFIKEK------------TQEVNEKILEAQERLNQPSNINMEEIKKKWESEHEQEVS 1518

Query: 1543 KRIAEAEENLKKRIRLPTEERIKQVV 1568
            ++I EAEE LKKRIRLPTEE+I +++
Sbjct: 1519 QKIREAEEALKKRIRLPTEEKINKII 1544

 Score = 78.2 bits (191), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 57/91 (62%), Gaps = 6/91 (6%)

Query: 1612 FEAEVQAVKKKAFEEGKQQAAMKSTLLERKISKLESQLHGKXXXXXXXXXXXXXXXXP-- 1669
            F  E+QA+KKK+F+EGKQQA MK+TLLERK++K+ESQL                   P  
Sbjct: 1632 FNNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQLSETKQSAESPPKSVNNVQNPLL 1691

Query: 1670 NLPSKIDEKSVTTNQSVPNPLVSGEKVLKLD 1700
             LP KI+E S     S  NPL+SGEK+LKL+
Sbjct: 1692 GLPRKIEENS----NSPFNPLLSGEKLLKLN 1718

>Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR095W
            (REAL)
          Length = 1885

 Score =  956 bits (2472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 638/1562 (40%), Positives = 969/1562 (62%), Gaps = 53/1562 (3%)

Query: 23   LGKLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTIDEIKTVSSKREEG 82
            L  +++F+    +Q+  ID  I+T L  K++ FNELKS+NL++ V+ DE+KT S K+ +G
Sbjct: 21   LNVIASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSENLQITVSFDELKTNSLKKIDG 80

Query: 83   LKNEIENLMKDNDSIRLERSQAQEESTQSSRDKQKIQNEVESLQEKLSDLDQERETLKQD 142
            LK E+EN+++ ND IR ER+    +      +K ++ NE+ES++ KL+DL +E++ ++ +
Sbjct: 81   LKTEMENVLRQNDEIRKERNDTSAKFEFLQNEKIQLSNELESVKRKLNDLTEEKKEIQSN 140

Query: 143  KREVVAVLEEKIKELESFRTESRKSLDDSKRLRQQVLELETTVQNLKSKELRDQSEIQTI 202
            ++  + +L+E++KE+E  + E+ ++ ++ + LR  V+ELET  Q   + +L  +SE++  
Sbjct: 141  QQRTLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELETKQQTYITNDLNSRSELERK 200

Query: 203  TQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDRLTSESLSCKNELQLEKSRNQVI 262
            TQ L +LQ N  WLE+E++SK+EQ +S R++ D  +  + SE    KN+ QLEK+ N V+
Sbjct: 201  TQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKNDFQLEKTNNDVL 260

Query: 263  TTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLENQVKSLQGELNAS 322
              KN EL+ SLQEK++++K+LSDSL  EKQEF+ E+++KQ+LIDLLE Q+ +++ EL + 
Sbjct: 261  KQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQLNAVKEELKSI 320

Query: 323  LDKDNVELLASGERN--TENEKLIQELITXXXXXXXXXXXXXXXXXXXXXXIPGDDSQDD 380
               D+  + +   R   +ENE L+++L                          G++S   
Sbjct: 321  RKSDSSNVTSDDSRKLISENESLLKDLRLTKEKLAQCESECLRLSSITEE--TGEESG-- 376

Query: 381  INNTSSFISLRNKDSSLRDMGILKKELIKERHQKERLQRQVESFIVELEYKIPVINSFKE 440
                    +L ++ S+  D  +LKK+ IKE+  KE+LQ Q+ESFIVELE+K+PVINSFKE
Sbjct: 377  --------TLTSRSST--DFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPVINSFKE 426

Query: 441  RTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIHTLTRQRTDLAHQVQF 500
            RT MLE ELN+ ALLL+HTSNEK  + RE    ++K+   E+ IH LTRQR DL  QVQ+
Sbjct: 427  RTDMLENELNNSALLLEHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDLCRQVQY 486

Query: 501  LLMNISVQVDSGGLLSAEEVSFIKRIVNNDDPNS-ESDSQRVISERLVEFNNIATLQEKN 559
            LL+  SV  DS G L  EE+ FI+ I+ ND+  + ESDSQ++++ RLVEF N+  LQEKN
Sbjct: 487  LLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRNVIELQEKN 546

Query: 560  MELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQDYNANLESKVEILTKE 619
             ELL+  R LA+KLES E    + +   EN TI EAKEAI+SLQ    +LESKVE L +E
Sbjct: 547  TELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMSLESKVEELERE 606

Query: 620  CDAFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLEARLTSLTVESSQNNKMLNN 679
             +  K+  S+  S  N S+    T+  R   S   +++ L+AR++ +T ES+QN  +LN 
Sbjct: 607  RETLKSSISKQASSFNNSVIQQLTKTKRELES---QVQDLQARISQITRESTQNMSLLNK 663

Query: 680  EIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQLVKRSQNLQSIFDR 739
            EI ++Y SK+ ISIEL KE+SS+ L EER KL+ +TL+LT+ EN QL KRS +LQS   +
Sbjct: 664  EIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSSISK 723

Query: 740  QDSRTAETVNELIACNSKLAVLETKVANLETEKELLQSSERTSRENYLKLSEERNSLRIM 799
            QDS+T ET+NE I+C SKL+V ET ++NL+ E++L   SE++ ++   KLS E+ SLRIM
Sbjct: 724  QDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTSLRIM 783

Query: 800  VSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLDAKTKEAEDMENSKRTQIQW 859
            V+QLQTLQ ERE  L E + + +  ++ +E+   + +     K +    +E    ++I+W
Sbjct: 784  VTQLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNTSKIEW 843

Query: 860  YQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVEESEARIQSYQVLSGSEVET 919
            YQ+K++++  ++  +   +  K   +  L+ +V+ LEK++EE++ R+ +Y V+     ET
Sbjct: 844  YQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVMD----ET 899

Query: 920  SPESSLRKELEKTKINLSDTYAEIDQYKNXXXXXXXXXXXXXXDYASGKQELQLQVETLQ 979
              + SLRKELE +KINL++ Y++I +YK                     +    Q+++L 
Sbjct: 900  INDDSLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQSLT 959

Query: 980  NEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKKIATLETESKGSHQLKEEYD 1039
            +EK  L+D V+ L E    L   L       E +K   +K IA L+  +K    +K EY+
Sbjct: 960  DEKINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVKSEYE 1019

Query: 1040 AQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISELREQSQKDRIAITRLKNSEE 1099
            +++ K+Q DL+QQ  +AN AQ NYE+ELQK ++VSKTISELREQ    R  +  L  S  
Sbjct: 1020 SKLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKTLTLSRS 1079

Query: 1100 QVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSLLYDQIELFSKDN---SDGVN 1156
            ++  +L++NEKSW++QK+    QL+ S   +EDLS+QN LLY+QIEL++       D  N
Sbjct: 1080 ELENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAGNGVGDARN 1139

Query: 1157 GETAEVREILTNLRRERDILGTKLTVSQREEQTLRGSLASVENELDTTKRQLSQFQKEIT 1216
            G T    +IL  LRRERDIL TK+TV++R+ + LR  +  ++ EL   + +L+  + E  
Sbjct: 1140 GPTLN-NDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLNNSRVEND 1198

Query: 1217 THSELIGQHEKIIEQLNQLNLLRESNITXXXXXXXXXXXXXXXXXXXXXXXXXILPLESE 1276
              S ++ QH+ I+E+LNQLNLLRESNIT                         I P+ESE
Sbjct: 1199 ERSSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEIIAPIESE 1258

Query: 1277 LNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPEDHKELKEKVSILETKLDE 1336
            L+ L  S+ EK+Q++ L KEE +RWK+RSQ+IL KH ++   D+++L+ +V  L+ +L++
Sbjct: 1259 LSALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESEVESLKAQLED 1318

Query: 1337 TNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAKSELEGKFEAEERKVHE 1396
              ++  E ++RFNRL++QA EKL +SK+ Q TL+ QLNEL++AK  LE        ++ E
Sbjct: 1319 KMQQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALERSLNDANTRIQE 1378

Query: 1397 LQ-ERLNAHGNDTETVESVQKELSDALEHSRELEQNLSATLQQNEEITKKLNDEIDSLK- 1454
            L+ E++    N +E ++  Q+   DA + SRELE+ L           +KLN+EI +LK 
Sbjct: 1379 LEGEKVAEDNNRSEMIKRSQE---DAEKSSRELEEKLEENAISYSSTVRKLNEEIATLKE 1435

Query: 1455 -LELHSLKEQSAATAKGEISEDLSNVVESMRRSFEEEKINFXXXXXXXXXXXXXXXHTLQ 1513
             +E     ++   TA G   EDLSN+VESM++SFEE+KI F                T +
Sbjct: 1436 EIEKQGQIQKQLQTAAGHRDEDLSNIVESMKKSFEEDKIKF------------IEEKTRE 1483

Query: 1514 VN-----GNEPQQQP--VNYEEIKRQWESEQEESILKRIAEAEENLKKRIRLPTEERIKQ 1566
            VN       E   QP  VN +E+K+QWE+E EE + +R+ EAEE LKKRIRLPTEE+I +
Sbjct: 1484 VNKKIQEAQERLNQPSSVNIDEMKKQWEAEHEEEVAERVREAEEALKKRIRLPTEEKISK 1543

Query: 1567 VV 1568
            ++
Sbjct: 1544 II 1545

 Score = 69.7 bits (169), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 43/88 (48%), Positives = 53/88 (60%), Gaps = 6/88 (6%)

Query: 1615 EVQAVKKKAFEEGKQQAAMKSTLLERKISKLESQLHGKXXXXXXXXXXXXXXXXP--NLP 1672
            E+Q VKKK+FEEGKQQA MK+TLLERK++K+ESQL                   P   LP
Sbjct: 1636 ELQNVKKKSFEEGKQQATMKTTLLERKLAKMESQLSEIKQSAESPPKHANNVPNPLLGLP 1695

Query: 1673 SKIDEKSVTTNQSVPNPLVSGEKVLKLD 1700
             KI+E S     S  N L+SGEK+LK +
Sbjct: 1696 RKIEENS----NSPFNTLLSGEKLLKFN 1719

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score =  941 bits (2431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 611/1567 (38%), Positives = 959/1567 (61%), Gaps = 37/1567 (2%)

Query: 13   TSGDNHNDVSLGKLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTIDEI 72
            T  D      L  +++F+    +Q+  ID  I+T L +K+L FNELKS+N+++ VT+DE+
Sbjct: 11   TQNDEDTGERLNAIASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSENIQITVTLDEL 70

Query: 73   KTVSSKREEGLKNEIENLMKDNDSIRLERSQAQEESTQSSRDKQKIQNEVESLQEKLSDL 132
            KT S+K+   LK E+E++++ ND IR ER+    +     R+K  + NE+ES++ KLSDL
Sbjct: 71   KTNSAKKINSLKTEMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSNELESIKRKLSDL 130

Query: 133  DQERETLKQDKREVVAVLEEKIKELESFRTESRKSLDDSKRLRQQVLELETTVQNLKSKE 192
             +E++ ++  ++  + +L+E++KELE  +  S  S  + K+LR  +LELET  Q   S +
Sbjct: 131  SEEKKEIQSSQQRTLKILDERLKELEMVKAASNHSDSECKKLRSTILELETKQQTYISND 190

Query: 193  LRDQSEIQTITQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDRLTSESLSCKNEL 252
            L  +S+++  TQ L +LQ N  WLE+E++SK +Q +S R+K +  +  + ++    +N+ 
Sbjct: 191  LNSKSQLERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIRNDLNRIRNDF 250

Query: 253  QLEKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLENQV 312
            QLEK+ N V+  KN EL+K LQEKL+++K LSDS   EK++F+ E+++KQ+LIDLLE+Q+
Sbjct: 251  QLEKTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQL 310

Query: 313  KSLQGELNASLDKDNVELLASGERN--TENEKLIQELITXXXXXXXXXXXXXXXXXXXXX 370
             +++ ELN + + +  ++ +   +   +ENEKL+++L                       
Sbjct: 311  NAVKEELNNTRESNYSDVNSDDSKQLISENEKLLKDL-----QLTKHKLVQCENECLRLS 365

Query: 371  XIPGDDSQDDINNTSSFISLRNKDSSLRDMGILKKELIKERHQKERLQRQVESFIVELEY 430
             I  +  ++D   TS          S  D  +LKK+LIKE+  KE LQ Q+ESFIVELE+
Sbjct: 366  SITEEAGKEDGILTSK---------SNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEH 416

Query: 431  KIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIHTLTRQ 490
            K+P+INSFKERT  LE ELN+ ALLL+HTSNEK  + +E +  ++K+ + +  IH L++Q
Sbjct: 417  KVPIINSFKERTDTLENELNNAALLLEHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQ 476

Query: 491  RTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDD-PNSESDSQRVISERLVEF 549
            R DL  Q+Q+LL+  SV  DS G L  EE+ FI+ I+ NDD   +ESDSQ++++ERLVEF
Sbjct: 477  RLDLCRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTERLVEF 536

Query: 550  NNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQDYNANL 609
             +I  LQEKN ELL+  R LA+KLES E      ++  EN+TI EAKEAI++LQ     L
Sbjct: 537  RDIIQLQEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQL 596

Query: 610  ESKVEILTKECDAFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLEARLTSLTVE 669
            ESK+  L KE + FK       +  N S+    T+  R   S   + + L+AR++ +T E
Sbjct: 597  ESKIHELEKEREKFKNWTMDQETSPNNSVIQQLTETKRELES---QTQDLQARISQVTRE 653

Query: 670  SSQNNKMLNNEIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQLVKR 729
            S++N  +LN E+ +LY SK+ +SIEL +E+SS+ L EER KL+ +TL+L + EN QL KR
Sbjct: 654  STENMSLLNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKR 713

Query: 730  SQNLQSIFDRQDSRTAETVNELIACNSKLAVLETKVANLETEKELLQSSERTSRENYLKL 789
            S NLQ+   +QDS+T ET+N+ ++C SKL+ +ET+++NL+ E+ L    E+  ++   +L
Sbjct: 714  SINLQNAISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIELEKNLKQELSEL 773

Query: 790  SEERNSLRIMVSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLDAKTKEAEDM 849
            S E+ SL IMV+QLQTLQ ERE  L E + + +  +D+L+  + + +     K +  + +
Sbjct: 774  SSEKTSLHIMVTQLQTLQKERENLLDETKKSCQNKIDALQNAQNELKTEAIRKDQYIKQL 833

Query: 850  ENSKRTQIQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVEESEARIQSY 909
            E    ++I+WYQ+K++++  + + +   L  K   V   + E++ LEK++EE++ R+ +Y
Sbjct: 834  EEDNDSKIEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHTY 893

Query: 910  QVLSGSEVETSPESSLRKELEKTKINLSDTYAEIDQYKNXXXXXXXXXXXXXXDYASGKQ 969
             VL     E+  + SLR+ELEK+KINL+D Y++I +YK                     +
Sbjct: 894  NVLD----ESINDDSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNK 949

Query: 970  ELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKKIATLETESK 1029
                Q++ L +EK+ L+D V+ L E ++ L   L   N+A E EK   +KKI+ L+  +K
Sbjct: 950  AFSNQIQNLTDEKTSLEDKVSLLREQMSNLNNELDLQNQAMEKEKAEFKKKISILQNNNK 1009

Query: 1030 GSHQLKEEYDAQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISELREQSQKDRI 1089
                +K EY++++ K+Q+DL+QQ  +AN AQ NYE+ELQK ++VSKTISELREQ    + 
Sbjct: 1010 EIEAVKTEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKG 1069

Query: 1090 AITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSLLYDQIELFSK 1149
             +  L  +  Q  + L++NE +W++QKE    QL+ S   +EDLS+QN LLYDQIEL++ 
Sbjct: 1070 QVETLNLARGQFEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTT 1129

Query: 1150 DNSDGVNGETAEV--REILTNLRRERDILGTKLTVSQREEQTLRGSLASVENELDTTKRQ 1207
              +   + ++  V   +IL  LRRERDIL TK+ V++R+ + LR  ++ ++ EL   + +
Sbjct: 1130 TGNKPTDAKSGSVLNNDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTK 1189

Query: 1208 LSQFQKEITTHSELIGQHEKIIEQLNQLNLLRESNITXXXXXXXXXXXXXXXXXXXXXXX 1267
            L   + E    S +I QH++++E+LNQLNLLRESN T                       
Sbjct: 1190 LCNSKVENEKRSFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLR 1249

Query: 1268 XXILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPEDHKELKEKV 1327
              I P+ESEL  L  S+ EK+Q++ L KEE +RWK+RSQ+I+ KH ++   D+++L+ ++
Sbjct: 1250 GNIAPIESELAALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEI 1309

Query: 1328 SILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAKSELEGKF 1387
              L+ +L++  ++  + +++FNRL++QA EKL +SK++Q +   QLNEL++AK  LE   
Sbjct: 1310 ESLKAQLEDKTQQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSL 1369

Query: 1388 EAEERKVHELQE-RLNAHGNDTETVESVQKELSDALEHSRELEQNLSATLQQNEEITKKL 1446
                 ++ EL++ ++  + N    ++ +Q+   D  E+S+ELE  L       +   KKL
Sbjct: 1370 NNANARIQELEDAKVAENRNQLSMIKKLQE---DTEENSKELETKLEENAISYDSTVKKL 1426

Query: 1447 NDEIDSLK--LELHSLKEQSAATAKGEISEDLSNVVESMRRSFEEEKINF---XXXXXXX 1501
            N+EI  LK  LE     +Q    A G   +DLS VVESM+RSFEE+KI F          
Sbjct: 1427 NEEIGILKEELEKQRQIQQQFQAAAGTEQDDLSKVVESMKRSFEEDKIKFIEEKTREVNQ 1486

Query: 1502 XXXXXXXXHTLQVNGNEPQQQPVNYEEIKRQWESEQEESILKRIAEAEENLKKRIRLPTE 1561
                       +  G +P    +N +EIK+QWE+E  E + K+I EAEE LKKRIRLPTE
Sbjct: 1487 KIREFQEAQEAEETGLKPSN--INIDEIKKQWEAEHNEEVSKKIREAEEALKKRIRLPTE 1544

Query: 1562 ERIKQVV 1568
            E+I +++
Sbjct: 1545 EKISKII 1551

 Score = 69.7 bits (169), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 41/86 (47%), Positives = 51/86 (59%), Gaps = 8/86 (9%)

Query: 1612 FEAEVQAVKKKAFEEGKQQAAMKSTLLERKISKLESQLHGKXXXXXXXXXXXXXXXXP-- 1669
            F  E+Q +KKK+FEEGKQQA MK+TLLERK++K+ESQL                   P  
Sbjct: 1639 FNHELQTIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETKQSVDSPPKHLSKMPNPLL 1698

Query: 1670 NLPSKIDEKSVTTNQSVP-NPLVSGE 1694
             LP KI+E     N + P NPL+SGE
Sbjct: 1699 GLPRKIEE-----NSNPPYNPLLSGE 1719

>Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON}
            similar to Ashbya gossypii AFR286W
          Length = 1769

 Score =  919 bits (2376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 628/1676 (37%), Positives = 989/1676 (59%), Gaps = 56/1676 (3%)

Query: 14   SGDNHNDVSLGKLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTIDEIK 73
            + D+   V   K++AF  V E ++  +D  ++T+   K  +F+++K+ N+RL+++ID +K
Sbjct: 6    ASDSSISVDYSKVAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLK 65

Query: 74   TVSSKREEGLKNEIENLMKDNDSIRLERSQAQEESTQSSRDKQKIQNEVESLQEKLSDLD 133
                ++    K ++E L+ D  S + E+ Q ++E  +   +K ++  EV  L+ ++ +  
Sbjct: 66   CNFEQKINTFKEQVEKLLSDVASRQQEKQQTEDEKLKLMNEKAQLSMEVLKLRSQVEEAK 125

Query: 134  QERETLKQDKREVVAVLEEKIKELESFRTESRKSLDDSKRLRQQVLELETTVQNLKSKEL 193
            Q  E +   K++V  +LEEKI +L + + ES + L  +K LR+  ++LE  +Q  KS+EL
Sbjct: 126  QGMEIIASAKQDVTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGYKSQEL 185

Query: 194  RDQSEIQTITQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDRLTSESLSCKNELQ 253
            R++SEIQ + Q L +++ N+ WL +E+ SK EQL S R K + EL     +  S K++L+
Sbjct: 186  REKSEIQRLHQELNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLKSQLE 245

Query: 254  LEKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLENQVK 313
              ++ N  +  K  EL+  LQEKL+E K L+D L  EK+EF  EMS+KQ+LIDLLE+QV 
Sbjct: 246  FARANNSTLKAKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLESQVS 305

Query: 314  SLQGELNASLDKDNVELLASGERNTENEKLIQELITXXXXXXXXXXXXXXXXXXXXX--X 371
            S++ +L  +    N     +G    E ++L+ ELI                         
Sbjct: 306  SMKSDLENAYQSAN----QNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEATVNELLS 361

Query: 372  IPGDDSQDDINNTSSFISLRNKDSSLR----DMGILKKELIKERHQKERLQRQVESFIVE 427
            + G +    IN+  S  SL +K S++     D+GILKK+L++ER QKE LQ QVESF+VE
Sbjct: 362  VNGKNGVAVINSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVVE 421

Query: 428  LEYKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIHTL 487
            LE+KIP++NSFKERT MLE+ELNDV LLL+ T+ +++++  E      K+ + ES + +L
Sbjct: 422  LEHKIPILNSFKERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCSL 481

Query: 488  TRQRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDDPNSESDSQRVISERLV 547
              QR+DLAHQVQ+LLM +SV+ D+ G L+ +EV F+KRI++++D   +SD+Q +ISERLV
Sbjct: 482  IVQRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSDTQGIISERLV 541

Query: 548  EFNNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQDYNA 607
            +F ++  LQ KN ELL T+R+LA+KLE EEK    ++++ E  T+KEAKEAI+SLQ++  
Sbjct: 542  QFKSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQEHVQ 601

Query: 608  NLESKVEILTKECDAFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLEARLTSLT 667
             LE +++I++KE DAFK     N +++ G  + + T  ++     +E +  LE RL +L 
Sbjct: 602  RLEDQLKIVSKERDAFKLA---NSANKQGDSAPSSTYQSKKL---DEHIMELEKRLKNLA 655

Query: 668  VESSQNNKMLNNEIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQLV 727
             +S  N K+LN+EI  LY++K+++++ LE+ERSSK L EERLKLIQ TL LT+ EN +L 
Sbjct: 656  EQSQDNIKLLNDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELH 715

Query: 728  KRSQNLQSIFDRQDSRTAETVNELIACNSKLAVLETKVANLETEKELLQSSERTSRENYL 787
            KRS +LQ +  +QD +T  T++E+IA  S+L+ L +K+A L +E++ L+  E   +    
Sbjct: 716  KRSDDLQRVLLKQDEKTQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNENE 775

Query: 788  KLSEERNSLRIMVSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLDAKTKEAE 847
             L++E  + +I+VSQLQTLQ ER+  L+E QT Y++N++ LE +  + R  L  +T+E E
Sbjct: 776  ALTKENTTSKILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTREYE 835

Query: 848  DMENSKRTQIQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVEESEARIQ 907
            +   S  +Q +W+Q K+DS+  +  + ++ LQ KT  +  L+   + L  ++EE+E R Q
Sbjct: 836  EQRVSDTSQYKWFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELRTQ 895

Query: 908  SYQVLSGSEVETSPESSLRKELEKTKINLSDTYAEIDQYKNXXXXXXXXXXXXXXDYASG 967
            SY VL+ ++  T    +LRK LEK  INL+D Y++I+QYK+                   
Sbjct: 896  SYSVLANADDITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKALEES 955

Query: 968  KQELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKKIATLETE 1027
            +   +  +  L+ E+  L D +A LN+ +  L   L       ++EK+ L KK++ L+  
Sbjct: 956  QANYRKNIALLEQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGS 1015

Query: 1028 SKGSHQLKEEYDAQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISELREQSQKD 1087
             +   +LK EY+ +I KLQ DL QQAS+AN+AQ+NYE+ELQK ++V+KTIS LRE+SQK 
Sbjct: 1016 QRSLDELKSEYEEKISKLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLREESQKY 1075

Query: 1088 RIAITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSLLYDQIELF 1147
            +  +   K S  + +  LE+NE+SW  Q  + E QL  ++Q  E+L+TQN LLYDQ+EL 
Sbjct: 1076 KSEMEGFKRSASEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQVELL 1135

Query: 1148 SK---DNSDGVNGETAEVREILTNLRRERDILGTKLTVSQREEQTLRGSLASVENELDTT 1204
            SK    +S+     +AE RE++  LRRERDIL TKL VS REE+ LR  L   + EL+  
Sbjct: 1136 SKATSSDSEAAASMSAESRELIMTLRRERDILETKLDVSIREEKILRQRLGLAKTELENV 1195

Query: 1205 KRQLSQFQKEITTHSELIGQ--HEKIIEQLNQLNLLRESNITXXXXXXXXXXXXXXXXXX 1262
            + + S+ Q   T    +  +   E+I+E+LNQLNLLRESN+T                  
Sbjct: 1196 RLEFSKTQ--ATAPDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQNE 1253

Query: 1263 XXXXXXXILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPEDHKE 1322
                   + PLES+L +L  ++ E+DQQ++L KEE++RWK+RSQ+ILHK++RIDP +H++
Sbjct: 1254 IAKLQEQLQPLESQLKSLTITISERDQQISLLKEESSRWKQRSQDILHKYERIDPVEHQK 1313

Query: 1323 LKEKVSILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAKSE 1382
            L ++V+ L+ +L++ + EN E  +RF +L+KQA+E+L+  K A+  + ++   +  AK++
Sbjct: 1314 LADEVTELKNELEKKSLENLESQERFRKLRKQANERLDEFKAAKAKVESEFEAVSIAKAQ 1373

Query: 1383 LEGKFEAEERKVHELQERLNAHGNDTET-VESVQKELSDALEHSRELEQNLSATLQQNEE 1441
            LE +      KV EL+ +L++  N+     +S+++EL +   +  E  + ++    +   
Sbjct: 1374 LEAELAQTLDKVSELESKLSSSANEKNGEADSLKEELEELRANFIEANEAVADIKAEAAS 1433

Query: 1442 ITKKLNDEIDSLKLELHSLK---EQSAATAK-GEISEDLSNVVESMRRSFEEEK------ 1491
              K L ++I  L  ++ +L+   E S   AK    S D + +VE+M++ FEEEK      
Sbjct: 1434 SEKDLKNQIQELTEKIKTLESEIEHSELEAKNSNDSPDFAPIVENMKKKFEEEKQVLIQE 1493

Query: 1492 -----------INFXXXXXXXXXXXXXXXHTLQVNGNEPQQQPVNYEEIKRQWESEQEES 1540
                       I                   ++   N P    ++ E +K + E+E E+ 
Sbjct: 1494 KDEELRMKLEEIQKQYEEERERELSELKASLVESTPNAP---LIDEETLKSKLEAEYEKK 1550

Query: 1541 ILKRIAEAEENLKKRIRLPTEERIKQVVXXXXXXXXXXXXXXXXXXXXXXXXXD-----G 1595
             L+RI EAEE LKKRIRLP+EERI QV+                         +     G
Sbjct: 1551 TLERIREAEEALKKRIRLPSEERINQVIERRQRALDQEFELRVRARALELFKENPESFVG 1610

Query: 1596 NNS---XXXXXXXXXXXXXFEAEVQAVKKKAFEEGKQQAAMKSTLLERKISKLESQ 1648
            + +                F+ ++  V+KKAFEEGKQQ  MK  LLE KI+KLE Q
Sbjct: 1611 DTAKLIKEHQEEMDKLEAKFDEQLALVRKKAFEEGKQQLVMKVKLLESKIAKLEGQ 1666

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1788

 Score =  882 bits (2280), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 639/1839 (34%), Positives = 1027/1839 (55%), Gaps = 93/1839 (5%)

Query: 11   IVTSGDNHNDVSLGKLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTID 70
            + T+ D      L  + +F  VP +QL  I+  IL+ L+ KV  F EL+SQ+L+  V+++
Sbjct: 1    MSTAADTLTKEELTLIGSFLSVPVEQLNAIETSILSNLKTKVEQFTELQSQSLKNEVSLE 60

Query: 71   EIKTVSSKREEGLKNEIENLMKDNDSIRLER-------SQAQEESTQSSRDKQKIQNEVE 123
            E++  S  R   L+ ++E+L++ N S   E+       S  ++ES Q S  +  ++ E++
Sbjct: 61   ELQKTSQGRINDLRTQLEDLIEQNASASEEKKKIEKELSDEKKESFQLSSTRDNLRAELK 120

Query: 124  SLQEKLSDLDQERETLKQDKREVVAVLEEKIKELESFRTESRKSLDDSKRLRQQVLELET 183
             +QEK  +L ++ +       + + +L+ KI + E  +  + K  +  +    +  +LE 
Sbjct: 121  EIQEKFDNLQKQNQ-------DTIKLLDRKISQNEVEKELTLKLTNQYRESTAKCHDLED 173

Query: 184  TVQNLKSKELRDQSEIQTITQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDRLTS 243
             +Q+LK  +   ++ +  ++Q L  + +  + LE E+ +K +++         E+  L  
Sbjct: 174  EIQSLKYNDSLTETTMNKLSQDLKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRK 233

Query: 244  ESLSCKNELQLEKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQK 303
            +  + +N   + KS N  +  +N  ++ +L EK  ++++L++    EK+E   E+S+KQ+
Sbjct: 234  KISTLENNCSIIKSENDALKKENRIVSSNLHEKSSKVQELTNLYNTEKEESQKELSLKQE 293

Query: 304  LIDLLENQVKSLQGELNASLDKDNVELLASGERNTENEKLIQELITXXXXXXXXXXXXXX 363
            +ID+L+ QV+ LQ +    L+     +    ERN E E+L Q+LI               
Sbjct: 294  MIDVLQTQVQKLQDDYTRILNTKQPIVQNDEERNLEVEELKQKLIETETQLNKELEERRN 353

Query: 364  XXXXXXXXIPGDDSQDDINNTSSFISLRNKDSSL-----RDMGILKKELIKERHQKERLQ 418
                                    I+++ + S+L      D+  +KKELI+ER+QKE+LQ
Sbjct: 354  ------------------------ITMQTESSTLSNQQQEDLDTIKKELIQERYQKEKLQ 389

Query: 419  RQVESFIVELEYKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVK 478
             QVE FIVELE K+P INSFK+RT MLEKEL D  LLL++   EK +   E +AL +  K
Sbjct: 390  NQVEIFIVELEKKVPTINSFKQRTDMLEKELTDATLLLENLRREKNQVTNELDALRQNFK 449

Query: 479  DSESSIHTLTRQRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDDPNSESDS 538
              +    +LT+QR DLAHQ+Q++L++ SVQ DS G LSAEEV FI+ I++N+     SDS
Sbjct: 450  SVKWETKSLTKQRNDLAHQLQYILIHTSVQNDSNGPLSAEEVRFIQDILDNESNEESSDS 509

Query: 539  QRVISERLVEFNNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEA 598
            Q+VISERLV F NI  LQ+KN++LLK+VR+LA KLE +E+      Q  E   I EAKEA
Sbjct: 510  QQVISERLVTFQNIVELQQKNIDLLKSVRELARKLELQEEHQQSTSQVVEQQAIDEAKEA 569

Query: 599  IVSLQDYNANLESKVEILTKECDAFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRT 658
            I+SLQ YN  LE K++ L  E D +K++   +   +   L  N          + + ++ 
Sbjct: 570  IISLQSYNTKLEDKIKTLNDELDCYKSLPKPDTKVETEHLRLN--------EENTDLIKE 621

Query: 659  LEARLTSLTVESSQNNKMLNNEIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLEL 718
            LE RL +   ES++    LNNEI ++ R+ +Q   E + ER+S+ L E+RLKLIQ++L L
Sbjct: 622  LETRLATSREESNKTFASLNNEIDDIRRNHSQTVKECQNERASRELAEQRLKLIQNSLSL 681

Query: 719  TRNENQQLVKRSQNLQSIFDRQDSRTAETVNELIACNSKLAVLETKVANLETEKELLQSS 778
            ++ EN+QL KR + LQ I  +QD RT ET+ E ++C   L+  + ++  ++++  + +++
Sbjct: 682  SKVENEQLQKRLEILQDITLKQDQRTQETLKEYVSCKVALSNSQNELNYIQSQLNISKTN 741

Query: 779  ERTSRENYLKLSEERNSLRIMVSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARAR 838
            E++ +++   +S+ERN L+ +VSQLQ+LQ+ERE+     +   +  LD++E+E  D   +
Sbjct: 742  EKSLKDDITIVSKERNELKELVSQLQSLQTEREQIFNSTKLDSQTRLDTVERELYDISEK 801

Query: 839  LDAKTKEAEDMENSKRTQIQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQ 898
            L  K +E +++E+++ ++I+WYQ+K+D++  +    + EL  KT  + +L  E++KL+K 
Sbjct: 802  LKNKDREIKELESNRLSEIEWYQNKIDAIKEKRDAYQDELLEKTNEIGELNYEIKKLQKD 861

Query: 899  VEESEARIQSYQVLSGSEVETSPESSLRKELEKTKINLSDTYAEIDQYKNXXXXXXXXXX 958
            ++ SE+R+ +Y+VL+ S+   +   +L+ ELEK+KINLS+ YAE+DQYK           
Sbjct: 862  LQASESRVTAYKVLNNSDNVGTKMETLQNELEKSKINLSEAYAELDQYKQSASEKEEFLE 921

Query: 959  XXXXDYASGKQELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQ 1018
                     K+E   ++ETLQ ++ +L D  + L+E +T L   L   NKA   EK+ + 
Sbjct: 922  NYQNTVEETKKEFIRKIETLQKDRDELLDTKSILSEQITDLNNELDHQNKAHLEEKSEIS 981

Query: 1019 KKIATLETESKGSHQLKEEYDAQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTIS 1078
            KK+  L  ++    ++  +Y+ ++  LQ DLEQQAS+AN AQ NYE+ELQK + ++KTIS
Sbjct: 982  KKLNELLAQNHNIEEVSNQYELKLSTLQNDLEQQASYANIAQNNYEQELQKHAELAKTIS 1041

Query: 1079 ELREQSQKDRIAITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNS 1138
            +LRE +   R  +  ++ +     ++L +NEK W  Q++ YE Q+   ++ +EDLS+QN 
Sbjct: 1042 QLREDAHTYRKKMDSMQANATTNEELLRKNEKLWEEQRKSYEDQIHALKKRIEDLSSQNK 1101

Query: 1139 LLYDQIELFSK-DNSDGVNGETAEVREILTNLRRERDILGTKLTVSQREEQTLRGSLASV 1197
            LL+DQ++L SK +NS           +++ +LR +RDIL T+L+V++ E + LR  L+SV
Sbjct: 1102 LLFDQVDLLSKSENSYNQQSSATPNEDLVLSLRSDRDILQTRLSVTEEEGKALRLKLSSV 1161

Query: 1198 ENELDTTKRQLSQFQKEITTHSELIGQHEKIIEQLNQLNLLRESNITXXXXXXXXXXXXX 1257
              EL  T+ +L++ +++       + +H+ I+ QLNQLNLLRESNIT             
Sbjct: 1162 NTELTNTRAKLTEIRQQYENTKISVEEHDNIMNQLNQLNLLRESNITLRNEANDSREKAK 1221

Query: 1258 XXXXXXXXXXXXILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDP 1317
                        +LPLE+E N L   + E +QQLN YKEE NRWK+RSQ+IL KH +IDP
Sbjct: 1222 QLQEDLETLREKVLPLEAEQNRLKEVIKENEQQLNAYKEECNRWKQRSQDILTKHKKIDP 1281

Query: 1318 EDHKELKEKVSILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELR 1377
             +H++L+ +++ L+  L +  KEN+EL+DRFNR+KKQAHE+LNSSK  Q TL +Q+ +L 
Sbjct: 1282 VEHEKLEAEIATLKQNLADKKKENEELNDRFNRIKKQAHERLNSSKATQQTLIDQIKQLE 1341

Query: 1378 EAKSELEGKFEAEERKVHELQERLNAHGNDTETVESVQKELSDALEHSRELEQNLSATLQ 1437
            +  + ++   E E   +   +E+       +E V +++ +L +AL  S+E E   +A+++
Sbjct: 1342 DENAHIQSLLETERGNIQNTEEKFRQMNKQSEDVTALRSQLEEALLSSKEFENKFNASVK 1401

Query: 1438 QNEEITKKLNDEIDSLKLELHSLKE--QSAATAKGEISEDLSNVVESMRRSFEEEKINFX 1495
             ++EI+  LND IDSL  EL  LKE   + AT  G+   DLSNVVE M++SFEEEKI F 
Sbjct: 1402 SSDEISSHLNDVIDSLNNELTHLKESKNNEATVTGQ--PDLSNVVEEMKKSFEEEKIKFV 1459

Query: 1496 XXXXXXXXXX-XXXXHTLQVNGNEPQQQPVN-YEEI---KRQWESEQEESILKRIAEAEE 1550
                             ++    + Q + V   ++I   + QWE E EE +LKRI +AEE
Sbjct: 1460 QDQTTEFKEKLAEEVKRIEAQATDTQNKNVTPLQDISAQREQWEKEYEEIVLKRIEQAEE 1519

Query: 1551 NLKKRIRLPTEERIKQVVXXXXXXXXXXXXXXXXXXXXXXXXXDGNNS---XXXXXXXXX 1607
            NLK+RIRLPTEE+I  V+                         + N +            
Sbjct: 1520 NLKRRIRLPTEEKINSVIQKKKNELEKEYDEKVNQRAKELLSSEENKTFIEDLKNDIKKE 1579

Query: 1608 XXXXFEAEVQAVKKKAFEEGKQQAAMKSTLLERKISKLESQLHGKXXXXXXXXXXXXXXX 1667
                 + E++  K KAFEEGKQQA MK+T LE+KISKLESQL G                
Sbjct: 1580 LERNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLESQLQGSNAANENKNDVEVLLK 1639

Query: 1668 XP----NLPSKIDE---KSVTTNQSVPNPLVS-GEKVLKLDPSKXXXXXXXXXXXXXXXX 1719
             P    N+PSK +E   K   +   + NPL+S G   L L+ S+                
Sbjct: 1640 TPSDENNVPSKQEETLSKPQLSKIQIANPLLSTGGTTLALNQSR---------------- 1683

Query: 1720 XPQNNDTMGTSAFGFKPTFTLS-NNSNKSSGTKIDSSSTENKPANPFSSFTETGASSPER 1778
             P +      S+  F   F  + N++N  + T+   +    +P+ P  S +     S   
Sbjct: 1684 APSSLQNGSDSSNPFTSPFQQTKNDANIPAVTQ--PAFLLREPSEPNMSVSTISRQST-S 1740

Query: 1779 ESSNTAMTPTPGEGASTP-SKRAAEDDDNEVGSESKKPR 1816
            E++  +  P   EG +TP SKR A++D  E   +++ P+
Sbjct: 1741 ETNTESELPVSSEGLATPSSKRPAQEDTEEEKLDAETPK 1779

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope, connects the nuclear pore complex with
            the nuclear interior; involved in the Tel1p pathway that
            controls telomere length; involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1771

 Score =  852 bits (2200), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 605/1665 (36%), Positives = 963/1665 (57%), Gaps = 67/1665 (4%)

Query: 29   FYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTIDEIKTVSSKREEGLKNEIE 88
            F G+  ++L+ +DGG++  +  K  +F +L+++NLR +VT+DE+++ S ++    K+++ 
Sbjct: 22   FLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSVTVDELRSSSERKLGACKDQVH 81

Query: 89   NLMKDNDSIRLERSQAQEESTQSSRDKQKIQNEVESLQEKLSDLDQERETLKQDKREVVA 148
             L+++ +S+R E +Q ++   + + +KQ+  N+ E+L+ +   L+Q+++ L+  K +V  
Sbjct: 82   LLLQELESLRGESAQFEKMKLELTSEKQRALNDSETLRVRKEALEQQKQALESSKNDVAR 141

Query: 149  VLEEKIKELESFRTESRKSLDDSKRLRQQVLELETTVQNLKSKELRDQSEIQTITQRLTI 208
            +L EKI EL SF+ E+   + +++RLRQQ L+LE+  +  KS++L+ ++E+  ++Q L++
Sbjct: 142  LLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRVSKSEDLQRKAELHRLSQELSL 201

Query: 209  LQKNSQWLEEEVTSKTEQLISTRRKNDDELDRLTSESLSCKNELQLEKSRNQVITTKNEE 268
             + NS+WLE ++  K  +  + R     +L  LT +  + + ELQ     N+ +   N  
Sbjct: 202  CRSNSEWLESQLGQKNAEFNAYRHTTQSQLAALTQKLETLEQELQASTRTNKSLREHNAR 261

Query: 269  LTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLENQVKSLQGELNASLDKDNV 328
            +T  L+ +L  +K L+D+L  EKQEF  EMS       L E  V  L+G++ +   K ++
Sbjct: 262  ITNDLETQLRNVKKLTDNLNSEKQEFTREMS-------LKERLVDLLEGQVQSL--KSDL 312

Query: 329  ELLAS---GERNTENEKL--IQELITXXXXXXXXXXXXXXXXXXXXXXIPGDDSQDDINN 383
            EL ++   G+  + +  L  + E +                       +   D +  + +
Sbjct: 313  ELRSTAGEGDDGSFSNPLNALSEELAQKTQQLEESEFKVQKLEQTVQDLVSTDKESRLKS 372

Query: 384  TSSFISLRNKDSSLRDMGILKKELIKERHQKERLQRQVESFIVELEYKIPVINSFKERTS 443
            ++        D    D+ +LK+++I E+ QKE LQ QVE+F+VELE K+P+++SFK+R  
Sbjct: 373  SAHEYPASVTDL-YGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPMLSSFKDRND 431

Query: 444  MLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIHTLTRQRTDLAHQVQFLLM 503
            MLE++L + A +L+  S +KE    +      ++ D E  I  LTRQR+DLA QVQ+LL+
Sbjct: 432  MLEEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLARQVQYLLI 491

Query: 504  NISVQVDSGGLLSAEEVSFIKRIVNNDDPNSESDSQRVISERLVEFNNIATLQEKNMELL 563
              SV+ DS G L+ EE++F++RI+   D + E D+Q+VISERLVEF +I  LQ KN +LL
Sbjct: 492  QASVRSDSKGPLTTEEIAFVRRILEQGDLSLERDTQKVISERLVEFRDIVELQSKNSDLL 551

Query: 564  KTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQDYNANLESKVEILTKECDAF 623
            +T+R LA+KLESEE+    + +T END I+EAKEAI++LQ++   LES++E+LTKE DA+
Sbjct: 552  RTIRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESRIEVLTKERDAY 611

Query: 624  KAICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLEARLTSLTVESSQNNKMLNNEIHE 683
            KAI     S  NG+        N  G     ++  LE  L +   E+ +N KMLN+EI E
Sbjct: 612  KAI---QPSTNNGNKITEHALANSKGKMS-ARVDDLERSLVTEREEAEKNMKMLNSEIQE 667

Query: 684  LYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQLVKRSQNLQSIFDRQDSR 743
            L R KT+++IE+EKER+SK L EERLK+ Q +L+LT+ EN++L KR   +Q    +QD++
Sbjct: 668  LLRQKTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYHIIQDNLLKQDTK 727

Query: 744  TAETVNELIACNSKLAVLETKVANLETEKELLQSSERTSRENYLKLSEERNSLRIMVSQL 803
            T ET++ LI C SKLA LE+++ +   + E L S ++ + E+  +L+ ERN+L I+V+QL
Sbjct: 728  TQETLSCLIECQSKLATLESELKSSVAKIESLSSCQKKNTESIEQLTAERNNLTILVTQL 787

Query: 804  QTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLDAKTKEAEDMENSKRTQIQWYQDK 863
            QTLQ ER+K L E + +YKE +D+LE E +  R +L  K +E  D   +  ++ QWYQ+K
Sbjct: 788  QTLQGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQWYQEK 847

Query: 864  LDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVEESEARIQSYQVLSGSEVETSPES 923
            +DS+    + +  +L+++     DLES+ + LE +++E E + QSY VL+ ++   +   
Sbjct: 848  IDSLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQSYDVLNQTDDVLAQTE 907

Query: 924  SLRKELEKTKINLSDTYAEIDQYKNXXXXXXXXXXXXXXDYASGKQELQLQVETLQNEKS 983
            +LR ELEK+KI L D Y++I+++++               +   K E       ++ ++ 
Sbjct: 908  ALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNEHSKDFGNMKKKED 967

Query: 984  QLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKKIATLETESKGSHQLKEEYDAQIL 1043
            +L   V  L   ++ L   L    K  ++EKN L+ ++ +L++  +  + +KE Y+ Q+ 
Sbjct: 968  ELVGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQSTQETMNSMKEHYEQQLG 1027

Query: 1044 KLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISELREQSQKDRIAITRLKNSEEQVRQ 1103
            KL +DL QQA+FAN+AQ NYE+ELQ+ ++VSKTIS+LRE+SQK +   + L++S EQ+ +
Sbjct: 1028 KLTQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQKYKNQASVLQSSIEQLEK 1087

Query: 1104 VLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSLLYDQIELFSKD-NSDGVNGETAE- 1161
             L++++  W  QKEEYE QL +  Q +EDL+ QN LL DQ++L +KD NS+    E  E 
Sbjct: 1088 TLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDLEAKDPNSELGQSEPQEK 1147

Query: 1162 VREILTNLRRERDILGTKLTVSQREEQTLRGSLASVENELDTTKRQLSQFQKEITTHSEL 1221
            VRE++T+LRRERDIL TKL VS+R E      L ++E EL   K +LS  Q   + +S +
Sbjct: 1148 VRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFAKEELSSLQALSSQNSIM 1207

Query: 1222 IGQHEKIIEQLNQLNLLRESNITXXXXXXXXXXXXXXXXXXXXXXXXXILPLESELNTLH 1281
              +H K++EQLNQLNLLRESNIT                         + PLESEL +L 
Sbjct: 1208 ADEHNKLLEQLNQLNLLRESNITLRSEVQKKTQRCQELEGQIDNLQQSLQPLESELASLK 1267

Query: 1282 TSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPEDHKELKEKVSILETKLDETNKEN 1341
             SV  KD Q++L  EE NRWK+RSQ+IL K +RIDPE+HK+L E++S  + +L     +N
Sbjct: 1268 RSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELSQAKAELAAKADQN 1327

Query: 1342 KELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAKSELEGKFEAEERKVHELQERL 1401
             EL+DRF RLKKQA E+L+++K  Q  LS +L + REA+S +E +   E+     LQE L
Sbjct: 1328 SELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMELQLRKEQDVNKALQESL 1387

Query: 1402 NAHGNDTETVESVQKELSDAL-------------EHSR-ELEQNLSATLQQNEEITKKLN 1447
                ++ +   + Q EL  AL             E  R ++E+ L + L++ +   ++L 
Sbjct: 1388 QRVESEAKADSTTQPELESALQKLSQAEKKAQDIESDRAQIEKALQSELEKVKSHAEELE 1447

Query: 1448 DEIDSLKLELHSLKE--QSAATAKGEISEDLSNVVESMRRSFEEEKINFXXXXXXXXXX- 1504
              +D  + E+ SL+E  Q A T   E+        E M+R  EE                
Sbjct: 1448 RRLDEARREVESLEEVKQGAFTDSSEL--------EKMKRDLEEHSNTLIAEKEAEIRSH 1499

Query: 1505 --------XXXXXHTLQVNGNEPQQQPVNYEEIKRQWESEQEESILKRIAEAEENLKKRI 1556
                           L+ NG   +  PV+ E +K+QWE + E+  +KRI E+ E L+KRI
Sbjct: 1500 YEELRLKEKATYEKELEENG---KHTPVDIETLKKQWEEDYEQKTIKRIEESNEILRKRI 1556

Query: 1557 RLPTEERIKQVVXXXXXXXXXXXXXXXXXXXXXXXXXDGNNSXXXXXXXXXXXXX----- 1611
            RLPTEE+I ++V                             +                  
Sbjct: 1557 RLPTEEKINKIVETRKSELEQEFEAKLQKRASELANEKPQPASFTEVMKRHKQEMEKLKA 1616

Query: 1612 -----FEAEVQAVKKKAFEEGKQQAAMKSTLLERKISKLESQLHG 1651
                  + E+  V+KKAF+EGKQQA+MKS  LE+KI+KLE+Q+  
Sbjct: 1617 DLTREMDEEMAQVRKKAFDEGKQQASMKSMFLEKKIAKLEAQVKA 1661

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score =  818 bits (2113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 596/1657 (35%), Positives = 952/1657 (57%), Gaps = 86/1657 (5%)

Query: 51   KVLDFNELKSQNLRLNVTIDEIKTVSSKREEGLKNEIENLMKDNDSIRLERSQAQEE--S 108
            K  +F +L+S NLR NV ++E K   S + E LK E++ +++DN  +R E     E+  S
Sbjct: 34   KAEEFAQLQSDNLRTNVLLEETKANLSSKYEKLKEELDYVVEDNTKVRAENKTLSEKVWS 93

Query: 109  TQSSRDKQKIQ--NEVESLQEKL-SDLDQERETLKQDKREVVAVLEEKIKELESFRTESR 165
             ++S D  K+   N++++  E L +++D+  E  K    E+    +EK+ ELE  R E +
Sbjct: 94   LETS-DNSKLAEINQLKTSNEGLQNNIDRANERYK----ELNGSYDEKVTELEHIRDEKK 148

Query: 166  KSLDDSKRLRQQVLELETTVQNLKSKELRDQSEIQTITQRLTILQKNSQWLEEEVTSKTE 225
            +     K L  ++LELE   Q  +S EL  +SE++   Q + +L+KN +WLE+E+T+K +
Sbjct: 149  ELQTQIKTLNDKILELELKCQEYQSSELNRKSELERNAQEILLLRKNQEWLEQELTNKNQ 208

Query: 226  QLISTRRKNDDELDRLTSESLSCKNELQLEKSRNQVITTKNEELTKSLQEKLMEMKDLSD 285
              +  R+K D  +    +     K++L++EKS  ++++ K +E T+ LQ  L+E KDL D
Sbjct: 209  HFMFYRKKTDLMVHDAVTNVEKLKSDLKIEKSSKEILSKKLDETTEQLQNNLIENKDLKD 268

Query: 286  SLYREKQEFAHEMSMKQKLIDLLENQVKSLQGELNASLDKDNVELLASGERNTENEKLIQ 345
             L  EKQEF  E+S+K KLI L ENQ+KSL+  L             + E N EN   + 
Sbjct: 269  VLAVEKQEFDKELSIKDKLIKLYENQIKSLESTLQQKF--------KTAEANEENSSEVV 320

Query: 346  ELITXXXXXXXXXXXXXXXXXXXXXXIPGDDSQDDINNTSSFISLRNK------------ 393
            + +                       I   DS D        +SL+ K            
Sbjct: 321  KSLKEELSLAERKLQDMEEKCVRLESILDHDSND--------VSLQTKGRKRTYSNDSNS 372

Query: 394  ----------DSSLR------DMGILKKELIKERHQKERLQRQVESFIVELEYKIPVINS 437
                      DSS+       D+ ILK++L++E+ QKE+LQ QVESF++ELE+KIPVINS
Sbjct: 373  NSSDELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEKLQNQVESFVIELEHKIPVINS 432

Query: 438  FKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIHTLTRQRTDLAHQ 497
            F+ERTS+LEKEL D ALLL+H + E E +  E ++L KK+ D  S +  L RQRTDLAHQ
Sbjct: 433  FQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDNSQLEILLRQRTDLAHQ 492

Query: 498  VQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDDPNSESDSQRVISERLVEFNNIATLQE 557
            +Q+LL+NIS+  D+  LL+ +E+ FIK +V+ND+  S +DSQ+VISE L++F +I  LQE
Sbjct: 493  LQYLLINISIINDNDHLLNEDEIKFIKNLVSNDNMASTNDSQKVISEHLIKFKDIQQLQE 552

Query: 558  KNMELLKTVRKLAEKL-ESEEKDVNKKIQTF--ENDTIKEAKEAIVSLQDYNANLESKVE 614
            KNMEL+KTVR LA++L E+EEK  +    T   +N+   EAKEAI++L+  N NLE  ++
Sbjct: 553  KNMELVKTVRTLAQQLEENEEKKKSTSNNTVDEDNEIFAEAKEAILTLEKVNENLEKNLQ 612

Query: 615  ILTKECDAFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLEARLTSLTVESSQNN 674
            I+TKE DAFK + S +  ++N   S +  + +   S +E  ++ LE RLT LT +S+ ++
Sbjct: 613  IVTKERDAFKLLVSEDR-ERNFKSSNSVHKYHELKSYNETVVKDLENRLTQLTNDSNAHS 671

Query: 675  KMLNNEIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQLVKRSQNLQ 734
            K L  E++ L++  +Q+++++EK RS+K+L EERLK+ Q+++EL   EN+QL  RS  L+
Sbjct: 672  KALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSMELLSKENEQLRIRSSRLE 731

Query: 735  SIFDRQDSRTAETVNELIACNSKLAVLETKVANLETEKELLQSSERTSRENYLKLSEERN 794
                +QD  T +T +  +   SK + LET V NLETE  LL+  E + +      +EE+ 
Sbjct: 732  DSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVTLLKDREISLKSELSNTTEEKT 791

Query: 795  SLRIMVSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLDAKTKEAEDMENSKR 854
             LRIMV+QLQ+LQSERE  L+ +Q+ +K+ +  +         +L  +  E + +E  + 
Sbjct: 792  KLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLDKQLSERVHEIDKIEKERN 851

Query: 855  TQIQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVEESEARIQSYQVLSG 914
             Q +WYQ K+D    + Q ++ +LQTK   +  L  + + LEK++E ++ RI +Y+ ++ 
Sbjct: 852  AQYEWYQKKIDEASQQQQQIQGQLQTKNDELERLHLQNKTLEKELEGAQIRIHTYETINQ 911

Query: 915  SEVETSPESSLRKELEKTKINLSDTYAEIDQYKNXXXXXXXXXXXXXXDYASGKQELQLQ 974
            +  E   E+ + KELEKTKI L+D Y++++++KN               + +  ++ +  
Sbjct: 912  NNSENQEENDVIKELEKTKIELADAYSQLEEFKNLSQNSEDALKELNASFNAKDRDYRDA 971

Query: 975  VETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKKIATLETESKGSHQL 1034
            ++TL  EK++++     L + +  ++  L   ++ AE+E+  L + IA L+  ++   ++
Sbjct: 972  IKTLTEEKTEIEGRFEILKQQLENIKNELTVQSEEAESERKRLTQTIAELQGAAQPIEEV 1031

Query: 1035 KEEYDAQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISELREQSQKDRIAITRL 1094
            K+ ++ ++ KL+ DLE+Q  +AN AQ+NYE+ELQ+ ++VSKTISELREQ+Q+ +     L
Sbjct: 1032 KKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQRHADVSKTISELREQNQRLKNDTKSL 1091

Query: 1095 KNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSLLYDQIELFSKDNS-- 1152
                + ++  + QNEK   ++++EY  Q++ ++Q ++D++ QN LLY+QI+L ++  S  
Sbjct: 1092 TAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDITKQNQLLYNQIDLLNRAESVN 1151

Query: 1153 -----DGVNGETAEVREILTNLRRERDILGTKLTVSQREEQTLRGSLASVENELDTTKRQ 1207
                 D  NG TA    ++ +LRRERDIL TK+ V + E+ +L+  L  ++NEL+ TKR 
Sbjct: 1152 ENSSDDEANGSTA----LVLSLRRERDILDTKINVIETEKNSLQQKLDDIQNELENTKRS 1207

Query: 1208 LSQFQKEITTHSELIGQHEKIIEQLNQLNLLRESNITXXXXXXXXXXXXXXXXXXXXXXX 1267
             +  + E + HS+LI  ++ I   L QLNLLRESN+T                       
Sbjct: 1208 AALLESEYSEHSDLINNYQTIRGDLEQLNLLRESNVTLRNELKQALDEKDKIAKDLQICR 1267

Query: 1268 XXILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPEDHKELKEKV 1327
              +LPL+S L + +  + EKD ++    +E+ RWK R +E++ KH +++ +D+ +L+E +
Sbjct: 1268 NELLPLQSNLESANNLIKEKDLKIASANDESQRWKTRLEEMIEKHQKVNVDDYTKLEETL 1327

Query: 1328 S----ILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAKSEL 1383
            +    +L+ K+ ETN    EL+DRFNRLKKQAHEKLN+SK  Q++L  Q++ L   K ++
Sbjct: 1328 NETKQLLDNKVQETN----ELNDRFNRLKKQAHEKLNTSKELQSSLQEQISNLISEKDDI 1383

Query: 1384 EGKFEAEERKVHELQERLNAHGNDTETVESVQKELSDALEHSRELEQNLSATLQQNEEIT 1443
              + + +  +  EL   LN        +E++++EL+  +  S ELE  L   ++ +   +
Sbjct: 1384 RKQLDVKTEENSELLSELNNFREKQNDLETLREELNKEISKSEELEVKLQNEIESSSLAS 1443

Query: 1444 KKLNDEIDSLKLELHSLKEQSAATAKGEISEDLSNVVESMRRSFEEEKINFXXXXXXXXX 1503
            +  N EI+ L+  +  LK Q AA +  +  E  +  VE+++R FE +K  F         
Sbjct: 1444 RNTNKEIEELQKVIDDLKTQLAANS-TDADEQTNRNVEAIKREFENQKTKFIAEKTEEFN 1502

Query: 1504 X-----XXXXXHTLQVNGNEPQQQPVNYEEIKRQWESEQEESILKRIAEAEENLKKRIRL 1558
                       +  Q N     +  V+ E +++QWE + EE I KRIAEAE+NLKKRIRL
Sbjct: 1503 KRLIEETEKIRNEFQENEKPDTELNVDVEALRKQWEEDSEELIQKRIAEAEDNLKKRIRL 1562

Query: 1559 PTEERIKQVVXXXXXXXXXXXXXXXXXXXXXXXXXDGN---NSXXXXXXXXXXXXXFEAE 1615
            P+EE+I +++                         D +   N+             FE E
Sbjct: 1563 PSEEKINKIIEKRRSELESEFDQKIRDKARDLLMNDHSNEFNNELKEALEKELKERFEDE 1622

Query: 1616 VQAVKKKAFEEGKQQAAMKSTLLERKISKLESQLHGK 1652
            +QA +KKAFEEGKQQA MK+TLLERKI KLESQ+  K
Sbjct: 1623 LQAARKKAFEEGKQQATMKTTLLERKIQKLESQIQEK 1659

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
            YKR095W (MLP1) - colied-coil protein (putative), similar
            to myosin and TPR [contig 159] FULL
          Length = 1760

 Score =  811 bits (2096), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/1404 (37%), Positives = 848/1404 (60%), Gaps = 24/1404 (1%)

Query: 26   LSAFYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTIDEIKTVSSKREEGLKN 85
            +++F  +  + LV + G +   +  K+ +F +L+++NL+ +VTIDE+++ SS +    K+
Sbjct: 21   VASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKCSVTIDELRSSSSHKLGACKD 80

Query: 86   EIENLMKDNDSIRLERSQAQEESTQSSRDKQKIQNEVESLQEKLSDLDQERETLKQDKRE 145
            +I +L+++ +++R E  Q ++   Q   ++Q+  N+ ++L+ +   L+Q+++ L+ +K +
Sbjct: 81   QIHSLLQEIEAVRAENLQLEQRRAQCDAERQRSINDSDTLRARNEALEQQKQVLEANKND 140

Query: 146  VVAVLEEKIKELESFRTESRKSLDDSKRLRQQVLELETTVQNLKSKELRDQSEIQTITQR 205
            V  +L EKI ++ + + E+ + L +++ LRQQ LELE   +  KS+EL+ +++   ++Q+
Sbjct: 141  VAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQARVYKSEELKHKADFHQLSQK 200

Query: 206  LTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDRLTSESLSCKNELQLEKSRNQVITTK 265
            +++L  N++WLE ++  K  +  + R++   EL  ++    +C+ +LQ      + +  +
Sbjct: 201  VSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGDLQAATKTIKTLREQ 260

Query: 266  NEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLENQVKSLQGELNASLDK 325
            N +    L+ +   +K L+D L   KQEF  EMS+KQ+L++LLE QV +L+ EL      
Sbjct: 261  NGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQVSALKSELEFK--- 317

Query: 326  DNVELLASGERNTENEKLIQ-ELITXXXXXXXXXXXXXXXXXXXXXXIPGDDSQDDINNT 384
             N    ++    TE++  I+ EL+                       +  D+    I+ +
Sbjct: 318  -NSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTVEQLLSADEK--TISGS 374

Query: 385  SSFISLRNKDSSLRDMGILKKELIKERHQKERLQRQVESFIVELEYKIPVINSFKERTSM 444
             S   L        D+GILKK++I ER QKE LQ QVE+F+VELE K+P+++SFK+R  +
Sbjct: 375  QSLPDL------YADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSFKDRNDV 428

Query: 445  LEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIHTLTRQRTDLAHQVQFLLMN 504
            LEKEL + A +LD  S +K++   + +    +++D ES I  LT+QR+DLA QVQ+LL+ 
Sbjct: 429  LEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLARQVQYLLIQ 488

Query: 505  ISVQVDSGGLLSAEEVSFIKRIVNNDDPNSESDSQRVISERLVEFNNIATLQEKNMELLK 564
            ++V+ DS G LSAEE +F+K++VN ++   + D+Q +ISERLVEF NI  LQ KN +LL 
Sbjct: 489  VTVRGDSHGPLSAEETAFVKKVVNMENTQPDGDAQGIISERLVEFKNIVELQAKNADLLH 548

Query: 565  TVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQDYNANLESKVEILTKECDAFK 624
            TVR LA +LE+EE+ V  K +  ENDTI EAKEAIV+LQD+   LE++++++T+E DA+K
Sbjct: 549  TVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRIDVITRERDAYK 608

Query: 625  AI---CSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLEARLTSLTVESSQNNKMLNNEI 681
            AI    S  GS  NG L     + + N    + K+R LE  L++   E+  N K+L  E 
Sbjct: 609  AIQSQTSHEGS--NGGLRDVNAKASENS---DLKIRELEELLSAAKREAEANVKLLMTEN 663

Query: 682  HELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQLVKRSQNLQSIFDRQD 741
             EL RSK+++ + +EKE+SS+ L EERLK+ + +L LT+ EN++L KR   L++   +QD
Sbjct: 664  QELARSKSELVVNVEKEKSSRLLAEERLKISKSSLLLTKQENEELNKRGLVLENNLAKQD 723

Query: 742  SRTAETVNELIACNSKLAVLETKVANLETEKELLQSSERTSRENYLKLSEERNSLRIMVS 801
            +RT ET++ELI C S+LA L  ++ N   ++ LL +S +  +E   +L++ERN L I+V+
Sbjct: 724  TRTQETISELIDCKSQLATLSAELKNSIAKENLLNTSHQKLKETNEQLTKERNELTILVT 783

Query: 802  QLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLDAKTKEAEDMENSKRTQIQWYQ 861
            QLQTLQ ER+  LK+    +K  +DSLE E +  R  L  K  E  D  ++  ++ +WYQ
Sbjct: 784  QLQTLQKERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFMSTSDSRSRWYQ 843

Query: 862  DKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVEESEARIQSYQVLSGSEVETSP 921
            +K+D++    +    +L +KT ++ +L+S+   L  ++ ++E + QSY VL+ ++   + 
Sbjct: 844  EKIDALNECLKSTTSDLNSKTQMIQELQSQQSLLTSKLRDAETKSQSYSVLNQTDDVLTQ 903

Query: 922  ESSLRKELEKTKINLSDTYAEIDQYKNXXXXXXXXXXXXXXDYASGKQELQLQVETLQNE 981
              +LR ELEKT+INL D ++++D+YK                    KQ+  ++VETL+ E
Sbjct: 904  TDALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTALEHSKQDHTIEVETLKKE 963

Query: 982  KSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKKIATLETESKGSHQLKEEYDAQ 1041
            +  L +  A L + +  L   L       E  K+   K    +++       +K++Y  +
Sbjct: 964  RDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEEEVKSNKTALASMKDQYQLE 1023

Query: 1042 ILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISELREQSQKDRIAITRLKNSEEQV 1101
            + KL  DL QQA +AN+AQ NYE+ELQ+ ++VSKTIS+LRE++QK +  +  L+ S  ++
Sbjct: 1024 LSKLTEDLNQQAMYANKAQENYEQELQRHADVSKTISQLREEAQKHKNKVHSLEASITEL 1083

Query: 1102 RQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSLLYDQIELFSKDNSDGVNGE-TA 1160
            ++ LE+NE  W+AQK+EYE Q   S Q +EDLSTQN LL+DQI L   D S  +N E  +
Sbjct: 1084 KKSLEENESCWAAQKQEYETQASLSSQRIEDLSTQNRLLFDQISLKDTD-SIPINDELKS 1142

Query: 1161 EVREILTNLRRERDILGTKLTVSQREEQTLRGSLASVENELDTTKRQLSQFQKEITTHSE 1220
            E RE+++ L+RE DIL TKL +++R+E  L+  L   E EL   K ++ + Q    T S 
Sbjct: 1143 EARELISTLKRECDILQTKLELAKRDESNLKQKLEFTEQELSVAKSEIRKSQVTSDTRSI 1202

Query: 1221 LIGQHEKIIEQLNQLNLLRESNITXXXXXXXXXXXXXXXXXXXXXXXXXILPLESELNTL 1280
            +I ++ KI+EQLNQ+NLLRESNIT                         + PLE+++ TL
Sbjct: 1203 MIEENSKILEQLNQVNLLRESNITLRNELQRKSQRNQDLERNVEELQEALKPLENDILTL 1262

Query: 1281 HTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPEDHKELKEKVSILETKLDETNKE 1340
              SV  KD+Q++L  EE NRWK+RSQ+IL K++R+DPE+HK+L E++S    +     ++
Sbjct: 1263 QRSVGAKDKQISLITEEVNRWKQRSQDILLKYERVDPEEHKKLAEELSQARAEAAANAQQ 1322

Query: 1341 NKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAKSELEGKFEAEERKVHELQER 1400
              EL+DRF RLKKQA E+L++++  Q TL+ +L E RE++  LE   + E  K   LQE 
Sbjct: 1323 RSELEDRFQRLKKQARERLDNARTTQNTLNAELTEARESQKALEDALDKEREKTRSLQES 1382

Query: 1401 LNA-HGNDTETVESVQKELSDALE 1423
            + A   N+ E   + + +L DAL+
Sbjct: 1383 IKATEENEIENSSATRDQLQDALQ 1406

 Score = 43.5 bits (101), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 23/28 (82%)

Query: 1615 EVQAVKKKAFEEGKQQAAMKSTLLERKI 1642
            EV   KKKAF+EGKQQA+MKS  LE+KI
Sbjct: 1622 EVAQAKKKAFDEGKQQASMKSMFLEKKI 1649

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope connects the nuclear pore complex with
            the nuclear interior involved in the Tel1p pathway that
            controls telomere length involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1748

 Score =  763 bits (1971), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/1688 (33%), Positives = 938/1688 (55%), Gaps = 80/1688 (4%)

Query: 24   GKLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTIDEIKTVSSKREEGL 83
             +++ F  V +  +  I+  +L  +E K+ D  + KS+NLR+  T+D++K+ S  + E  
Sbjct: 8    SRVADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQSENKLESF 67

Query: 84   KNEIENLMKDNDSIRLERSQAQEESTQSSRDKQKIQNEVESLQEKLSDLDQERETLKQDK 143
            K  I  L K  +  + ER   +EE  +      ++   +  L++++    Q++E     K
Sbjct: 68   KIHISQLAKALEDGKDERLHFEEEKRRLIEGNSQVTKRIIELEQEIEVERQQKELADASK 127

Query: 144  REVVAVLEEKIKELESFRTESRKSLDDSKRLRQQVLELETTVQNLKSKELRDQSEIQTIT 203
            +++   L EKI+EL S + +  ++   +K LRQ+V+  ET +Q  ++ ELR +SEI  + 
Sbjct: 128  QDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQTQQALELRSKSEILRME 187

Query: 204  QRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDRLTSESLSCKNELQLEKSRNQVIT 263
            Q +T+L++N+ WL  ++ +KT QL   R     EL     +  + ++EL++ ++ NQ + 
Sbjct: 188  QEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEIARTSNQKLK 247

Query: 264  TKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLENQVKSLQGELNASL 323
                 L + L++KL E K++ D     KQE   EMS+KQ++ID LE  ++SL+ E++A+ 
Sbjct: 248  QSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESLKKEMDAT- 306

Query: 324  DKDNVELLASGERNTENEKLIQELITXXX---XXXXXXXXXXXXXXXXXXXIPGDDSQDD 380
             K+N++  +S     E ++LI+EL                           I  +DS+  
Sbjct: 307  -KNNMD--SSYFTEKERDELIEELNAVKYRLDASESNCIKLKETIDELTSNIKLEDSEVG 363

Query: 381  INNTSSFISLRNKDSSLRDMGILKKELIKERHQKERLQRQVESFIVELEYKIPVINSFKE 440
                SS  S+        D+G+LKK+L+ E+ QK+ L+ QVE+F+VELE+KIPV+NSFKE
Sbjct: 364  NTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEHKIPVLNSFKE 423

Query: 441  RTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIHTLTRQRTDLAHQVQF 500
            R+ MLE+ELN+V +LL+ T  +++++  + + L   VK  E+ I +L++QR DLAHQ+Q+
Sbjct: 424  RSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQIASLSKQRVDLAHQIQY 483

Query: 501  LLMNISVQVDSGGLLSAEEVSFIKRIVNNDDPNSESDSQRVISERLVEFNNIATLQEKNM 560
            LL+N S++ + GG LSAEE+ F+K + N+ +    SD+Q +I++RLVEF ++  LQ+KN 
Sbjct: 484  LLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQGIITDRLVEFRSVVELQQKNS 543

Query: 561  ELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQDYNANLESKVEILTKEC 620
            ELL T+R LA++LE  E +   +IQ  E++T++EAKE I++L D+  NLE+++ IL+KE 
Sbjct: 544  ELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQNLENQLVILSKER 603

Query: 621  DAFKAICSRNGSDQNGSLSANGTQGNRNGSSD-EEKLRTLEARLTSLTVESSQNNKMLNN 679
            DA+KA+        N S   N  +     S D ++K++ LE RLT++  E+  N K  ++
Sbjct: 604  DAYKALSV------NASSGTNTPKAITYPSPDNDDKVKDLETRLTAVIQEAENNAKEWSS 657

Query: 680  EIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQLVKRSQNLQSIFDR 739
            E   L +   +IS+  E E++S+TL E+RL L+Q TLEL++ + ++L KRS +LQ I  +
Sbjct: 658  ENSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSSDLQDILTK 717

Query: 740  QDSRTAETVNELIACNSKLAVLETKVANLETEKELLQSSERTSRENYLKLSEERNSLRIM 799
            QD RT ETV+ LI   S L+ ++++++ L++EK+ +   ++  +    + S+E    +++
Sbjct: 718  QDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAENERFSKESVEYKVL 777

Query: 800  VSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLDAKTKEAEDMENSKRTQIQW 859
            ++QLQTLQ ERE  LKE Q +YKE L  LE E + +  RL+   K    + ++K  Q  W
Sbjct: 778  IAQLQTLQREREMLLKETQNSYKEKLRKLEIELSGSLERLEEIEKNTTGIASNKEHQYNW 837

Query: 860  YQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVEESEARIQSYQVLSGSEVET 919
            +Q+K+D + +E+   K  L+ K   +  ++S + +   +++E+EAR QSY +LS  +   
Sbjct: 838  FQEKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEARAQSYTMLSNVDDAQ 897

Query: 920  SPESSLRKELEKTKINLSDTYAEIDQYKNXXXXXXXXXXXXXXDYASGKQELQLQVETLQ 979
            +   +LR+ELEK  + LSD+Y++I+ +K                +   ++E Q  + TL+
Sbjct: 898  NLVETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQSVNEVSQAFEEAQKESQKTIITLE 957

Query: 980  NEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKKIATLETESKGSHQLKEEYD 1039
            NE++QLQ  V  LN+ V  L   +       + E+N   ++I+ L+   +   + K +Y+
Sbjct: 958  NERNQLQSTVNILNDQVKDLNNEIFHQKSEYQTERNATMEEISKLQMVKESVDRTKADYE 1017

Query: 1040 AQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISELREQSQKDRIAITRLKNSEE 1099
             +I  +Q+DLE Q  +AN +QR+YE ELQK ++VSKTI+ LR ++Q  +  +  LK   +
Sbjct: 1018 EKIAMIQKDLEMQTQYANESQRSYELELQKHADVSKTITSLRTEAQSYKSDLETLKTQSQ 1077

Query: 1100 QVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSLLYDQIELFSK----DNSDGV 1155
               + L+ +EK W+ QK EYE +L    Q +++LSTQN LLYDQIEL +K    DNS   
Sbjct: 1078 LAMENLKNSEKLWNEQKTEYEDKLSVLEQRVQELSTQNKLLYDQIELLNKTEDRDNSHDS 1137

Query: 1156 NGETAEVREILTNLRRERDILGTKLTVSQREEQTLRGSLASVENELDTTKRQLSQFQKEI 1215
            +       ++L +LRRERD+L TKL V+  E+  L+  L   ++E++    QLSQ +   
Sbjct: 1138 S-------DLLISLRRERDMLETKLEVALSEQTVLKQRLDIAKSEIEDLNTQLSQVKNSS 1190

Query: 1216 TTHSELIGQHEKIIEQLNQLNLLRESNITXXXXXXXXXXXXXXXXXXXXXXXXXILPLES 1275
            +  + L+ Q E I+++L+QL+LLRESN+T                         + PL+S
Sbjct: 1191 SESAHLLEQQENIMKELDQLHLLRESNVTLRSENSSFKKECDNLKSQLQECNDRLAPLQS 1250

Query: 1276 ELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPEDHKELKEKVSILETKLD 1335
             +++L   +  K+Q+L   KEEA RWK RSQ+ILHK++RIDPE+H +LKE+++ ++ +L 
Sbjct: 1251 SISSLQNGIKIKEQELIQSKEEAERWKSRSQDILHKYERIDPEEHGKLKEEINDVKNELQ 1310

Query: 1336 ETN-------KENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAKSELEGKFE 1388
             T         E  + + +F R++ QA ++LN+SK  + +LS+++N++ EAKS++E    
Sbjct: 1311 TTKDTLQSVIAEKDDWESKFQRIRLQARDRLNASKEKEQSLSSEINQINEAKSQVEADLG 1370

Query: 1389 AEERKVHELQERLNAHGNDTETVE-SVQKELSDALE--HSRELE-QNLSATLQQNE---- 1440
              +    EL+ERL     + ET E +   +LS   E  HS +++ +N S T Q N     
Sbjct: 1371 KCKTACKELEERLQVVTQEAETKEQTFNSQLSKLQEDLHSIQVQMENASKTEQNNADSDE 1430

Query: 1441 ------EITKKLNDEIDSLKLELHSLKEQSAATAKGEISEDLSNVVESMRRSFEEEKINF 1494
                  E  + LN +I  L+ E  + ++  A      I+ED  ++V++++  FE EK   
Sbjct: 1431 KIKSLTETVEMLNSKIQELEAEASNAQKIVAEHHTPVINEDTKSIVDNLKTEFEAEKEQL 1490

Query: 1495 XXXXXXXXXXXXXXXHTLQVNGNEPQ------------------------QQP---VNYE 1527
                                N  E +                         QP   ++ +
Sbjct: 1491 IKDKEKELRSKFEAEKESAWNSREEELRKQFEEREKRIREECEKTTVQSPSQPTLDIDID 1550

Query: 1528 EIKRQWESEQEESILKRIAEAEENLKKRIRLPTEERIKQVVXXXXXXXXXXXXXXXXXXX 1587
             +K +WE E E+  L++I  AEE LKKRIRLPT+++I ++V                   
Sbjct: 1551 ALKNEWEKEYEKQTLEKIKLAEEALKKRIRLPTQQKIDKIVEARKAVLEESFEEKVNEKA 1610

Query: 1588 XXXXXXDGNNSXXXXXXXX-------XXXXXFEAEVQAVKKKAFEEGKQQAAMKSTLLER 1640
                   GN++                    FEA++  +K+K+FEEGKQQ ++K   LE 
Sbjct: 1611 QKLAGEIGNDAITLEKHRAELNALKDSMRKQFEADLAEIKQKSFEEGKQQVSLKLKFLES 1670

Query: 1641 KISKLESQ 1648
            KI  LE Q
Sbjct: 1671 KIRNLEQQ 1678

>AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKR095W (MLP1) and
            YIL149C (MLP2)
          Length = 1758

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 572/1730 (33%), Positives = 930/1730 (53%), Gaps = 114/1730 (6%)

Query: 20   DVSLGKLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTIDEIKTVSSKR 79
            +V   +L+A  G+ + Q+  +   ++  L  +   F +L+++N RL V+I   ++     
Sbjct: 15   EVDYSRLAARLGLEQGQVQQLGEQLVRTLWGREQAFRQLEAENTRLKVSIGAAESACEHG 74

Query: 80   EEGLKNEIENLMKDNDSIRLERSQAQEESTQSSRD-----KQKIQNEVESLQEKLSDLDQ 134
             E L+   + L  +  +    + + Q E+  + R       +++Q ++E  + +++  D 
Sbjct: 75   VEALRERQQQLAAEAGA----QQRGQGEAGSAGRAGGPSVPERVQQQLEETERRVAAGDS 130

Query: 135  ERETLKQDKREVVAVLEEKIKELESFRTESRKSLDDSKRLRQQVLELETTVQNLKSKELR 194
             R       R++  +LEEKI +L++ + E  + L  +K LR+  +ELE TVQ+ +S+ LR
Sbjct: 131  AR-------RDLARLLEEKISDLDASQQELERVLGVNKELRRHEMELEFTVQSQRSQSLR 183

Query: 195  DQSEIQTITQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDRLTSESLSCKNELQL 254
            +Q+EIQ + Q L +++ N++W   ++  K +QL S R K + E+     E    KNEL++
Sbjct: 184  EQAEIQRLQQELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQVELNIVKNELEV 243

Query: 255  EKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLENQVKS 314
            E +    + +KN EL+K LQ+ L E K L+DSL+ EKQEFA EM++KQ+LI+LL  QV +
Sbjct: 244  EHANVAALRSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQVAT 303

Query: 315  LQGELNASLDKDNVELLASGERNTENEKLIQELITXXXXXXXXXXXXXXXXXXXXXXIPG 374
            ++ +L  + D         G  ++E E+L+ +L                        +  
Sbjct: 304  MKQDLEKAYDVAK----NGGMSDSERERLLNDLFDTKKKLELSQANVSRLEDTIKELLET 359

Query: 375  DDSQDDINNTSSFISLRNKDSS------LRDMGILKKELIKERHQKERLQRQVESFIVEL 428
            D+ Q    N     ++ +            D+  L+K+L++ER  KE LQ QVESF+VEL
Sbjct: 360  DNVQSGGRNGIEHANVGSPSGGSTISTVYGDLAALRKQLVQERRHKEELQLQVESFVVEL 419

Query: 429  EYKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIHTLT 488
            E+KIPV+NSFK+R   LEK+LN V LLL+ T+ E++++  + +    KV D E+ +  L 
Sbjct: 420  EHKIPVLNSFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYETQVGHLV 479

Query: 489  RQRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDDPNSESDSQRVISERLVE 548
            +QR+DLA QVQ LL++ISV+ DS G L+AEEV F+K++ +  D  + SD+Q +IS RLVE
Sbjct: 480  QQRSDLARQVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATGSDTQAIISNRLVE 539

Query: 549  FNNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQDYNAN 608
            F ++  LQ+KN ELL  +R+LA+KLE EE     K+++ E +T+ EAKEAI+SLQ++   
Sbjct: 540  FKSVVELQQKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAILSLQEHVQM 599

Query: 609  LESKVEILTKECDAFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLEARLTSLTV 668
            LE ++E +T E D+FK + S     +N SL               + +  LEARL ++  
Sbjct: 600  LEDQLETVTTERDSFKLLVSEG---KNNSLPNPVGAAALQPQEVADGIAHLEARLKAMAE 656

Query: 669  ESSQNNKMLNNEIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQLVK 728
            ES Q+ KMLN EI  LY+S +Q++IELE+ERSS+ L +E+L LIQ +LEL + EN  L  
Sbjct: 657  ESEQHAKMLNEEIKALYKSNSQLAIELERERSSRELADEKLSLIQKSLELVKGENADLQN 716

Query: 729  RSQNLQSIFDRQDSRTAETVNELIACNSKLAVLETKVANLETEKELLQSSERTSRENYLK 788
            R+ +LQ++   QD+R   T+ E ++  S+L  + +++  L++E++ L+  E   ++    
Sbjct: 717  RAGSLQALLLEQDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVEADLKKENES 776

Query: 789  LSEERNSLRIMVSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLDAKTKEAED 848
            L+++ N  ++++ QL+T Q ER+  ++E +  Y+  ++ L+ E +  + +L+ K +E ++
Sbjct: 777  LNKDNNDSQLLILQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQLERKQREYDE 836

Query: 849  MENSKRTQIQWYQDKLDSVVAESQHLKQELQTKT----FLVTDLESEVRKLEKQVEESEA 904
            + +S  TQ +W+Q KLDS+  E    K  L+ KT     L   L S   KLE    + + 
Sbjct: 837  LSSSSSTQCKWFQSKLDSLKEELGSSKLALKAKTSELDALKARLNSSTSKLEPASMDHQ- 895

Query: 905  RIQSYQVLSGSEVETSPESSLRKELEKTKINLSDTYAEIDQYK--NXXXXXXXXXXXXXX 962
              QS  VL       S   SL K+L++    LS  Y+EI++YK  +              
Sbjct: 896  --QSSLVLESDHA--SRVQSLSKDLDEANRKLSSAYSEIERYKAASNATERPSLSYNAVQ 951

Query: 963  DYASGKQELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKKIA 1022
            D   G ++  +   +L+ E ++L   +A  N+ +  LE+ L         E++ LQ+KI 
Sbjct: 952  DNKDGSKQAAI---SLEAELTKLNSDIAMANDRIKVLEDELNRREATYSTERSELQEKIN 1008

Query: 1023 TLETESKGSHQLKEEYDAQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISELRE 1082
             L T+ +   + K +Y  +I +LQ DLE+Q S  N A+  Y+  LQK + +S+ I  LR+
Sbjct: 1009 ALVTDKQRIEEAKADYQQKITQLQTDLEKQISSTNEAETKYQTALQKQAEISENIESLRK 1068

Query: 1083 QSQKDRIAITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSLLYD 1142
             S+  +  I + K++ E+ R+VLE+NE++W  QK + E  L+ + Q +E+LSTQN LLYD
Sbjct: 1069 SSESYKSEIAKFKSAAEEARKVLERNEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYD 1128

Query: 1143 QIELFSKDNSDGVNGET---AEVREILTNLRRERDILGTKLTVSQREEQTLRGSLASVEN 1199
            QIEL S+  S  +  +T   ++ RE++  LRRERDIL TK+ VS+REE+ LR  L   ++
Sbjct: 1129 QIELLSRSPSSSLEPDTKISSDARELIVTLRRERDILETKIDVSKREEKMLRQRLELTKS 1188

Query: 1200 ELDTTKRQLSQFQKEITTHSELIGQHEKIIEQLNQLNLLRESNITXXXXXXXXXXXXXXX 1259
            ELD  + QLS+ +  +T  ++     E++ E+LNQLNLLRE N++               
Sbjct: 1189 ELDNLRAQLSESKGLVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNESEKVSEHNEFL 1248

Query: 1260 XXXXXXXXXXILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPED 1319
                      + P+E ++ +L  ++ EK+Q+L L KEE++RWK+RSQ+ILHK++RIDPE+
Sbjct: 1249 QNEILSLQEKVQPMEEQIKSLTATLTEKEQKLALLKEESDRWKQRSQDILHKYERIDPEE 1308

Query: 1320 HKELKEKVSILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREA 1379
            +++L  ++ +L+ +L+  + E+ +  +RF +L+KQA+E+L+  K A+  + ++L      
Sbjct: 1309 YRKLASEIEVLKAELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKVESELELALSG 1368

Query: 1380 KSELEGKFEAEERKVHELQERLN---AHGND---TETVESVQKELSDALEHSRELEQNLS 1433
            KS+LE K      K+  L+ +L    A  +D   +  +E  + +L DA      L+   S
Sbjct: 1369 KSQLEAKLSEAREKITSLETQLTERPASEDDNPVSHELEETKTKLQDAENTINMLKSEWS 1428

Query: 1434 ATLQQNEEITKKLNDEIDSLKLELHSLKEQSAATA-----------KGEISEDLSNVVES 1482
             +    EE  KK   ++D L  +L ++++ SA ++              + ED    VE 
Sbjct: 1429 IS----EESFKK---QLDELNKQLETIQKNSAPSSGHSDPSSYHEQPTAVLEDFKKQVEE 1481

Query: 1483 MRRS------------FEEEKINFXXXXXXXXXXXXXXXHTLQVNGNEPQQQPVNYEEIK 1530
             RR+             E  + NF                 + V          N E +K
Sbjct: 1482 ERRTLIESHQQELTARLEASRKNFLAEKEKALEELRDSLTNVSVEAASQ-----NLEALK 1536

Query: 1531 RQWESEQEESILKRIAEAEENLKKRIRLPTEERIKQVVXXXXXXXXXXXXXXXXXXXXXX 1590
            ++WE E E+  L+RI EAEE LKKRIRLP+EERI QV+                      
Sbjct: 1537 KKWEEEYEQQTLQRIREAEEALKKRIRLPSEERINQVIERKQKALEQEFTTKVNATALAL 1596

Query: 1591 XXXDG------------NNSXXXXXXXXXXXXXFEAEVQAVKKKAFEEGKQQAAMKSTLL 1638
               +             ++              FE ++  VKKKAFEEG+QQ  MK  LL
Sbjct: 1597 LKENPDSIASDKADLIKDHQKEIVQLKKDLADKFEGQLVQVKKKAFEEGRQQGIMKVKLL 1656

Query: 1639 ERKISKLESQLHGKXXXXXXXXXXXXXXXXPNLPSKID-EKSVTTNQSVP 1687
            E KISKLESQ                     N+P+KI  E +    Q VP
Sbjct: 1657 ESKISKLESQAKAPLGT--------------NVPTKIPLENTQPLAQQVP 1692

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score =  709 bits (1829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 557/1682 (33%), Positives = 929/1682 (55%), Gaps = 66/1682 (3%)

Query: 13   TSGDNHNDVS---LGKLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTI 69
            T+  N N +S   + K+++F     D +  +D  IL  L N+  +FN ++++ ++++  +
Sbjct: 8    TTDSNKNPLSSATIAKVASFLDTSPDVVQTLDETILKSLNNRFDEFNHIENEQIKISTEL 67

Query: 70   DEIKTVSSKREEGLKNEIENLMKDNDSIRLERSQAQEESTQSSRDKQKIQNEVESLQEKL 129
            +  K  ++   + LKNE+  L+   +S+  E+  A ++  +    K   ++E+ES   ++
Sbjct: 68   EVTKKTNNTTIKKLKNELTELIDSYESVCKEKEDAYKKIAEEEEKKIDNRDELESKLIQI 127

Query: 130  SDLDQERETLKQDKREVVAVLEEKIKELESFRTESRKSLDDSKRLRQQVLELETTVQNLK 189
              L++    L+  K+E++  L+++I EL  +R       ++  + R ++L+LE   Q+LK
Sbjct: 128  HSLEENVSELQSKKQELIKSLDDRITELNEYRHNIELLNNEKSKTRNKILQLENENQDLK 187

Query: 190  SKELRDQSEIQTITQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDRLTSESLSCK 249
              +L  +++++ ++Q L  + K   WLEE +  K EQ  S R K+ +E   L  +  + K
Sbjct: 188  INDLSQRTQLERLSQELETINKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNTVK 247

Query: 250  NELQLEKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLE 309
            NEL   KS N V+  + +EL+  L++    +K++  S   +K     E+++KQ+LI +L+
Sbjct: 248  NELDQMKSTNCVLQERTDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQLIVVLQ 307

Query: 310  NQVKSLQGELNASLDKDNVELLASGERNTENEKLIQELITXXXXXXXXXXXXXXXXXXXX 369
            +Q+  LQ E    L     +  +S  ++++  + I +L                      
Sbjct: 308  SQLNELQRENGNELSLTVSDTASSSRKDSDFTREINDL-------KNQLNHVQERNVELE 360

Query: 370  XXIPGDDSQDDINNTSSFISLRNK-DSSLRDMGILKKELIKERHQKERLQRQVESFIVEL 428
              +   +    ++N++S   LRN    +  D+ +LKK+L  E+ Q+E  ++ +E F+ +L
Sbjct: 361  FKLRKSEDYTAVSNSTSSDDLRNSLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDDL 420

Query: 429  EYKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIHTLT 488
            E ++P + +++ R +  E+EL +  LLL+  + EK     E      +++  E  I  + 
Sbjct: 421  ETELPTLEAYRHRAAAREEELKEATLLLEKANKEKSLVSSELNQAQSRIQSIEQEIKLVA 480

Query: 489  RQRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDD--PNSESDSQRVISERL 546
            +QR+DLA+Q+QF L++ SV  DS G L+ EEV FI+ I+  DD   + E+D+Q+VISERL
Sbjct: 481  KQRSDLANQLQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISERL 540

Query: 547  VEFNNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQDYN 606
             +F +I  LQ+KNMELLKT R+LA KLE E+K    +    E +TI EAKEAI++LQ+YN
Sbjct: 541  TKFKDIIELQQKNMELLKTTRELATKLEEEDKIKQAEKSRIEEETIAEAKEAILTLQNYN 600

Query: 607  ANLESKVEILTKECDAFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLEARLTSL 666
            ++L +K+  LTKE + +K + +   S           Q     +   + ++ LE R+ S+
Sbjct: 601  SSLTAKIAALTKELETYKVLSNTEDSSTPADFDKQREQREIEHT---QLVKELETRIASI 657

Query: 667  TVESSQNNKMLNNEIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQL 726
              ES +N  +LN++I  L      ISIEL +E+S+K L EERLKL+Q ++++T  EN++L
Sbjct: 658  IQESKENANILNDKIFALDEKNNHISIELAREKSAKQLAEERLKLLQKSMDMTITENERL 717

Query: 727  VKRSQNLQSIFDRQDSRTAETVNELIACNSKLAVLETKVANLETEKELLQSSERTSRENY 786
             KR  +L+++   QD RT ET+N LI   S+LA +E K    + E +LL SSE   +   
Sbjct: 718  QKRLNSLRNVVVEQDKRTHETINSLIKTRSELATVENKWNVSQNEIKLLHSSEEMLKNEL 777

Query: 787  LKLSEERNSLRIMVSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLDAKTKEA 846
             +L+EE+NS++++V++LQTLQSERE  L   Q  + + L+ LE    D R +L    KEA
Sbjct: 778  TRLNEEKNSMKLLVTRLQTLQSEREHLLSTTQDKFNKELNDLEGTCNDLRKKL----KEA 833

Query: 847  ED-----MENSKRTQIQWYQDKLDSVVAESQHLKQEL---QTKTFLVTDLESEVR----K 894
            E+     ME +   +  + Q K        + LK+E+   + +   + + E E +    +
Sbjct: 834  EENYGSLMEETTELKDDFRQKK--------KSLKEEMSNVEKRYSEIVEKERETKWENTR 885

Query: 895  LEKQVEESEARIQSYQVLSGSEVETSPESSLRKELEKTKINLSDTYAEIDQYKNXXXXXX 954
            L KQ++E    I+ Y+  S  E +    SSL+KEL+  K  L+++Y++ + Y+       
Sbjct: 886  LTKQLKEKTELIEKYKAASDDEGKLEEISSLQKELQVLKNELTESYSQTESYRKDIELLN 945

Query: 955  XXXXXXXXDYASGKQELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEK 1014
                       + +   + ++  ++  K+ + D    L   +  L   L+   K  E+EK
Sbjct: 946  QSIADINKQVLNKEAAFKERITEVELAKNNIADSNTVLKTQIDDLNNELEVQKKLYEDEK 1005

Query: 1015 NTLQKKIATLETESKGSHQLKEEYDAQILKLQRDLEQQASFANRAQRNYEEELQKDSNVS 1074
                +    LE  +KG  Q K +Y+ ++  L +DLE+Q  +AN+AQ NYE+ELQ  +NVS
Sbjct: 1006 INFTRNANELERVTKGLEQSKRDYEDKLKSLMKDLEEQVKYANKAQNNYEQELQNHANVS 1065

Query: 1075 KTISELREQSQKDRIAITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLS 1134
            KTIS+LREQ+Q  R  I  L  S    +++L +N+ SW  Q++EYE+Q+E  ++ +E+ S
Sbjct: 1066 KTISQLREQTQHYRTEIAELTISATDAKRLLNENQISWQKQRDEYEKQIEFFKKRIEEES 1125

Query: 1135 TQNSLLYDQIELFSKDN------SDGVNGETAEVREILTNLRRERDILGTKLTVSQREEQ 1188
             QN +L++Q +L ++ N      S GVN    + + +L+ LR ERD+L  +L V++ EE+
Sbjct: 1126 EQNKMLFEQSKLTTQANDEDNAESSGVNSIEGDNKLVLS-LRSERDLLQERLNVTEAEEK 1184

Query: 1189 TLRGSLASVENELDTTKRQLSQFQKEITTHSELIGQHEKIIEQLNQLNLLRESNITXXXX 1248
             LR  L S+E +   T  +L + ++E   + +L+ QH+ ++ QL QL+LLRESNIT    
Sbjct: 1185 LLRERLTSIEKDFRATDLELQKIKEETHNYPDLLEQHKTVMSQLTQLDLLRESNITLRNE 1244

Query: 1249 XXXXXXXXXXXXXXXXXXXXXILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEI 1308
                                 +LPLE+EL TL   + EKD+QL++  EE+ RWK+RSQ+I
Sbjct: 1245 TIELQSKNQHLQTEVENLHDKLLPLETELQTLTNLIEEKDKQLSICHEESERWKQRSQDI 1304

Query: 1309 LHKHDRIDPEDHKELKEKVSILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTT 1368
            L K+ RIDP +H+ L E+ + L+ +L+E +KEN+EL +RF +LKKQAHEKLN+SKI+Q +
Sbjct: 1305 LSKYQRIDPVEHENLAEERNRLQAQLEEKSKENEELGNRFEKLKKQAHEKLNASKISQNS 1364

Query: 1369 LSNQLNELREAKSELEGKFEAEERKVHELQERLNAHGNDTETVESVQKELSDALEHSREL 1428
            L+ Q+N+L   K EL  + E E+     L++RL     ++  + S+Q +L +AL  S++ 
Sbjct: 1365 LTIQINDLEAKKKELLSQLETEKEGKLSLEKRLEVTMKNSHDIVSIQSQLEEALMKSKDF 1424

Query: 1429 EQNLSATLQQNEEITKKLNDEIDSLKLELHSLKEQ-------SAATAKGEISED-----L 1476
            E     +++ +++I + LN EI  L+ E   L+E+       ++ T  G + +D     +
Sbjct: 1425 ETKFINSVESSKQIEENLNSEIKKLQEESSKLQEELAHEKLTTSTTEIGNVDQDTVDGGV 1484

Query: 1477 SN-VVESMRRSFEEEKINFXXXXXXXXXXX-XXXXHTLQVNGNEPQQQPVNYEE--IKRQ 1532
            SN +VESM++SFEEEKI F                + L+      Q +PV+ +E  I++Q
Sbjct: 1485 SNDIVESMKQSFEEEKIKFIEEQTTEFKKKLQAEINKLKAEYETKQIEPVSIDENAIRKQ 1544

Query: 1533 WESEQEESILKRIAEAEENLKKRIRLPTEERIKQVVXXXXXXXXXXXXXXXXXXXXXXXX 1592
             E E E++  +RI EAEENLK+RIRLPTEE+I +V+                        
Sbjct: 1545 IEEEYEQATSQRIKEAEENLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARAKELLT 1604

Query: 1593 XDGNN---SXXXXXXXXXXXXXFEAEVQAVKKKAFEEGKQQAAMKSTLLERKISKLESQL 1649
             D  N                 +E E+Q VKKKAF+EG+QQ  MK++ LE+KI+KLES L
Sbjct: 1605 GDEKNEFFDRMKKEIQEELARKYEEELQVVKKKAFDEGRQQVLMKTSFLEKKITKLESDL 1664

Query: 1650 HG 1651
              
Sbjct: 1665 QN 1666

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1735

 Score =  523 bits (1346), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 522/1823 (28%), Positives = 908/1823 (49%), Gaps = 178/1823 (9%)

Query: 21   VSLGKLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTIDEIKTVSSKRE 80
            V+L  L+    V    L  I+  +L  +  K+L   + K    RLN TID  K+  S + 
Sbjct: 2    VNLNNLATSLEVTATDLETIEPTVLEKINAKLLSSEQEKD---RLNATIDNFKSKMSSQF 58

Query: 81   EGLKNEIENLMKDNDSIRLERSQAQEESTQSSRDKQKIQNEVESLQEKLSD-LDQERETL 139
            + +KN++E L K+ + +  ++ Q + +  Q   ++Q  Q++  S  +  SD + +E ET 
Sbjct: 59   DTVKNDLELLQKEKELLIQDKKQLESKCIQ--WEQQYAQHQDISKTDLASDDVIKENETF 116

Query: 140  KQDKREVVAVLEEKIKELES----FRTESRKSL---DDSKRLRQQVLELETTVQNLKSKE 192
            K+D + + + L    K+L S       +S   L   +D+  +R Q+   ++  + LKSK 
Sbjct: 117  KRDHQLLTSDLMNLSKKLSSCDAALEKKSTAYLELQNDNIDIRTQLNNFKSETKGLKSKY 176

Query: 193  LRDQSEIQTITQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDEL----DRLTSESLSC 248
             R   + + +    + ++   +   +E++  + +  + +  + +EL    D L   SL  
Sbjct: 177  ERKVKDFEELKNAYSSMKTYEETSRKELSEMSNKFYTLKTSSSNELRNAKDAL--HSLEK 234

Query: 249  KNELQLEKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLL 308
            + EL LE+  N+    +N ELT ++ ++L + K L + L   K+ F  EM++ Q   DLL
Sbjct: 235  QYELLLEE--NKAFKERNNELTTTVSDELFKKKSLENDLNELKESFTREMTLTQHENDLL 292

Query: 309  ENQVKSLQGELNASLDKDNVELLASGERNTENEKLIQELITXXXXXXXXXXXXXXXXXXX 368
            +  ++ L         K+  +    G    E ++L+ EL+                    
Sbjct: 293  KEHIEYL---------KNTTKETTGGTSTLEKDRLLHELV-------------------- 323

Query: 369  XXXIPGDDSQDDINNTS------SFISLRNKDSSLRDMGILKKELIKERHQKERLQRQVE 422
               I     + ++ N         +++   + +S  ++ +LK++LIKE+ QK+ LQ QVE
Sbjct: 324  --DIKKSLEKSELENVHLNDFIEQYLTENEESTSDNELVLLKEQLIKEKRQKDYLQEQVE 381

Query: 423  SFIVELEYKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSES 482
             F++ELE ++P +NS K+R   LE+EL  +  LL+ T  E + R +E    ++++K+   
Sbjct: 382  LFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETERESDIRIKELTTENRRLKEQTE 441

Query: 483  SIHTLTRQRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDDPNSESDSQRVI 542
            +I+ L  QR DLAHQVQFLL+N+ ++     LL+ +E++F+++I+ + +  ++SDSQ++I
Sbjct: 442  NINVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEITFLRKIIKSRNSQNDSDSQKII 501

Query: 543  SERLVEFNNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSL 602
            SERLV+F++I+ LQ++NMELL T R LAE+LES +    +KI      T  E+KE I  L
Sbjct: 502  SERLVKFHDISVLQKQNMELLTTTRNLAEQLESSDTKSVQKI------TRNESKEKIAKL 555

Query: 603  QDYNANLESKVEILTKECDAFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLEAR 662
            Q+    L SK+E L KE DA+K +  +N  +Q  +         +     EE+L  LE R
Sbjct: 556  QESINGLTSKLEKLQKEKDAYKLLSLQNTGEQTPTEELRSQLQKK-----EEQLTKLE-R 609

Query: 663  LTSLTVE-SSQNNKMLNNEIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRN 721
            ++SL    + +  K+LN  I +L + K  ++  + KE S + + E++ K+++ +LEL   
Sbjct: 610  MSSLDSHLAEEKAKVLNQSIIKLKKEKYDLNNAIIKETSQRAIAEKKSKMLEDSLELLHK 669

Query: 722  ENQQLVKRSQNLQSIFDRQDSRTAETVNELIACNSKLAVLETKVANLETEKELLQSSERT 781
            +    VK+ ++ +++ +  ++   +   E     +K+++L+ ++ + +  + LLQ S+  
Sbjct: 670  KYDLAVKKYEHYETLLNDHNAENIKHSRENETTQAKISILQKEIESYK--QNLLQYSK-- 725

Query: 782  SRENYL-KLSEERNSLRIMVSQLQTLQSEREK---FLKEIQTTYKENLDSLEQEKADARA 837
              EN L KL+        + S+L T+++E E+    ++E +T YKE+    E+    ++ 
Sbjct: 726  DNENTLSKLAAATQEKETLGSRLSTVKNELEQKINLMQERETYYKEHDSISERLLKKSKI 785

Query: 838  RLDAKTKEAEDMENSKRTQIQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEK 897
            +L+ K KE +D E  K +QI WYQ +LDS+   +  L+ EL  +   +     ++  LEK
Sbjct: 786  QLEDKIKEVKDFEAKKNSQINWYQKRLDSLTTTNDKLQVELNKELTKINIQRLKISDLEK 845

Query: 898  QVEESEARIQSYQVLSGSEVETSPESSLRKELEKTKINLSDTYAEIDQY----------K 947
                          LS +   +S    + ++ EK K  L +   EI+QY          K
Sbjct: 846  -------------TLSQNTNGSSSLPRVDQDFEKLKNELKEKQLEINQYRDLLNLAEETK 892

Query: 948  NXXXXXXXXXXXXXXDYASGKQELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQDAN 1007
            N              D   GK++L  Q+  L  E S +  ++ K        ++ +QD  
Sbjct: 893  NRLQKDLNKQRQIVDDAMEGKEQLDQQLAELTQECSSMNSLLQKQKAKCEDDQKIIQDKA 952

Query: 1008 KAAENEKNTL---QKKIATLETESKGSHQLKEEYDAQILKLQRDLEQQASFANRAQRNYE 1064
               EN KN+L   + KI TLE E                     +E+  SF  + +  Y+
Sbjct: 953  TETENLKNSLSSLENKITTLENEM--------------------VEKTKSFEEK-ENTYK 991

Query: 1065 EELQKDSNVSKTISELREQSQKDRIAITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLE 1124
            E+L K S  S  I ++  +++  + ++  LK +       +    +    +K  +E Q++
Sbjct: 992  EQLHKLSESSTLIEKMEAENKAYKTSLDGLKANIAAYEDAISAYRQKLLDEKFNHELQVD 1051

Query: 1125 TSRQHLEDLSTQ-------NSLLYDQIELFSKDNSDGVNGETAEVREILTNLRRERDILG 1177
              ++ +++L+ Q        S +  +    S D  + V  +T++  E++  LRRERD L 
Sbjct: 1052 EFKETIDNLNFQIHIQKGKRSFITSEGSTTSNDTDETVVNDTSDKNELILALRRERDGLD 1111

Query: 1178 TKLTVSQREEQTLRGSLASVENELDTTKRQLSQFQKEITTHSELIGQHEKIIEQLNQLNL 1237
             KL +SQRE  +LR  + +++N LD T++     + E++       QH++ ++QLN+LN 
Sbjct: 1112 IKLDISQREVYSLREQVENLKNSLDETRQSFKGLESEVSGEMTTTEQHKEAVKQLNELNT 1171

Query: 1238 LRESNITXXXXXXXXXXXXXXXXXXXXXXXXXILPLESELNTLHTSVLEKDQQLNLYKEE 1297
            L+E+N                           + PL+ ++  L  S++EKDQQL L  EE
Sbjct: 1172 LKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVERLKNSIMEKDQQLTLLSEE 1231

Query: 1298 ANRWKERSQEILHKHDRIDPEDHKELKEKVSILETKLDETNKENKELDDRFNRLKKQAHE 1357
              RWK RS+EIL K  ++D E+H +L E++S L+T+LD   K+N++L+DRFNRLKKQAHE
Sbjct: 1232 NERWKLRSREILMKRQQVDLEEHNKLMEELSTLKTQLDTKTKDNEDLNDRFNRLKKQAHE 1291

Query: 1358 KLNSSKIAQTTLSNQLNELREAKSELEGKFEAEERKVHELQERLNAHGNDTETVESVQKE 1417
            KL+++K    +L+ ++ +L +AKS+LE   + E +++ E++ +L    ++ + + +++KE
Sbjct: 1292 KLDAAKAQNASLTAEITDLIDAKSKLEIDLDEERKRIQEVESQLKQKPDNPDVITALEKE 1351

Query: 1418 LSDALEHSRELEQNLSATLQQNEEITKKLNDEIDSLKLELHSLKEQSAATAKGEISEDLS 1477
            LSD++E+S+++E+NL  T+  + E+ KKL +E++SLK +L +LK Q+   +  + S   S
Sbjct: 1352 LSDSVENSKKIEENLQETVNSSLELNKKLTEEVNSLKSQLETLKNQNGVISVADGSAINS 1411

Query: 1478 NVVESMRRSFEEEKINFXXX-------XXXXXXXXXXXXHTLQVNGNEPQ--QQPVNYEE 1528
              +  ++ SFE EK                            +   ++P    +P++ E+
Sbjct: 1412 ETIAHLKESFEVEKTELITTLKEEFKKQLEEEKKKLLEEKEKEYYDSKPTGGSEPIDIEK 1471

Query: 1529 IKRQWESEQEESILKRIAEAEENLKKRIRLPTEERIKQVVXXXXXXXXXXXXXXXXXXXX 1588
            +K +WE +QEE I++RIA+AEENLKKRIRLP+EE+I +V+                    
Sbjct: 1472 MKSEWEEKQEEIIMQRIADAEENLKKRIRLPSEEKINRVIEKRRKELEEEYEKKLKRQGL 1531

Query: 1589 XXXXXDGNNSXXXXXXXXXXXXXFEAEVQAVKKKAFEEGKQQAAMKSTLLERKISKLESQ 1648
                                   F+ E+  VKKKAF EGKQQ+ MK+TLLERK+SKLESQ
Sbjct: 1532 TTET--AIEEELRKEVERELRVKFDNELAEVKKKAFLEGKQQSQMKTTLLERKLSKLESQ 1589

Query: 1649 LHGKXXXXXXXXXXXXXXXXPNL---PSKIDEKSVT---TNQSVPNPLVSGEKVLK---- 1698
                                      PSKI+    +   T+ S+   +  GEKVL+    
Sbjct: 1590 ASPSRTPDLESSQKENTEGATKTTLGPSKINLLPFSMSNTDDSIEKQVPQGEKVLQINRR 1649

Query: 1699 -LDPSKXXXXXXXXXXXXXXXXXPQNNDTMGTSAFGFKPTFTLSNNSN----KSSGTKID 1753
             L+PS                    N  T+ T     KP F  ++N++    K  G  I+
Sbjct: 1650 SLEPS----------------FGSSNPFTLPTQN---KPAFLFASNNHSQTKKQDGLPIN 1690

Query: 1754 SSSTENKPANPFSSFTETGASSP 1776
             S  +     PFSS T T   +P
Sbjct: 1691 KSPFQTTLFAPFSSKTTTPNGTP 1713

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1820

 Score =  494 bits (1273), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 398/1196 (33%), Positives = 676/1196 (56%), Gaps = 55/1196 (4%)

Query: 400  MGILKKELIKERHQKERLQRQVESFIVELEYKIPVINSFKERTSMLEKELNDVALLLDHT 459
            + +LKK++ +E+ +K+ LQ Q+ESFI+ELE KIP+I+SF+E+   LE EL ++ LLL+ T
Sbjct: 365  INLLKKQVTQEKLEKKHLQTQIESFIIELENKIPIISSFQEKNQALENELTNLTLLLNKT 424

Query: 460  SNEKEKREREFEALSKKVKDSESSIHTLTRQRTDLAHQVQFLLMNISVQVDSGGLLSAEE 519
            SNEK   + +      K+   +S+I  L RQR DLA+QV+ LL+ ++V+ DSGG L+ EE
Sbjct: 425  SNEKNTIQNKLNNYDSKLLTYQSNIKELIRQRLDLANQVKHLLLFVAVKNDSGGPLTREE 484

Query: 520  VSFIKRIVNN--DDPNSESDSQRVISERLVEFNNIATLQEKNMELLKTVRKLAEKLESEE 577
            + FI +I NN  D   SE  SQ VISERLV F+NI  LQ KNMELL ++R L+E LE+ E
Sbjct: 485  IEFINKISNNSEDLNGSELTSQHVISERLVTFSNIEELQAKNMELLNSIRSLSENLENIE 544

Query: 578  KDVNKKIQTFENDTIKEAKEAIVSLQDYNANLESKVEILTKECDAFKAICSRNGSDQNGS 637
               + K   F+N TI +AKEAI++LQ +N  LESKV++L  E D+FK + + N S  + S
Sbjct: 545  NANSHK--EFQNKTIADAKEAILTLQYHNDILESKVKVLEAERDSFKLLLNNNVS-IDSS 601

Query: 638  LSANGTQGNRNGSSDEEKLRTLEARLTSLTVESSQNNKMLNNEIHELYRSKTQISIELEK 697
            +  +    + +  ++E+ +  L+  +  L  E  +N   L ++I      K+ ++I LEK
Sbjct: 602  IKNDDLSSSTSPETNEKSIEKLQTLIEELKAELKKNKDALESQIASFTADKSNLTISLEK 661

Query: 698  ERSSKTLTEERLKLIQHTLELTRNENQQLVKRSQNLQSIFDRQDSRTAETVNELIACNSK 757
            E+SS TL  E++ L +   ++ + EN++L KR +NLQ+I  +Q+S+  + +N+ I   ++
Sbjct: 662  EKSSNTLMAEKISLTESAFDMLKTENKELNKRFENLQNIIIKQESKLGDIINKYITGETE 721

Query: 758  LAVLETKVANLETEKELLQSSERTSRENYLKLSEERNSLRIMVSQLQTLQSEREKFLKEI 817
            ++ L+T+++  ++EK+ L  S+ +     +K SEE+N LRIM+SQLQ+LQ+ER   L + 
Sbjct: 722  ISNLKTQLSIAKSEKDFLVKSQDSLNSELIKTSEEKNKLRIMLSQLQSLQNERMTLLDDT 781

Query: 818  QTTYKENLDSLEQEKADARARLDAKTKEAEDMENSKRTQIQWYQDKLDSVVAESQHLKQE 877
            Q  +   +  LE    D    L +K  E + +  S  +Q  WYQ+ +D +   +  +K E
Sbjct: 782  QKKFMSKIHELENNNLDLIKNLGSKMTEIQKLSISNESQCTWYQNTIDDLKKINSAIKTE 841

Query: 878  LQTKTFLVTDLESEVRKLEKQVEESEARIQSYQVLSGSEVETSPE--SSLRKELEKTKIN 935
            L +K  L++DL +++  LE          QSY + + +   +S    S + K+L+ TK++
Sbjct: 842  LTSKNSLISDLNTKIELLES---------QSYTIDTNTRCSSSGNDFSQISKDLDITKLH 892

Query: 936  LSDTYAEIDQYKNXXXXXXXXXXXXXXDYASGKQELQLQVETLQNEKSQLQDVVAKLNES 995
            LS+ Y ++++YK               ++ S K  +  ++  L +E   L+    + ++ 
Sbjct: 893  LSEAYTQVEEYKQLYTSTEESLKTLESNFESVKNLMDDKISKLLSENETLKASTGEYDKR 952

Query: 996  VTKLEESLQDANKAAENEKNTLQKKIATLETE-------SKGSHQLKEEYDAQILKLQRD 1048
            +++L   L+       NEKN   ++IA L  +        K S     EY+ +I KLQ  
Sbjct: 953  ISELSTDLK-------NEKNKYSEEIAQLNVQITRLNKFKKDSADTASEYEEKISKLQSQ 1005

Query: 1049 LEQQASFANRAQRNYEEELQKDSNVSKTISELREQSQKDRIAITRLKNSEEQVRQVLEQN 1108
            LE +A FA+ AQ  YE  L KD+   ++I E +EQ +K    I  +++  E+   +L +N
Sbjct: 1006 LELKAKFADNAQEKYESLLTKDNANLQSIEEFKEQIEKLNQRIVIIESDLEKKTSLLSEN 1065

Query: 1109 EKSWSAQKEEYERQLETSRQHLEDLSTQNSLLYDQIELFSKD-NSDGVNGETAEVREILT 1167
            E  W  +++ +   LE S++ +++L+ QN L  DQ+EL +KD +S   +  ++E + +  
Sbjct: 1066 ESLWKKKQDAFISDLEESKKKIDNLTNQNKLYVDQLELLNKDFSSMDSSQLSSETKHMFN 1125

Query: 1168 NLRRERDILGTKLTVSQREEQTLRGSLASVENELDTTKRQLSQFQKEITTHSELIGQHEK 1227
             LR +RD+L TKL++++R+ +     L S+ +EL   + +L   + ++  HS+LI  HEK
Sbjct: 1126 RLRADRDVLETKLSIAERDSKNNASKLESLRDELANVQMKLISSENKLLRHSDLIENHEK 1185

Query: 1228 IIEQLNQLNLLRESNITXXXXXXXXXXXXXXXXXXXXXXXXXILPLESELNTLHTSVLEK 1287
            I+ +LNQ+ L +ESN T                         +  L  EL ++  S+ +K
Sbjct: 1186 IVSELNQITLFKESNETLRNQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVKESLGDK 1245

Query: 1288 DQQLNLYKEEANRWKERSQEILHKHDRIDPEDHKELKEKVSILETKLDETNKENKELDDR 1347
            +  + L KEE+N+W+ R++E+  + D++D +   +L  ++  L+   +   K+N EL++R
Sbjct: 1246 ETDIMLIKEESNKWRLRAEELSVQIDKVDLDSVSKLSTELDALKDDAETKRKQNAELEER 1305

Query: 1348 FNRLKKQAHEKLNSSKIAQTTLSNQLNELREAKSELEGKFEAEERKVHELQERLNAH-GN 1406
            FN LKKQAHE+LN+SK  Q++L+ Q+NEL+ + + +E    +E++K  +LQ  L+ +   
Sbjct: 1306 FNLLKKQAHERLNASKEIQSSLNKQINELKASNTNIELALSSEQKKSMDLQNTLSDNEVK 1365

Query: 1407 DTETVESVQKELSDALEHSRELEQNLSATLQQNEEITKKLNDEIDSLKLELHSLKEQSAA 1466
             T+ + +++ EL  AL+      +N S  L   +E   +L DE+DSLK  L  ++ QS  
Sbjct: 1366 YTQKLSNIESELK-ALKT-----ENNSFKLSSEKE-KMELTDEVDSLKKSL--VEAQSKL 1416

Query: 1467 TAKGEISED--LSNVVESMRRSFE------------EEKINFXXXXXXXXXXXXXXXHTL 1512
            +A G  S D  ++ ++ESM++ FE            E +  +                 L
Sbjct: 1417 SAIGSDSTDSTMNAMIESMKKEFEEEKLKLLEDKTNELEAQWKLEKDKLLKEYEEKIEDL 1476

Query: 1513 QVNGNEPQQQPVNYEEIKRQWESEQEESILKRIAEAEENLKKRIRLPTEERIKQVV 1568
            Q    +   +   ++ +K++WE E E++ L+RI EA+E LKKRIRLP+E +I +V+
Sbjct: 1477 QSARTDQSIKIEEFQSLKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINRVI 1532

 Score = 58.9 bits (141), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/38 (73%), Positives = 34/38 (89%)

Query: 1612 FEAEVQAVKKKAFEEGKQQAAMKSTLLERKISKLESQL 1649
            FE ++   KKK+FEEGKQQ++MK+TLLERKISKLESQL
Sbjct: 1585 FENDLNEAKKKSFEEGKQQSSMKTTLLERKISKLESQL 1622

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  453 bits (1166), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 449/1591 (28%), Positives = 812/1591 (51%), Gaps = 168/1591 (10%)

Query: 25   KLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTIDEIKTVSSKREEGLK 84
            K+S +  VP   L  ++  IL  L  ++  F   + +  RLNV IDEIK+    R   L 
Sbjct: 4    KISEYLHVPSKSLQGVNYSILRALCKRIDKFERSEEEVTRLNVLIDEIKSQYYTRISKL- 62

Query: 85   NEIENLMKDNDSIRLERSQAQEESTQSSRDKQKIQNEVESLQEKLS-DLDQERETLKQDK 143
            NE+               ++ EE   S ++  ++ N +++ + K +  +D   + L   K
Sbjct: 63   NEL-------------LGESSEEKNVSKKELSRLHNLLKNERSKCARKIDALNKQLNASK 109

Query: 144  REVVAVLEEK-IKE-LESFRTES------RKSLD-DSKRLRQQVLELETTVQNLKSKELR 194
              +  + +E+ +KE  E  + E       R +L  ++K LR+++LE+E  +Q  KS  L 
Sbjct: 110  NTITKLNDERGVKEEAEVLKAEHQNNDLERSALGHENKLLRRKLLEMENILQTCKSNTLS 169

Query: 195  DQSEIQTITQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDRLTSESLSCKNELQL 254
             + +  T+ Q   ++ +N +W+EE+++ + E+ +         +  L  +    +N+ + 
Sbjct: 170  LKLKYDTVVQEKELILENKKWMEEQLSFRDEKTLVDDVTRTSHVQNLEEQLNRTQNDYES 229

Query: 255  EKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLENQVKS 314
              + NQ +  +N++L+ S+++K++E+K+L D++  EK +F+ EM++++ + DLL +Q+ S
Sbjct: 230  VSTNNQFLLAQNKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTS 289

Query: 315  LQGELNASL---DKDNVELLASGERNTENEKLIQELITXXXXXXXXXXXXXXXXXXXXXX 371
               E N SL   +KDN +      +N+++  ++ +LI                       
Sbjct: 290  F--EKNYSLSAREKDNDDPC----KNSQHANVVDKLIDTKLQLEKSKDECQRLQNIVADC 343

Query: 372  IPGDDSQDDINNTSSFISLRNKDSSLRDMGILKKELIKERHQKERLQRQVESFIVELEYK 431
            I  D++  D  NT +     NK  S  D+  LK++LIKER+QK +LQ Q+ESFI ELE K
Sbjct: 344  IEEDEAAFD--NTHNVDPSVNKVFS--DIKALKRQLIKERNQKFQLQNQMESFIKELERK 399

Query: 432  IPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIHTLTRQR 491
             P + SFKERT  LE+EL +   LL+  S  K K E+E  +L +K+ + E++IH+L +QR
Sbjct: 400  TPELISFKERTESLEQELKNSTDLLETISLAKRKDEKELTSLRQKINNCEANIHSLVKQR 459

Query: 492  TDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDDPNSESDSQRVISERLVEFNN 551
             DLA QV+ LL+NIS        LS +E+  +K+++ + D  +E DSQ +I+ERLVEFNN
Sbjct: 460  LDLARQVKLLLLNISAVQKKASPLSNDELISLKKLLESGDVPNEKDSQIIITERLVEFNN 519

Query: 552  IATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQDYNANLES 611
               LQEKNMELL  VR LA+KLE+ E   +K +   EN TIKEAK+AI+ L+  N+ LES
Sbjct: 520  TNELQEKNMELLNCVRVLADKLENHEGKQDKSLAKLENQTIKEAKDAIIELEHVNSTLES 579

Query: 612  KVEILTKECDAFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLEARLTSLTVESS 671
            +++IL++E D++K + S NG      + A+    N+  +++ +K++ LE+ L+   VE+S
Sbjct: 580  RIDILSRERDSYKLLASANG----NKIYADA--ANKTEAANLKKIKELESELSLTKVENS 633

Query: 672  QNNKMLNNEIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQLVKRSQ 731
               + LN E+    +S++   I L++  + K L  E+  L+Q               R  
Sbjct: 634  AVVQRLNKELLTCKKSQSNGQIALQEFSNFKVLAIEKENLLQ--------------TRID 679

Query: 732  NLQSIFDRQDSRTAETVN--------ELIACNSKLAVLETKVANLETEKELLQSSERTSR 783
            +L++  ++Q S    +++        EL    +K   L  +++NL  +   L+  + +  
Sbjct: 680  DLKTKLEKQRSSAPSSIHGSIGSEETELSQYKNKTKSLMCEISNLSKKNTDLRCMKESLT 739

Query: 784  ENYLKLSEERNSLRIMVSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLDAKT 843
             +  +  +E+  L++ +++ +T  +E++      Q  Y   + +LE+   +   RL +K 
Sbjct: 740  RDLERCCKEKMQLQMKLTESETSHNEQKLKSDSKQVQYNTKIKNLEKNCEELNNRLHSKV 799

Query: 844  KEAEDMENSKRTQIQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVEESE 903
            +E E ++ SK +Q++W Q+ +D      + L  +L  K   +  L  E++ LE  +E  +
Sbjct: 800  QEIETLQTSKNSQLKWAQNTIDDTEKNMKSLSTDLSEKKTTIRKLSLEMKDLE--IELQK 857

Query: 904  ARIQSYQVLSGSEVETSPESSLRKELEKTKINLSDTYAEIDQYKNXXXXXXXXXXXXXXD 963
             ++Q Y++L+ S    + E++L+KELE+++I+L D +++I+ Y+                
Sbjct: 858  TKLQ-YKLLNNSSDANTLETALKKELERSQIDLKDAHSQIEAYE---------------- 900

Query: 964  YASGKQELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKKIAT 1023
                        E +  +++ L++    LN+ +TK +E L+  +++ + E N  +++I+ 
Sbjct: 901  ------------EIISTDENTLKE----LNDQLTKTKEELKVKSQSLDEENNAKEEEISF 944

Query: 1024 LETESKGSHQLKEEYDAQILKLQRDLEQQASFANRAQR---------------------- 1061
            L  E      L+ +     L+L   ++Q     N+ QR                      
Sbjct: 945  LRRELDEIRGLQPKLKEGALRL---VQQSEKLGNQTQRIQAMNEKIDKMTTIVELHQEVE 1001

Query: 1062 --NYEEELQKDSNVSKTISELREQSQKDRIAITRLKNSEEQVRQVLEQNEKSWSAQKEEY 1119
               Y+ +L+ + ++S  +  L  +    +  + + K+S    +++L+++E+ W  +K +Y
Sbjct: 1002 TSQYQAKLKANKDLSALVLRLENEVLDYQTELKKTKSSLHSTQELLDKHERKWMEEKADY 1061

Query: 1120 ERQLETSRQHLEDLSTQNSLLYDQIELFSKDNSDGVNG--ETAEVREILTNLRRERDILG 1177
            ER+L ++ +  E L  +NS L ++I+    D +   NG  E  ++  + ++LR ER+ L 
Sbjct: 1062 ERELISNIEQTESLRVENSALVEKID----DGTGENNGDKEYLKLVSLFSSLRHERNTLE 1117

Query: 1178 TKLTVSQREEQTLRGSLASVENELDTTKRQLSQFQKEITTHSELIGQHEKIIEQLNQLNL 1237
            TKLT  +R+    +   A++E  ++  ++     +K++   +++I + E I++++ Q+N+
Sbjct: 1118 TKLTTCKRDLALAKQKNANLEKSVNDMQQTHLVSRKDVQCSTDIIDEFEDIMKEIAQVNI 1177

Query: 1238 LRESNITXXXXXXXXXXXXXXXXXXXXXXXXXILPLESELNTLHTSVLEKDQQLNLYKEE 1297
            L+E+N                           I  L+ +L      V     ++ +Y+ E
Sbjct: 1178 LKENNTILQKSLKKVTEKNEAIYKEHTSLQYEISQLQGDLAQTKEQVSVNANKVLVYESE 1237

Query: 1298 ANRWKERSQEILHKHDRIDPEDHKELKEKVSILETKLDETNKENKELDDRFNRLKKQAHE 1357
              +WK+R   +  +      ++ ++L  ++S L+ KL      N +L+D+FNRLKKQAHE
Sbjct: 1238 IEQWKQRYDNLSQQQKETHKDETEKLFNEISDLKAKLLNAQNANADLNDKFNRLKKQAHE 1297

Query: 1358 KLNSSKIAQTTLSNQLNELREAKSELEGKFEAEERKVHELQERLNAHGNDTETVESVQKE 1417
            KL++SK  QT L+N+++EL++ K+ELE    +EE KV EL+ +L  H    E V      
Sbjct: 1298 KLDASKKQQTALTNEVDELKDMKNELEESLHSEESKVLELEAKLKKHLVQAEGVSK---- 1353

Query: 1418 LSDALEHSRELEQNLSATLQQNEEITKKLNDEIDSLKLELHSLKEQSAATAKGEISEDLS 1477
                                Q E+ +K L +EI+ LK EL   KE S          D S
Sbjct: 1354 -------------------DQEEDTSKPLMEEIELLKRELQVFKETS----------DSS 1384

Query: 1478 NVVESMRRSFEEEKINFXXXXXXXXXXXXXXXHTLQVNGNEPQQQPVNYEEIKRQWESEQ 1537
            + +E M+   E EK N                 T +  G   +    N EE+K+QW  + 
Sbjct: 1385 DTIEKMKEIMEAEK-NKIIEEKTTEFERKLEEATGKNTGATIENGE-NMEELKKQWLKQY 1442

Query: 1538 EESILKRIAEAEENLKKRIRLPTEERIKQVV 1568
            EE  ++RI EAEENLKKRIRLP+EERI++++
Sbjct: 1443 EEETMRRIKEAEENLKKRIRLPSEERIQKII 1473

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score =  439 bits (1128), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 430/1580 (27%), Positives = 799/1580 (50%), Gaps = 145/1580 (9%)

Query: 25   KLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTIDEIKTVSSKR----- 79
            K+S F  VP + L  I    L  L  K+ +F   + +  +LNV +DEIK+    R     
Sbjct: 4    KISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRISKLT 63

Query: 80   --------EEGLKNEIENLMKDNDSIRLERSQAQEESTQSSRDKQKIQNEVESLQEKLSD 131
                    E+ + +++ N ++D         Q +EE ++ +R    +  ++ +  E +  
Sbjct: 64   KLLNESSEEKVINSKVMNRLQD---------QLKEERSRHTRKIDALNKQLNASHETIKK 114

Query: 132  LDQERETLKQDKREVVAVLEEKIKELESFRTESRKSLD-DSKRLRQQVLELETTVQNLKS 190
            L+ E     +  +E  +  ++ ++  +S    ++  LD ++K L++++LE+E  +Q  KS
Sbjct: 115  LEDE-----EGAKEEASSWQDGLRNDDS----TKHVLDKENKLLQRKLLEMENILQVCKS 165

Query: 191  KELRDQSEIQTITQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDRLTSESLSCKN 250
              +  Q +  T +Q   +  +N +W EE ++S  ++ +         L  L  +    + 
Sbjct: 166  NAVSLQFKYDTASQEKELWLQNKKWTEERLSSCNQKALVDEVTKTSYLQNLEEKLNQTQT 225

Query: 251  ELQLEKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLEN 310
            E +   + N+ +  +N++L+  ++EKL+E+K+L D+   EK EF+ EM++++K+ DLL +
Sbjct: 226  ENESVSTYNKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDLLRS 285

Query: 311  QVKSLQ-GELNASLDKDNVELLASGERNTENEKLIQELITXXXXXXXXXXXXXXXXXXXX 369
            Q+ S + G      +K + +L     +N E+  + +ELI                     
Sbjct: 286  QLTSFERGHSLRPKEKGDDKLC----KNPEHIDVAEELIDAKLKLEKSKEECQLLKNIVS 341

Query: 370  XXIPGDDSQDDINNTSSFISLRNKDSSLRDMGILKKELIKERHQKERLQRQVESFIVELE 429
              I  + +  + N  +  +          ++  LK++L+KER QK ++Q Q++ F++ELE
Sbjct: 342  DCIEENGTTVNTNTAAPTVG-----KLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELE 396

Query: 430  YKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIHTLTR 489
            +K P + SFKERT +LE EL     LL+  S  K K E++  +L +K+   E++IH+L R
Sbjct: 397  HKTPALVSFKERTELLEHELKCSTELLETMSLAKRKDEKKLTSLEQKINSYEANIHSLVR 456

Query: 490  QRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDDPNSESDSQRVISERLVEF 549
            QR DLA QV+ LL NIS    +   LS +E+  +++++ +++  +E DSQ +I+E+LVEF
Sbjct: 457  QRLDLARQVKILLSNISAIQTTTSPLSNDELMSLRKLLESENTVNERDSQIIITEKLVEF 516

Query: 550  NNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQDYNANL 609
             NI  LQEKNMELL  +R LA+KLE+ E + +K +   EN TIKEAKEAI+ ++  N+ L
Sbjct: 517  KNIDELQEKNMELLDCIRILADKLETNEGEADKTVAKIENQTIKEAKEAIIEMESINSKL 576

Query: 610  ESKVEILTKECDAFKAICSRNGSDQNGSLSANGTQGNRNG---SSDEEKLRTLEARLTSL 666
              +V ILT+E D++K + S N          N T  +  G   ++ E+K+R L+++L+S 
Sbjct: 577  ALRVNILTRERDSYKLLASAND---------NKTHADTEGITEATYEKKIRELQSKLSST 627

Query: 667  TVESSQNNKMLNNEIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQL 726
             VESS   + LN ++    +S+T   I L++  + K L  E+  ++Q  +   +    QL
Sbjct: 628  RVESSAIIQNLNGQLLTYKKSQTDGKIALQEFENFKVLVAEKEAMLQERINHLKT---QL 684

Query: 727  VKRSQNLQSIFDRQDSRTAETVNELIACNSKLAVLETKVANLETEKELLQSSERTSRENY 786
             K  Q L +    QD + +  + +L    +K+  L+ +++NL+ E   L + + +   + 
Sbjct: 685  EK--QRLSAAPPVQDYKYS-NLTDLSHSENKIGSLKYEISNLKKENTGLIAMKESLTRDL 741

Query: 787  LKLSEERNSLRIMVSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLDAKTKEA 846
             +  +E+  L + +S+ +T  +E+       +  Y   +  LE+   +   RL++K +E 
Sbjct: 742  ERCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTRIKVLEKNLKELNVRLESKEQEI 801

Query: 847  EDMENSKRTQIQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVEESEARI 906
            + +++SK +Q++W Q+ +D      + +  EL  K   +  L  E+  L  ++  ++ + 
Sbjct: 802  KTLQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKETTIGRLSLEIENLGNELRMTKLQ- 860

Query: 907  QSYQVLSGSEVETSPESSLRKELEKTKINLSDTYAEIDQYKNXXXXXXXXXXXXXXDYAS 966
              Y+ LS +    + E +LRKEL++T+I L D +++I  Y+               +   
Sbjct: 861  --YKFLSNTSDTNTLEPTLRKELKQTQIELKDAHSQIKAYEEIISTNENVLKELNGELKK 918

Query: 967  GKQELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKKI----- 1021
             K++ + +++    EK   ++ ++ L + +               +E   LQ K+     
Sbjct: 919  AKEDCETKIQLENKEKGAKEEELSHLRKEL---------------DEIRCLQPKLREGAS 963

Query: 1022 -ATLETESKGSH-QLKEEYDAQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISE 1079
               L++E  G   Q  +E   +I K+   +E   ++       Y+ EL+ + ++S+ +  
Sbjct: 964  YLVLQSEKVGDQAQRIQEMKNKIDKMAAIIE---AYQKEESSQYQSELKTNKDLSEWVMR 1020

Query: 1080 LREQSQKDRIAITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSL 1139
            L +++   +  + + K S    +++L+++EK W  +K +YER+L ++ +  E L  +NS+
Sbjct: 1021 LEKEAFDYQTELKKTKKSLYSTQELLDRHEKKWMEEKADYERELISNIEQTESLRVENSV 1080

Query: 1140 LYDQIELFSKDNSDGVNGETAEVREILTNLRRERDILGTKLTVSQREEQTLRGSLASVEN 1199
            L ++I+  ++ ++   N +  E+  + +NLR ER  L TKLT  +R+   LR   AS+E 
Sbjct: 1081 LIEKIDGATEGSNS--NEKYLELVSLFSNLRHERSSLETKLTTCKRDLALLRQKNASLEK 1138

Query: 1200 ELDTTKRQLSQFQKEITTHSELIGQHEKIIEQLNQLNLLRESNITXXXXXXXXXXXXXXX 1259
             +   +R  +  + ++   + +I ++EKII+++ Q+N+LRE+N                 
Sbjct: 1139 SIGDLQRANTVPRNKVQCPAVIIDEYEKIIKEIAQVNILRENNAILHKSLKNVTEKNEAI 1198

Query: 1260 XXXXXXXXXXILPLESELNTLHTSVLEKDQQLNL-------YKEEANRWKERSQEILHKH 1312
                      ++ ++ E++ L   +++  +Q+++       Y+ E  + K+R Q++  + 
Sbjct: 1199 YKE-------LINMQEEISRLQGHLIQTKEQVSINANKVLAYESEIEQCKQRYQDLSQQQ 1251

Query: 1313 DRIDPEDHKELKEKVSILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQ 1372
                  + ++L   +  LE KL      N +L+++FNRLKKQAHEKL++SK  QT L+N+
Sbjct: 1252 KLTHKNETEKLHNVIGDLEVKLLNVQNANADLENKFNRLKKQAHEKLDASKKQQTALTNE 1311

Query: 1373 LNELREAKSELEGKFEAEERKVHELQERLNAHGNDTETVESVQKELSDALEHSRELEQNL 1432
            LNEL+E K +LE     EE KV +L+ +L  HG     V  V K+  D++          
Sbjct: 1312 LNELKETKDKLEENLHNEESKVVDLELKLKEHGLQ---VGEVSKD-HDSIAF-------- 1359

Query: 1433 SATLQQNEEITKKLNDEIDSLKLELHSLKEQSAATAKGEISEDLSNVVESMRRSFEEEKI 1492
                       K   +EI+SLK EL   +           + D S+  E ++ + EEEK 
Sbjct: 1360 -----------KPFVEEIESLKKELQVFRN----------ANDASDAFEKIKNNMEEEKN 1398

Query: 1493 NFXXXXXXXXXXXXXXXHTLQVNGNEPQQQPV----NYEEIKRQWESEQEESILKRIAEA 1548
                                 VN ++  +  V    + E +K++W  E EE  +KRI EA
Sbjct: 1399 KIIDEKTKDFEKKLQDA----VNKSKSNESEVENSEHIEALKKEWLKEYEEETVKRIKEA 1454

Query: 1549 EENLKKRIRLPTEERIKQVV 1568
            EENLKKRIRLP+EERI++++
Sbjct: 1455 EENLKKRIRLPSEERIQKII 1474

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
            MLP2Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved in the Tel1p pathway that
            controls telomere length
          Length = 1679

 Score =  431 bits (1109), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 426/1560 (27%), Positives = 809/1560 (51%), Gaps = 108/1560 (6%)

Query: 25   KLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTIDEIKTVSSKREEGLK 84
            K+S F  VP + L  +   +L  L  K+  F   + +  +LNV +DEIK+    R   LK
Sbjct: 4    KISEFLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRISKLK 63

Query: 85   NEIENLMKDNDSIRLERSQAQEE----STQSSRDKQKIQNEVESLQEKLSDLDQERETLK 140
              +       D    +++ A+EE      Q + ++ + + E+++L+++L    +    + 
Sbjct: 64   QLL-------DESSEQKNTAKEELNGLKDQLNEERSRYRREIDALKKQLHVSHEAMREVN 116

Query: 141  QDKREVVAVLEEKIKELESFRTESRKSLDD-----SKRLRQQVLELETTVQNLKSKELRD 195
             +KR    V EE   ++   R +   SL+D     +K LR++++E+E  +Q  KS  +  
Sbjct: 117  DEKR----VKEEY--DIWQSRDQGNDSLNDDLNKENKLLRRKLMEMENILQRCKSNAISL 170

Query: 196  QSEIQTITQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDRLTSESLSCKNELQLE 255
            Q +  T  Q   ++ ++ + +EE+++S +++ ++        ++ L  +    ++  +  
Sbjct: 171  QLKYDTSVQEKELMLQSKKLIEEKLSSFSKKTLTEEVTKSSHVENLEEKLYQMQSNYESV 230

Query: 256  KSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLENQVKSL 315
             + N+ +  +N++L++S++EK++EMK+L D+   EK EF+ EM++++ + DLL +Q+ SL
Sbjct: 231  FTYNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSL 290

Query: 316  QGELNA-SLDKDNVELLASGERNTENEKLIQELITXXXXXXXXXXXXXXXXXXXXXXIPG 374
            + + +  +++K++     +  RN E+  +I ELI                       +  
Sbjct: 291  EKDCSLRAIEKND----DNSCRNPEHTDVIDELI----DTKLRLEKSKNECQRLQNIVMD 342

Query: 375  DDSQDDINNTSSFISLRNKDSSLRDMGILKKELIKERHQKERLQRQVESFIVELEYKIPV 434
               +++   T+S +S         D+ +LK++LIKER+QK +LQ Q+E FI+ELE+K P 
Sbjct: 343  CTKEEEATMTTSAVS-PTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPE 401

Query: 435  INSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIHTLTRQRTDL 494
            + SFKERT  LE EL     LL+  S  K K+ERE  +L +K+   E++IH+L +QR DL
Sbjct: 402  LISFKERTKSLEHELKRSTELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDL 461

Query: 495  AHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDDPNSESDSQRVISERLVEFNNIAT 554
            A QV+ LL+N S   ++   LS +E+  +++I+ + +  +E+DSQ +I+ERLVEF+N+  
Sbjct: 462  ARQVKLLLLNTSAIQETASPLSQDELISLRKILESSNIVNENDSQAIITERLVEFSNVNE 521

Query: 555  LQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQDYNANLESKVE 614
            LQEKN+ELL  +R LA+KLE+ E   +K +Q  EN TIKEAK+AI+ L++ NA +E+++ 
Sbjct: 522  LQEKNVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETRIN 581

Query: 615  ILTKECDAFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLEARLTSLTVESSQNN 674
            IL +E D++K + S   +++N    AN        ++ E+K+R LEA L+S  VE+S   
Sbjct: 582  ILLRERDSYKLLAS---TEENK---ANTNSVTSMEAAREKKIRELEAELSSTKVENSAII 635

Query: 675  KMLNNEIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQLVKRSQNLQ 734
            + L  E+    +S+ +    LE   + K L +E+ ++++  ++  + E   L K+   + 
Sbjct: 636  QNLRKELLIYKKSQCKKKTTLEDFENFKGLAKEKERMLEEAIDHLKAE---LEKQKSWVP 692

Query: 735  SIFDRQDSRTAETVNELIACNSKLAVLETKVANLETEKELLQSSERTSRENYLKLSEERN 794
            S    +  R +    EL     K+  LE +++ L+ E      ++ +   ++ +  +E+ 
Sbjct: 693  SYIHVEKERAS---TELSQSRIKIKSLEYEISKLKKETASFIPTKESLTRDFEQCCKEKK 749

Query: 795  SLRIMVSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLDAKTKEAEDMENSKR 854
             L++ + + +   +E +      +  YK  +  LE      R+ L +K +E E + + K 
Sbjct: 750  ELQMRLKESEISHNENKMDFSSKEGQYKAKIKELENNLERLRSDLQSKIQEIESIRSCKD 809

Query: 855  TQIQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVEESEARIQSYQVLSG 914
            +Q++W Q+ +D    + + L  EL  K   +  L SE+  L+K++ +++ +   Y+ L  
Sbjct: 810  SQLKWAQNTIDDTEMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTKFQ---YKFLDQ 866

Query: 915  SEVETSPESSLRKELEKTKINLSDTYAEIDQYKNXXXXXXXXXXXXXXDYASGKQELQLQ 974
            +   ++ E +LRKELE+ ++ L D  ++I  Y+               + A  K+    +
Sbjct: 867  NSDASTLEPTLRKELEQIQVQLKDANSQIQAYEEIISSNENALIELKNELAKTKENYDAK 926

Query: 975  VETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKKIATLETESKGSHQL 1034
            +E  + EK   ++ +++L   + ++  +LQ   K  E   + +Q+           S +L
Sbjct: 927  IELEKKEKWAREEDLSRLRGELGEI-RALQP--KLKEGALHFVQQ-----------SEKL 972

Query: 1035 KEEYDAQILKLQRDLEQQASFANRAQRN----YEEELQKDSNVSKTISELREQSQKDRIA 1090
            + E + +I K+   +E+ ++     ++     Y+  ++++ ++S+ +  L + +   +  
Sbjct: 973  RNEVE-RIQKMIEKIEKMSTIVQLCKKKEMSQYQSTMKENKDLSELVIRLEKDAADCQAE 1031

Query: 1091 ITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSLLYDQIELFSKD 1150
            +T+ K+S    + +L+++E+ W  +K +YER+L ++ +  E L  +NS+L +++     D
Sbjct: 1032 LTKTKSSLYSAQDLLDKHERKWMEEKADYERELISNIEQTESLRVENSVLIEKV-----D 1086

Query: 1151 NSDGVNGETAEVR--EILTNLRRERDILGTKLTVSQREEQTLRGSLASVENELDTTKRQL 1208
            ++   NG+   ++   + +NLR ER+ L TKLT  +RE   ++    S+E  ++  +R  
Sbjct: 1087 DTAANNGDKDHLKLVSLFSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKTINDLQRTQ 1146

Query: 1209 SQFQKEITTHSELIGQHEKIIEQLNQLNLLRESNITXXXXXXXXXXXXXXXXXXXXXXXX 1268
            +  +KE    + +I + + I +++ Q+N+L+E+N                          
Sbjct: 1147 TLSEKEYQCSAVIIDEFKDITKEVTQVNILKENNAILQKSLKNVTEKNREIYKQLNDRQE 1206

Query: 1269 XILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPEDHKELKEKVS 1328
             I  L+ +L      V     ++ +Y+ E  + K+R Q++  +      +D ++L  ++S
Sbjct: 1207 EISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDIEKLTNEIS 1266

Query: 1329 ILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAKSELEGKFE 1388
             L+ KL      N +L+++FNRLKKQAHEKL++SK  Q  L+N+LNEL+  K +LE    
Sbjct: 1267 DLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKDKLEQDLH 1326

Query: 1389 AEERKVHELQERLNAHGNDTETVESVQKELSDALEHSRELEQNLSATLQQNEEITKKLND 1448
             E  KV +L  +L AH   +E V             SR+ E++   TL +          
Sbjct: 1327 FENAKVIDLDTKLKAHELQSEDV-------------SRDHEKDTYRTLME---------- 1363

Query: 1449 EIDSLKLELHSLKEQSAATAKGEISEDLSNVVESMRRSFEEEKINFXXXXXXXXXXXXXX 1508
            EI+SLK EL   K  +++          S+  E ++ + E+EK                 
Sbjct: 1364 EIESLKKELQIFKTANSS----------SDAFEKLKVNMEKEKDRI--IDERTKEFEKKL 1411

Query: 1509 XHTLQVNGNEPQQQPVNYEEIKRQWESEQEESILKRIAEAEENLKKRIRLPTEERIKQVV 1568
              TL  + +   +   + E +K++W  E E+  L+RI EAEENLKKRIRLP+EERI++++
Sbjct: 1412 QETLNKSTSSEAEYSKDIETLKKEWLKEYEDETLRRIKEAEENLKKRIRLPSEERIQKII 1471

>KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1674

 Score =  419 bits (1076), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 453/1722 (26%), Positives = 813/1722 (47%), Gaps = 234/1722 (13%)

Query: 177  QVLELETTVQNLKSKELRDQSEIQTITQRLTILQKNSQWLEEEVTSKTEQLISTRR---- 232
            ++L L+  ++  KS+ L  QSE +   ++  ++++++QWLEE +   TE+L++ ++    
Sbjct: 102  EILTLQRELERAKSEHLISQSEAERSLKQSELVREHNQWLEEHLVKTTEELMTQKQSILK 161

Query: 233  --KNDDELDRLTSESLSCKNELQLEKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYRE 290
              + D E+D L       ++E+ + K  N ++  KN+EL++++QEKL+E+K  SD    +
Sbjct: 162  MEEKDQEIDNL-------RHEVSILKKNNDLLLGKNQELSENVQEKLIEIKQKSDDYSTK 214

Query: 291  KQEFAHEMSMKQKLIDLLENQVKSLQGELNASLDKDNVELLASGERNTENEKLIQELITX 350
            +QEF HE+ +K ++   LE Q+K +Q E +   ++DN           E++K++++LI  
Sbjct: 215  QQEFLHEIGLKDRINSSLETQLKEIQQEKSIQ-NEDNTS-------RAESQKIMEQLIDT 266

Query: 351  XXXXXXXXXXXXXXXXXXXXXIPGDDSQDDINNTSSFISLRNKDSS---LRDMGILKKEL 407
                                     DS+++     S+++    D +        +LKKEL
Sbjct: 267  RKQLK--------------------DSRNECTRLKSYVNEFINDVNGEYSSSSSLLKKEL 306

Query: 408  IKERHQKERLQRQVESFIVELEYKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKRE 467
            +K + QK+ L+ QVE+FI ELE K+PVI+S +++   LEKEL+DV  L+D  S E+E  E
Sbjct: 307  LKVKEQKDYLETQVENFITELEIKVPVIDSLEKKNKDLEKELSDVTSLVDRISIERESLE 366

Query: 468  REFEALSKKVKDSESSIHTLTRQRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIV 527
            +EF++  +K + ++  I TLT QR+DLAHQ+QFLL+ +  Q  +  LLS +E  FI+R+ 
Sbjct: 367  KEFQSFKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFIRRLT 426

Query: 528  NNDDPNSESDSQRVISERLVEFNNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTF 587
             ND     +DSQ +ISERL++F +I  LQ++NM++L TVR LA +LE +EK       T 
Sbjct: 427  ENDTYARNNDSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQADHHTI 486

Query: 588  ENDTIKEAKEAIVSLQDYNANLESKVEILTKECDAFKAICSRNGSDQNGSLSANGTQGNR 647
            E  T++EAK+A++ LQ+Y  +LE K+E   KE D +K +        N     N    + 
Sbjct: 487  ERKTLEEAKKALLDLQEYTNSLERKLETFRKERDVYKLLSKGKSPSSNKPSECNDIDKHT 546

Query: 648  NGSSDEEKLRTLEARLTSLTVESSQNNKMLNNEIHELYRS-------KTQISIELEKERS 700
             G                L  E  Q  + L  EI +L R+       K ++   ++K  S
Sbjct: 547  TGK---------------LQNELQQTREYLTKEIEKLTRTNKDILNKKKELEYSMKKMES 591

Query: 701  SKTLTEERLKLIQHTLELTRNENQQLVKRSQNLQSIFDRQDSRTAETVNELIACNSKLAV 760
            +K   E + +LI++ L + +   + +++++ +LQ +  +++++ AE   +L    S+  +
Sbjct: 592  AKEYAEGKAELIENNLLMLQENRKSVLEQNDHLQQLLSQKEAKLAELTQDLHELTSQYNL 651

Query: 761  LETKVANLETEKELLQSSERTSRENYLKLSEERNSLRIMVSQLQTLQSEREKFLKEIQTT 820
            L+ +  + +++   L++  +T+++   ++ EE+N+L++ + +L+  ++E +     ++  
Sbjct: 652  LQIRFTDTQSQSNSLRTQHQTTQKELFEVVEEKNALKVKIHELEISRNECKGIQATVELK 711

Query: 821  YKENLDSLEQEKADARARLDAKTKEAEDMENSKRTQIQWYQDKL----DSVVAESQHLKQ 876
              E L   +  + D    ++ +  +  DME  +  ++ WYQ       ++ +     +K+
Sbjct: 712  LNERLTEYQLHEQDLLKIIEKQEDQIRDMEVKRAEELNWYQKNFPTQTETEIGLPVDMKK 771

Query: 877  ELQTK--------------TFLVTDL--ESEVRK--------LEKQVEESEARIQSYQVL 912
            E +T               +   TDL  +S VRK        + +  EES+   +   + 
Sbjct: 772  EGETGRQSNRDTLESQKSGSPGFTDLGTDSSVRKSTSLPVMQVGRTEEESKEAKKCDALT 831

Query: 913  SGSEVETSPESSLRKELEKTKINLSDTYAEIDQYKNXXXXXXXXXXXXXXDYASGKQELQ 972
              S+V   PE+  +KE         D  A+I+Q  +              +Y     +LQ
Sbjct: 832  DSSQVVGLPENVTKKE--------KDLIAQIEQLASDKKELKTSLQAIRAEYQHLHDQLQ 883

Query: 973  LQVETLQNEKSQLQDVVAKL--NESVTK-----LEESLQDANKAAENEKNTLQKKIATLE 1025
            L+  +   EK+ L + + K+  N S+T+     LE+ L D     E E+   ++  ATL 
Sbjct: 884  LEKNSFDTEKASLNNELDKIMENNSLTEVAKKSLEDDLHDVEMKLEEERQKHEETNATLS 943

Query: 1026 TESKGSHQLKEEYDAQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISELREQSQ 1085
             +     ++ EE                         Y EEL K + +   I   RE   
Sbjct: 944  EKELLCEKMIEEISG----------------------YREELSKSAEMQVDIQHTRE--- 978

Query: 1086 KDRIAITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSLLYDQIE 1145
                                              E  L+ + + ++DL TQN+LL++Q+ 
Sbjct: 979  ---------------------------------LEDLLDLANKRIDDLCTQNNLLHEQLN 1005

Query: 1146 LFSKDNSDGVNGETAEVREILTNLRRERDILGTKLTVSQREEQTLRGSLASVENELDTTK 1205
              + D  D  N +  ++++I+  ++RERD L  KL + +RE + LR   A +++ELD   
Sbjct: 1006 A-TLDLEDTQNKD--DIKDIIVCMKRERDTLQKKLAIVEREGEVLRERCAGLKSELDAVS 1062

Query: 1206 RQLSQFQKEITTHSELIGQHEKIIEQLNQLNLLRESNITXXXXXXXXXXXXXXXXXXXXX 1265
            +        +   S L+  HEKI+++L +++LLRE+N++                     
Sbjct: 1063 KGQQWHNLPL---SNLLTGHEKILDELKEVHLLRENNVSLLTEVNQLKHDNCILNDELSQ 1119

Query: 1266 XXXXILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHD-RIDPEDHKELK 1324
                  PL+ + N       EKDQ+++LYK+E  RWK+R Q+++H+ D  +  E +   K
Sbjct: 1120 VRKLSGPLQDQKNNTERYFKEKDQEISLYKDEIERWKKRWQQMVHRQDDTLGLEAN--FK 1177

Query: 1325 EKVSILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAKSELE 1384
             ++  L+  ++E  KE ++L ++F  LKKQAHEKL+++KI   TL+N L+E++ +  +LE
Sbjct: 1178 NEIDSLKGLIEERTKEKEKLSEKFQLLKKQAHEKLDANKIHIQTLNNDLSEIKASNLQLE 1237

Query: 1385 GKFEAEERKVHELQERLNAHGNDTETVESVQKELSDALEHS-RELEQNLSATLQQNEEIT 1443
               + +++K+ E++  L       E +E   K+     E + +E E  L+ T+   +++ 
Sbjct: 1238 EVMKEKDKKIREIELTLK------ENLEKFDKDEKLVSEKTFKENEAKLNKTITMLQKLN 1291

Query: 1444 KKLNDEIDSLKLELHSLKEQSAATAKGEISEDLSNVVESMRRSFE-------EEKINFXX 1496
            + LN E+ SL+ E++ L+++   T         + ++ +M+  FE       EEK+    
Sbjct: 1292 ETLNQEVVSLREEINVLRKKDDET---------NQLISTMKLDFEREKDRLIEEKVRELN 1342

Query: 1497 XXXXXXXXXXXXXHTLQVNGNEPQQQPVNYEEIKRQWESEQEESILKRIAEAEENLKKRI 1556
                          +  V  +       N +++K++   + EE  L+RI EA+ENLK+ I
Sbjct: 1343 EKFESGRNEVLSKQSENVTNDNTGS---NVDKLKQELRKDWEEQTLQRIEEAKENLKRHI 1399

Query: 1557 RLPTEERIKQVVXXXXXXXXXXXXXXXXXXXXXXXXXDGNNSXXXXXXXX-------XXX 1609
            RLP+EE+I++++                         D  +                   
Sbjct: 1400 RLPSEEKIQRIIEKRRAELESDFDKRVEEKANLIALADKADMSPDELKQKVRRELEHAIE 1459

Query: 1610 XXFEAEVQAVKKKAFEEGKQQAAMKSTLLERKISKLESQLHGKXXXXXXXXXXXXXXXXP 1669
               +A+++ ++ KAFEEGK+QA MK+TLLERK+SKLESQ+                    
Sbjct: 1460 QDLQAKLETIRTKAFEEGKRQAEMKTTLLERKLSKLESQVAKDNESGSKVRKSISGL--- 1516

Query: 1670 NLPSKIDEKSVTTNQSVPNPLVSGEKVLKLDPSKXXXXXXXXXXXXXXXXXP-----QNN 1724
               +KID  S    +   N     E VLKL P+                  P     ++N
Sbjct: 1517 ---TKIDVNSPQLYKD--NTGTRTEAVLKLRPTAKVDSGKDVSNDSNPFTSPTQELSKSN 1571

Query: 1725 DTMGTSAFGFKPTFTLSNNSNKSSGT---KIDSSSTENKPANPFSSF---TETGASSPER 1778
                       PTF+ +    KS+GT   +++ ++     A  FS+F   T  G  S   
Sbjct: 1572 SPAALPIVHMAPTFSFT--PGKSTGTVNKELNKTAQATFGAPTFSNFGTSTAFGGFSGFG 1629

Query: 1779 ESSNTAMTPTPGEGA----STPSKRAAEDDDNEVGSESKKPR 1816
            +++N      P E      +   KR   D+  +  SESKKP+
Sbjct: 1630 KTTNDQSGFKPFEALKEIDNESIKRPVSDEKEDDFSESKKPK 1671

>Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  406 bits (1044), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 431/1556 (27%), Positives = 776/1556 (49%), Gaps = 97/1556 (6%)

Query: 25   KLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTIDEIKTVSSKREEGLK 84
            K+S F  VP + L  I+  +L  L  K+ +F   + +  RLNV +DEIK+    R   L 
Sbjct: 4    KISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSRISKLS 63

Query: 85   NEIENLMKDNDSIRLERSQAQEESTQSSRDKQKIQNEVESLQEKLSDLDQERETLKQDKR 144
              +    +  +    E S  Q++  Q   D+++ + ++++L ++L   D  R+ +K+   
Sbjct: 64   KLLNESSEQKNIASKELSHLQDQLMQ---DRERCRRKIDALNKQL---DSSRDAIKRLND 117

Query: 145  EVVAVLEEKIKELESFRTESRKSLDD--SKRLRQQVLELETTVQNLKSKELRDQSEIQTI 202
            E  A  E  I++ +     S +++ D  +K LR++++E+E  +Q  KS  +  Q +  TI
Sbjct: 118  EKDAKEESMIRQSKHQNVNSVQNVLDKENKLLRRKLMEMENILQICKSNSVSLQLKYDTI 177

Query: 203  TQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDRLTSESLSCKNELQLEKSRNQVI 262
             Q   ++ +N +W EE+++S   + ++        +  L  +    + + +   S +Q++
Sbjct: 178  VQEKELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQADRESALSYSQLL 237

Query: 263  TTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLENQVKSLQGELNAS 322
              +N++L+ S++EK++E+K+L D+   EK EF+ EM++++ + DLL +Q+ S + + ++ 
Sbjct: 238  LDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLASFERDHSSG 297

Query: 323  -LDKDNVELLASGERNTENEKLIQELITXXXXXXXXXXXXXXXXXXXXXXIPGDDSQDDI 381
             + KD+  L    + N     +  EL+                       +  D +  D 
Sbjct: 298  EIGKDDDNLCKDPDHNN----VTDELMNTKVQFQKSQDECQRLQNIISDFVQEDKATVDT 353

Query: 382  NNTSSFISLRNKDSSLRDMGILKKELIKERHQKERLQRQVESFIVELEYKIPVINSFKER 441
            N  S  +          D+ +L+K+LIKER QK +LQ Q+E FI+ELE+K P + SFKER
Sbjct: 354  NGASHTVG-----KLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTPELVSFKER 408

Query: 442  TSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIHTLTRQRTDLAHQVQFL 501
            T  LE EL     LL+  S  K K ERE  +L +K+   E++IH L +QR DLA QV+ L
Sbjct: 409  TKSLEHELKRSTELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRLDLARQVKVL 468

Query: 502  LMNISVQVDSGGLLSAEEVSFIKRIVNNDDPNSESDSQRVISERLVEFNNIATLQEKNME 561
            L+N S    +   LS +++  +++I+ +    +E+D+Q +ISERLVEFNNI  LQEKN+E
Sbjct: 469  LLNTSAIQKTTLPLSKDDLISLRKILESGSDVNENDAQAIISERLVEFNNINELQEKNVE 528

Query: 562  LLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQDYNANLESKVEILTKECD 621
            LL  +R LA+KLE  E   +  +   E  TIKEAK+AI+ L++ N  +ES++ IL +E D
Sbjct: 529  LLYCIRTLADKLEFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKMESRINILLRERD 588

Query: 622  AFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLEARLTSLTVESSQNNKMLNNEI 681
            ++K + S   S +N     N    N    S E+K++ LEA L+S  VESS   + L  E+
Sbjct: 589  SYKLLAS---SKENN---VNVNAKNFTEISHEKKIKELEAELSSTKVESSAVIQNLRKEL 642

Query: 682  HELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQLVKRSQNLQSIFDRQD 741
                +      I  +   + K L +E+  +++     TR  N +     Q L      QD
Sbjct: 643  TTYKKLLCDKKIASQDFENFKMLAKEKESILE-----TRVNNLKTDLEKQKLSVPSFVQD 697

Query: 742  SRTAETVNELIACNSKLAVLETKVANLETEKELLQSSERTSRENYLKLSEERNSLRIMVS 801
            ++  ++  EL+   +K  +L  ++++L+ E         T+    LK S  R+  R    
Sbjct: 698  NKVRDST-ELLQSRTKTEILMHEISSLKKE---------TANSMVLKESLTRDLERCCKE 747

Query: 802  --QLQTLQSEREKFLKEIQTT-------YKENLDSLEQEKADARARLDAKTKEAEDMENS 852
              QLQ    E E  L E +         Y   +  LE+     R  L +K +E + +++S
Sbjct: 748  KIQLQMKLKESEISLNEQKVNFDSKGIKYDARIKQLEESLERLRIELKSKAQEIKSLQSS 807

Query: 853  KRTQIQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVEESEARIQSYQVL 912
            K +Q++W Q+ +D    + + +  EL  K   V  L S++  L+ ++ E++ +   Y+ L
Sbjct: 808  KDSQLKWAQNTIDDTEEKLKSVLTELSRKEKTVVTLSSKIENLDNELRENKLK---YEFL 864

Query: 913  SGSEVETSPESSLRKELEKTKINLSDTYAEIDQYKNXXXXXXXXXXXXXXDYASGKQELQ 972
            + +   ++ + +LRKELE+T++ L D ++++  Y+                 AS K++  
Sbjct: 865  NNTSDASTLQPALRKELEQTQLELKDAHSQVRTYEEIISTNEKALKELNSQLASMKEDYD 924

Query: 973  LQVETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKKIATLETESKGSH 1032
             ++E    EK   ++ ++ L   + ++  SLQ   K        L K+   L  +++   
Sbjct: 925  ARIELECKEKLANEEELSLLRRELDEIR-SLQPKLKEG---TVCLVKQSEKLRNQAEKIQ 980

Query: 1033 QLKEEYDAQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISELREQSQKDRIAIT 1092
            ++K + D     +Q   +++ S        ++  ++ +  +S+ ++ L +++   ++ + 
Sbjct: 981  EMKAKIDKMNWNVQVYKKEKTS-------QFQSIMKANKELSELVTRLEKEATDSQMELK 1033

Query: 1093 RLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSLLYDQIELFSKDNS 1152
            +LK+S  + + +L+ +EK W  +K +YER+L ++ +  E L  +NS+L ++I   + + S
Sbjct: 1034 KLKSSLHKTQDLLDTHEKKWMEEKADYERELISNIEQTESLRVENSVLIEKIGSVT-EGS 1092

Query: 1153 DGVNGETAEVREILTNLRRERDILGTKLTVSQREEQTLRGSLASVENELDTTKRQLSQFQ 1212
            DG N +  ++    +NLR ER+ L TKLT  +R+   ++   AS+E  ++  +      Q
Sbjct: 1093 DG-NEDYLKLVSFFSNLRHERNSLETKLTTCKRDLALVKQKNASLEKNINDLQIDQPASQ 1151

Query: 1213 KEITTHSELIGQHEKIIEQLNQLNLLRESNITXXXXXXXXXXXXXXXXXXXXXXXXXILP 1272
             E+   + +I +   I +++ Q+NLL+E+N                           +  
Sbjct: 1152 TELQCSAVIIDEFNDITKEIAQVNLLKENNAILQKSLKNVTEKNREIYEELTIRQEEVSQ 1211

Query: 1273 LESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPEDHKELKEKVSILET 1332
            L+S+L      V     ++ +Y+ E ++ K+R  ++  +   +  +  ++L  ++S  + 
Sbjct: 1212 LKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQREVQKKTIEKLNSEISDFKA 1271

Query: 1333 KLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAKSELEGKFEAEER 1392
            KL +      EL+++FNRLKKQAHEKL++SK  QT L+N+L EL+  + +LE    ++  
Sbjct: 1272 KLLDAENTKTELENKFNRLKKQAHEKLDASKKQQTALTNELKELKAVRDKLEQDLNSKNF 1331

Query: 1393 KVHELQERLNAHGNDTETVESVQKELSDALEHSRELEQNLSATLQQNEEITKKLNDEIDS 1452
            K  +L      H     TV+S      D L      +Q   A+L         L +EI+S
Sbjct: 1332 KTVDLDTEPKEH-----TVQS-----GDLLR-----DQEKVASL--------PLIEEIES 1368

Query: 1453 LKLELHSLKEQSAATAKGEISEDLSNVVESMRRSFEEEKINFXXXXXXXXXXXXXXXHTL 1512
            LK EL   K  + +          S+  E +R + EEEK                   + 
Sbjct: 1369 LKRELQVFKNANNS----------SDAFEKLRDNMEEEKNKIINERTKEFEKKLEEIVSK 1418

Query: 1513 QVNGNEPQQQPVNYEEIKRQWESEQEESILKRIAEAEENLKKRIRLPTEERIKQVV 1568
              +  +      N E +K++W  E EE  ++RI EAEENLKKRIRLP+EERI++++
Sbjct: 1419 SKSTGKVADNSENIETLKKEWLKEYEEETIRRIREAEENLKKRIRLPSEERIQKII 1474

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_5.702
            YIL149C
          Length = 1651

 Score =  367 bits (941), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 382/1399 (27%), Positives = 715/1399 (51%), Gaps = 124/1399 (8%)

Query: 122  VESLQEKLSDLDQERETLKQDKREVVAVLEEKIKELESFRTESRKSLDDSKRLRQQVLEL 181
            V +++ ++  + +E   LK    ++  ++ E+ +E+   R E       +  LR ++  L
Sbjct: 43   VRTVEGRMELIVEENRLLKSSNLDMSRIVTERAEEIGRLRDEVSTVTGQTSALRAELENL 102

Query: 182  ETTVQNLKSKELRDQSEIQTITQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDE--LD 239
            +  ++ LK K+L  QSE  +    L  L+  +  L  E+    E  +++ R++D E  LD
Sbjct: 103  QNDLELLKDKDLALQSERDSTVALLDGLKLENSALRAEIEQAKE--LASIRQHDYEADLD 160

Query: 240  RLTSESLSCKNELQLEKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMS 299
              T   +S + EL+L KS    + ++ E L++ L ++  +++ L D+    + E+  E++
Sbjct: 161  SKTGALVSKEEELRLAKSERASLISQTERLSQELLQRDADIRQLVDADKLRQDEYTDEIN 220

Query: 300  MKQKLIDLLENQVKSLQGE--LNASLDKDNVELLASGERNTENEKLIQELITXXXXXXXX 357
            +++    LL+ QV SL+ E  L     +   E+   GE     E  +Q+           
Sbjct: 221  LQKHRARLLQEQVASLEKEAKLVGHETEPEYEIPPPGE-----EVALQQ----------- 264

Query: 358  XXXXXXXXXXXXXXIPGDD----SQDDINNTSSFISLRNKDSSLRDMGILKKELIKERHQ 413
                          + G+D    S  ++NN  S +S R           LK+E +     
Sbjct: 265  ----RSHSISMDSLLTGNDETSHSMSELNNNISILSNR-----------LKRETL----S 305

Query: 414  KERLQRQVESFIVELEYKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEAL 473
            K++L++QV  F+ ELE   P+I SFK+++   + +++ + L L+H + +KE   +E E  
Sbjct: 306  KQKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTKDKETIFQEVEQY 365

Query: 474  SKKVKDSESSIHTLTRQRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDDP- 532
             K+++        L R+R DLA Q+Q+LL+N  V+ DS   L++ E S+IK I+N D P 
Sbjct: 366  KKQLEQISGQDKILRRERFDLARQLQYLLLNGFVK-DSDDPLTSSEFSYIKEILNTD-PE 423

Query: 533  ---NSESDSQRVISERLVEFNNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFEN 589
                S +DSQ +IS+R+++F +I  LQ++N+ LL  VR L+++ E+ E+    K+++ ++
Sbjct: 424  EGNTSSTDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLER----KLESGDS 479

Query: 590  -DTIKEAKEAIVSLQDYNANLESKVEILTKECDAFKAICSRNGSDQNGSLSANGTQGNRN 648
             + I EAK+ ++ LQ YN++LE+KVE LT +  A +   S            +G  GN +
Sbjct: 480  IEAINEAKQTLLDLQQYNSSLEAKVESLTNKLKANEHFTS----------IGDGEFGNSD 529

Query: 649  GSSDEEKLRTLEARLTSLTVESSQNNKMLNNEIHELYRSKTQISIELEKERSSKTLTEER 708
              SD   ++ L+ +  SL  ESS+    L ++I+ L +SK+ ++ E E   +SK L E+R
Sbjct: 530  -LSDGNNIQALKNKYDSLMAESSETIGHLYSQINNLQQSKSDLAKECESLINSKHLIEDR 588

Query: 709  LKLIQHTLELTRNENQQLVKRSQNLQSIFDRQDSRTAETVNELIACNSKLAVLETKVANL 768
            LK+ Q  L+L++NEN  L  R +N       ++  T++T+ + + C +KL V++ ++ N 
Sbjct: 589  LKITQDMLDLSKNENSTLRNRIKNTSQALKEREVETSQTIKKYLDCVAKLDVIQRQLENT 648

Query: 769  ETEKELLQSSERTSRENYLKLS-EERNSLRIMVSQLQTLQSEREKFLKEIQTTYKENLDS 827
              EK++LQ+++ +S EN L  + +ERN+ + ++ QL+ LQ  +++ LK+IQ + +  +D 
Sbjct: 649  LVEKDILQNAQ-SSIENKLNQALKERNNFQGLIPQLRALQKNQDEQLKDIQVSLQNKIDD 707

Query: 828  LEQEKADARARLDAKTKEAEDMENSKRTQIQWYQDKLDSVVAESQHLKQELQTKTFLVTD 887
            LE E  + R ++D K         + + +++WYQ K DS+   +  L +++      +  
Sbjct: 708  LELENTELRNKIDTKETSPSSALTNPKAELEWYQTKFDSLSGSNDALNEKMIECASTIET 767

Query: 888  LESEVRKLEKQVEES-------EAR--IQSYQVLSGSEVETSPESSLRKELEKTKINLSD 938
            L  + + L+  ++E+       EAR  +     L+G         +L  EL  ++  L+D
Sbjct: 768  LTVKTQTLDILLQEANSKNKLLEARETVDDVNKLTG---------ALETELATSRTRLTD 818

Query: 939  TYAEIDQYKNXXXXXXXXXXXXXXDYASGKQELQLQVETLQNEKSQLQDVVAKLNESVTK 998
            T  E++   N               Y S  + L  +   L+NE   L+D +A L + +T 
Sbjct: 819  TSRELEISSNTIRQ-----------YQSEIKVLNERQSELENENKHLRDEIAILRDELTH 867

Query: 999  LEESLQDANKAAENEKNTLQKKIATLETESKGSHQLKEEYDAQILKLQRDLEQQASFANR 1058
                        E EK  L KK++ LE       +L+E+Y A+I KL+ DL++QA     
Sbjct: 868  -------NGGEFEREKEALMKKLSNLEIRQAELTKLEEDYTAEIEKLKLDLDKQAMLGKE 920

Query: 1059 AQRNYEEELQKDSNVSKTISELREQSQKDRIAITRLKNSEEQVRQVLEQNEKSWSAQKEE 1118
             +  ++EE+++  N +        ++ ++ + +  ++ +     +V  + EK   ++ + 
Sbjct: 921  IKLAHDEEVREVQNRNT-------ETYRNELELVEIRQT-----KVFVEKEKELESRIKI 968

Query: 1119 YERQLETSRQHLEDLSTQNSLLYDQIELFSKDN-SDGVN-GETAEVREILTNLRRERDIL 1176
               Q+E  ++ ++  S + SLL +Q++L + +  SD V+ G + E  +++  L  E+  L
Sbjct: 969  LNEQIELDKERMKQFSDEESLLREQVKLLADEKASDLVDAGVSPEYTDLVRKLSDEKKNL 1028

Query: 1177 GTKLTVSQREEQTLRGSLASVENELDTTKRQLSQFQKEITTHSELIGQHEKIIEQLNQLN 1236
             +KL  SQ E+  LR  L   E+E+        Q +KE+   +E+  +  +  E + QL 
Sbjct: 1029 ESKLFASQSEKNRLREQLTKTESEIAVLNMNYEQAKKEVA--AEVNNESGRAEEHIAQLE 1086

Query: 1237 LLRESNITXXXXXXXXXXXXXXXXXXXXXXXXXILPLESELNTLHTSVLEKDQQLNLYKE 1296
             L+ESN++                            +ES+L+     +  KD +L   + 
Sbjct: 1087 SLKESNMSLTNEVKLAQMRNGEIIAELNELKTKFKSVESQLDEARNVLSSKDMKLMELQT 1146

Query: 1297 EANRWKERSQEILHKHDR-IDPEDHKELKEKVSILETKLDETNKENKELDDRFNRLKKQA 1355
            E +R K  S ++    ++    E    L+  V+ L  ++D     N EL+DRF RLK+QA
Sbjct: 1147 ECSRLKATSHDMPQNGNKDSSSELVGALQSSVATLTEQVDNLKHANTELEDRFGRLKRQA 1206

Query: 1356 HEKLNSSKIAQTTLSNQLNELREAKSELEGKFEAEERKVHELQERLNAHGNDTETVESVQ 1415
             E+L++SK+   +L + +  L + K+ L+   E  + +++EL+ ++  H   +  ++ ++
Sbjct: 1207 RERLDASKVTINSLRDNVETLTKDKTALQDVIERSKDELNELRAKIQEHIETSAVMKELK 1266

Query: 1416 KELSDALEHSRELEQNLSATLQQNEEITKKLNDEIDSLKLELHSLKEQSAATAKGEISED 1475
             EL+  +  ++++E  L+ T + + ++T  LN+EI+SLK E+  LKE S+A  +G  +E+
Sbjct: 1267 TELAAVMSKNKDIEAELNETSKSSNQLTTALNEEIESLKHEVQYLKEASSAEPQG--NEE 1324

Query: 1476 LSNVVESMRRSFEEEKINF 1494
            +S VVESMR++FE+EKI F
Sbjct: 1325 MSGVVESMRKAFEDEKIAF 1343

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 72/189 (38%), Gaps = 33/189 (17%)

Query: 1618 AVKKKAFEEGKQQAAMKSTLLERKISKLESQLHGKXXXXXXXXXXXXXXXXPNLPSKIDE 1677
            AVKK+AFEEGKQQA MK ++LERKI+KLE++                    P   +  + 
Sbjct: 1470 AVKKRAFEEGKQQATMKMSILERKIAKLEAE----SKATKSGSDMSVSEDAPRFVTPNNN 1525

Query: 1678 KSVTTNQSVPNPLVSGEKVLKLDPSKXXXXXXXXXXXXXXXXXPQNNDTMGTSAFG---F 1734
            K    NQ       SG  V                        P +     T+A     F
Sbjct: 1526 KVQQANQPFLATAGSGFSV--------------QSSESNPFTTPVSRGAAHTNASSQSKF 1571

Query: 1735 KPTFTLSNNSNKSSGTKIDSSSTENKPANPFSSFTE-TGASSPERESSNTAMTPTPGEGA 1793
             PTF L    N      +  SS E+      +S  E  G + P    +N      PGEG 
Sbjct: 1572 APTFLL----NSQPPVLVSGSSDEDNDTMRGTSVDEDAGTAVPSLNENN----KRPGEGE 1623

Query: 1794 S---TPSKR 1799
            S   +PSK+
Sbjct: 1624 SNLKSPSKK 1632

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1454

 Score =  266 bits (681), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 303/1133 (26%), Positives = 579/1133 (51%), Gaps = 82/1133 (7%)

Query: 132  LDQERETLKQDKREVVAVLEEKIKELESFRTESRKSLDDSKRLRQQVLELETTVQNLKSK 191
            L +E+   ++ K E++ +LEE+I ++++ + +  K ++++K L +   +L   ++  K +
Sbjct: 63   LQKEKLASQETKNELLKLLEERINQIDTLKADLNKVVEENKNLYENSHKLTKEIETSKDE 122

Query: 192  ELRDQSEIQTITQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDRLTSESLSCKNE 251
            +L  ++++  +T  L++  K  Q  E E  SK +   S + + + E   +     +  NE
Sbjct: 123  KLLLRTQLDKVTFTLSLTMKQKQHTESEYLSKEKHFESYKDRKELEYQNVMENLTAIDNE 182

Query: 252  LQLEKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLENQ 311
            L++   +N  +  +NEEL+K L+ K+ E+K L +SL     +F  E  ++ +LI+ L+NQ
Sbjct: 183  LRMTNGKNAELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQ 242

Query: 312  VKSLQGELNASLDKDNVELLASGERNTENEKLIQEL--ITXXXXXXXXXXXXXXXXXXXX 369
            +K+LQ +L +  D+   +    G +  +  +L++++  +                     
Sbjct: 243  IKTLQEQLESLSDE---KFDDPGTQKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEF 299

Query: 370  XXIPGDDSQDDINNTSSFISLRNKDSSLR---DMGILKKELIKERHQKERLQRQVESFIV 426
              IP ++S    ++ S     RN +S+L    D+ IL+K  +KER QK +L+ Q+   + 
Sbjct: 300  QNIPEEESSSVSSHASG----RN-NSALSLSGDVNILRKHFLKERQQKRQLEEQMRQILQ 354

Query: 427  ELEYKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIHT 486
            ELE  +P ++S+KER++ LEKELN   +LL+H   E   +  E E    +  +  SSI++
Sbjct: 355  ELERNMPSLSSYKERSTFLEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSINS 414

Query: 487  LTRQRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDDPNSESDSQRVISERL 546
            L  QRT LA QV++LL+ I      G  L  +++  + + +  +   + SDS++++ ERL
Sbjct: 415  LAFQRTVLARQVKYLLLIIQNNETLGSSLGRKDLELLGQYLAANTAEAMSDSEKILLERL 474

Query: 547  VEFNNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQDYN 606
             +F N+  LQ +NM+LL+  R+LA K E  EK   K+I + E++TI +AKEAI+ LQ+Y+
Sbjct: 475  AQFKNVKELQNRNMQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAKEAILVLQEYS 534

Query: 607  ANLESKVEILTKECDAFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLEARLTSL 666
              LES+++ L+ E     A+  +  +++  S+SA     +   S   +  + L A L   
Sbjct: 535  QKLESQIKELSDEL----AVQKKEKTEKE-SISAMSKIEDDASSHTIDLGKQLSANLK-- 587

Query: 667  TVESSQNNKMLNNEIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQL 726
               S      LN+EI  L+++ T ++I L+KE+S++ L E+R  L+++ + L ++E ++L
Sbjct: 588  --HSKDIIDALNSEIENLHQANTDVNISLDKEKSARKLAEDRYNLLEYNVSLLKSEKEEL 645

Query: 727  VKRSQNL-QSIFDRQDSRTAETVNELIACNSKLAVLETKVANLETEKEL---LQSSERTS 782
             +    L Q+I D+ + + + +  + I+C SKL+  E ++ +L  E EL    Q++ RT 
Sbjct: 646  QEEVNKLQQNILDK-EKQFSYSSRDYISCKSKLSTAEAEITSLRAENELSIETQTTLRTK 704

Query: 783  RENYLKLSEERNSLRIMVSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLDAK 842
            +E  L    ERN+LR+ V+Q+ +L +E +  LKE ++ Y + L     +      +L   
Sbjct: 705  KEALLN---ERNNLRMTVTQMNSLNNELQTLLKETKSGYDDKLKISALKCTQTNNQLQLV 761

Query: 843  TKEAEDMENSKRTQIQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVEES 902
             +   ++++   ++I+WY+  +D + A    L +EL+ K       E ++ +  K +E  
Sbjct: 762  QQRMSELKSQNDSEIKWYKATIDDLKANVFELNEELKQK-------EEKIEEFSKTLE-- 812

Query: 903  EARIQSYQVLSGSEVETSPESSLRKELEKTKINLSDTYAEIDQYKNXXXXXXXXXXXXXX 962
               +Q+   L+ S+  +  + +L KEL + K  L  +  E+ +Y+N              
Sbjct: 813  --NVQNELTLANSKDVSEEKRALEKELSEVKSQLEKSNLEVKEYENV------------- 857

Query: 963  DYASGKQELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKKIA 1022
              ++ K+       + +N+  Q +D +  L    +KL+  L++     EN  +TLQ ++ 
Sbjct: 858  -ISTSKR-------SFENKSIQYEDRIKAL---ASKLDSELRERTTLQEN-LSTLQARMV 905

Query: 1023 TLETESKGSH----QLKEEYDAQILKLQRDLEQQASF----------ANRAQRNYEEELQ 1068
              + E   ++    +L+  YD+ +L+ +   +++A             +   ++YE  +Q
Sbjct: 906  VQQDELTSNNNTLSELRVSYDSLLLEQKTFKDKEAELRSVIAVKTGNYDSLSKSYERIMQ 965

Query: 1069 KDSNVSKTISELREQSQKDRIAITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQ 1128
            ++S +SK +  LRE+  K+R +    +   E    ++++ +  W  +K+ +E Q+    +
Sbjct: 966  ENSELSKVVELLREEV-KNRTSNGEKEGDLEDTESIIKKGQDVWDEEKKVFEVQITNLNE 1024

Query: 1129 HLEDLSTQNSLLYDQIELFSK-DNSDGVNGETAEVREILTNLRRERDILGTKLTVSQREE 1187
             L +L  +N  L  ++E   K +NS       A   E L  LR ER  L  KLT +Q+EE
Sbjct: 1025 RLSELLEENESLLARLESQDKGNNSPSAETNAAGNEETLAALRSERTSLIEKLTAAQKEE 1084

Query: 1188 QTLRGSLASVENELDTTKRQLSQFQKEITTHSELIGQHEKIIEQLNQLNLLRE 1240
            +++R  L   E+ L     +L + + +I   S L      I+  L  L   RE
Sbjct: 1085 RSVRHKLRETEHALSENAFELKKIKSQIFELSSLPQNEHDILRHLVHLKEQRE 1137

 Score = 67.4 bits (163), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 43/117 (36%), Positives = 56/117 (47%), Gaps = 6/117 (5%)

Query: 1538 EESILKRIAEAEENLKKRIRLPTEERIKQVVXXXXXXXXXXXXXXXXXXXXXXXXXDGNN 1597
            EE I K++++AEENLKKRIRLPTEE+I  ++                           ++
Sbjct: 1225 EEEIQKKVSQAEENLKKRIRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSLLLHSDDD 1284

Query: 1598 SXXX------XXXXXXXXXXFEAEVQAVKKKAFEEGKQQAAMKSTLLERKISKLESQ 1648
                                F+ ++  V+KKAFEEGKQ   MKS  LERKIS LE Q
Sbjct: 1285 KIKKIYKEIEESGRETLQQEFDEQLNIVRKKAFEEGKQHVLMKSAFLERKISMLEGQ 1341

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5.702
            YIL149C
          Length = 1608

 Score =  264 bits (675), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 357/1407 (25%), Positives = 633/1407 (44%), Gaps = 133/1407 (9%)

Query: 400  MGILKKELIKERHQKERLQRQVESFIVELEYKIPVINSFKERTSMLEKELNDVALLLDHT 459
            +  L+K L+KER +   L++Q+ESF++ELE+++P +   +++   ++++L+     +   
Sbjct: 284  IAHLRKLLLKERKENVSLKKQMESFVIELEHRLPGLQILEKQNKEVQQKLHAATNKMIEE 343

Query: 460  SNEKEKREREFEALSKKVKDSESSIHTLTRQRTDLAHQVQFLLMNISVQVDSGGLLSAEE 519
            S  K + +RE  +  +KV       H L  QR+DLAHQ+QFLL   S    S  +L   E
Sbjct: 344  SKAKIRTQRELSSSRQKVDHLNQIFHKLRVQRSDLAHQIQFLLTVNS----SDTVLPPSE 399

Query: 520  VSFIKRIVNNDDPNSESDSQRVISERLVEFNNIATLQEKNMELLKTVRKLAEKLESEEKD 579
            +SFIK I+ N++ ++  DSQR++S+RL+ F+NI  LQE+NM+L+ TVR L +K+ES E D
Sbjct: 400  LSFIKTIIENENWDAYKDSQRIVSDRLLRFDNIPELQEQNMKLVSTVRSLVDKVESWEAD 459

Query: 580  VNKKIQTFENDTIKEAKEAIVSLQDYNANLESKVEILTKECDAFKAICSRNGSDQNGSLS 639
             +  +      T++ AK  I  L+  NA LES+V    K  +A      ++G   +  ++
Sbjct: 460  NDSGL------TLEAAKLQISKLEQSNAQLESEV----KNWEALMETL-KDGDSLDSKIN 508

Query: 640  ANGTQGNRNGSSDEEKLRTLEARLTSLTVESSQNNKMLNNEIHELYRSKTQISIELEKER 699
                +        ++K+  LE++LT +     Q   +LN  I      + Q +I +  E+
Sbjct: 509  VTMVE-------QQKKIEELESKLTDVGESHVQKINVLNKTI-----DRNQSTINMLNEQ 556

Query: 700  SSKTLTEE---RLKLIQHTLELTRNENQQLVKRSQNLQSIFDRQDSRTAETVNELIACNS 756
               T+  +   + +LI       + EN  L ++    Q+  D  +S++A+   +     +
Sbjct: 557  IKNTVKSDMNAKSELIA-----CKRENLSLTQQISTKQNELDELNSKSAQKERDYQLKIA 611

Query: 757  KLAVLETKVANLETEKELLQSSERTSREN-----YLKLSEERNSLRIMVS---QLQTLQS 808
            +L+V   K  + E    LL + E+T  E      + K+ +E   L  + +   +L+   S
Sbjct: 612  ELSVAANKCKSWENSFHLL-TEEKTQMEQKQRSLFDKIQQESKKLLQLETRNKELEVKIS 670

Query: 809  EREKFLKEIQTTYKENLDSLEQEKADARARLDAKTKEAEDMENSKRTQIQWYQDKLDSVV 868
             +E   K  + T    +  L +E       L  K +E +        QI+WYQ  +D   
Sbjct: 671  GKELHRKRSEETLSSKITFLSEENKSLHNDLAFKEEEVKQFIEKSEKQIKWYQQNID--- 727

Query: 869  AESQHLKQELQTKTFLVTDLESEVRKLEKQVEESEARIQSYQVLSGSEVETSPESSLRKE 928
                 L ++ + K+  + +L  ++R L      SE  + +     G+E++      L+ E
Sbjct: 728  ----ELSEQNKNKSNKIIELNDKLRLL------SEKSLSNKPYPVGTELK-----ELQNE 772

Query: 929  LEKTKINLSDTYAEIDQYKNXXXXXXXXXXXXXXDYASGKQELQLQVETLQNEKSQLQDV 988
            L   K  L  + ++   YK+               + +   ELQ + E L  +   LQ+ 
Sbjct: 773  LNGMKAALEVSESQATLYKDTLERNQNFYNNSTLSFQNTISELQSKNEALSKQHETLQNQ 832

Query: 989  VAKLNESVTKLEESLQDANKAAENEKNTLQKKIATLETESKGSHQLKEEYDAQILKLQRD 1048
            + +       ++   Q       +EK  L++K+ +L    +   ++K EYDAQI K++ +
Sbjct: 833  ITETENQSKGIQLEHQTIIDRLTSEKTALEEKLNSLSHSEEKIAEMKGEYDAQIQKIESN 892

Query: 1049 LEQQASFANRAQRNYEEELQKDSNVSKTISELREQSQKDRIAITRLKNSEEQVRQVLEQN 1108
            L+ Q+      + N+E  L   ++  K ++    Q ++    I +L NS+        + 
Sbjct: 893  LKIQSD----TRLNFESAL---TSKEKELTSYAVQIEQLNTEIAKL-NSDIAALTEPAEA 944

Query: 1109 EKSWSAQKEEYERQLETSRQHLEDLSTQNSLLYDQIELFSKDNSDGVNGETAEVREILTN 1168
             K+   +++   ++L+ + Q +E L+ QNS+LYD        ++D    E  ++R ++ N
Sbjct: 945  RKTLIKERDSLGQELKLANQRIESLAAQNSILYDTFSGMRHVDADAEPNE--DLRNLVIN 1002

Query: 1169 LRRERDILGTKLTVSQREEQTLRGSLASVENELDTTKRQLSQFQKEITTHSELIGQHEKI 1228
            LR ERD+  ++ T +QR+ + L+ +L  +  +L  T  ++ +          L   HEKI
Sbjct: 1003 LRIERDMHQSQETTAQRDVKLLKKNLKEITEKLAITCPEIDEPTNTEKDDFSLTVTHEKI 1062

Query: 1229 IEQLNQLNLLRESNITXXXXXXXXXXXXXXXXXXXXXXXXXILPLESELNTLHTSVL--- 1285
            + +L  L   +E N+                           L    EL   ++S +   
Sbjct: 1063 MRELEGLTNTKEENLYLDESIKSLNEDKRTLQEEVSR-----LRESEELAKKNSSAISEQ 1117

Query: 1286 EKDQQLNLYKEEANRWKERSQEILHKHDRIDPEDHKELKEKVSILETKLDETNKENKELD 1345
            E  Q++  Y++E+ +WK   Q++          + + L++++   +  +    +EN +L+
Sbjct: 1118 EWQQKIETYQQESEKWKLMCQQMSEN----TATEIQNLQQQLETFKADIQLKTQENDDLN 1173

Query: 1346 DRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAKSELEGKFEAEERKVHELQERLNAHG 1405
            DRF RLKKQAHEKLN+SK    +L+ +L+EL+     L+ K   +E            + 
Sbjct: 1174 DRFTRLKKQAHEKLNASKATSDSLAIELSELKTVNDALQEKLNNQE-----------TNS 1222

Query: 1406 NDTETVESVQKELSDALEHSRELEQNLSATLQQNEEITKKLNDEIDSLKLELHSLKEQSA 1465
             D+E+  ++  +L +  + ++ LE  L  ++  +E++       I  +  EL +LKE   
Sbjct: 1223 VDSESNAALILQLKEENKQAKSLELELRHSVDSSEKL-------IADMTKELTTLKENP- 1274

Query: 1466 ATAKGEIS-EDLSNVVESMRRSFEEEKINFXXXXXXXXXXXXXXXHTLQVNGNEPQQQPV 1524
               +G ++ ED ++ +E ++  FE+EK                      +N N       
Sbjct: 1275 --IQGSVNVEDYTHRLEQLKSEFEDEKRVLIEKTTSELTERFEREKKELMNNN------A 1326

Query: 1525 NYEEIKRQWESEQEESILKRIAEAEENLKKRIRLPTEERIKQVVXXXXXXXXXXXXXXXX 1584
            N EE+++  E E E   L+RI EA+ENLKK IRLPTEE+I++V+                
Sbjct: 1327 NLEELRKPLEEEWERKTLQRIEEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQFQTKVA 1386

Query: 1585 XXXXXXXXXDGNNSXX---XXXXXXXXXXXFEAEVQAVKKKAFEEGKQQAAMKSTLLERK 1641
                     + +N                  E + + +KKKAFEEG+QQA+MK+TLLERK
Sbjct: 1387 EQANLLKLSELSNKTADELEKEVREEIKTRLEEDFELLKKKAFEEGRQQASMKTTLLERK 1446

Query: 1642 ISKLESQLHGKXXXXXXXXXXXXXXXXPNLPSKIDEKSVTTNQSV----PNPLVSGEKVL 1697
            I+KLE++L G                  N+ S +      TN+ V    PN         
Sbjct: 1447 IAKLEARLQGGTGPLKSANGLNKI----NIDSPLMVAGPLTNEPVLDEKPNAFAGATTTT 1502

Query: 1698 KLDPSKXXXXXXXXXXXXXXXXXPQNN--DTMGTSAFGF----KPTFT-LS--NNSNKSS 1748
               P+                  P      +    AF F    K +F+ LS  N+   +S
Sbjct: 1503 ISQPTSTTAKDSANAFSFNAQKVPAQPAFSSRAQPAFSFGSFNKTSFSDLSHKNSVGAAS 1562

Query: 1749 GTKIDSSSTENKPANPFSSFTETGASS 1775
            GT        N P  PF +  E G  +
Sbjct: 1563 GTPFRFGFASN-PPTPFQNTAENGTDA 1588

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1554

 Score =  213 bits (541), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 200/654 (30%), Positives = 333/654 (50%), Gaps = 102/654 (15%)

Query: 14  SGDNHNDVS---LGKLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTID 70
           S D+ N+ +   + K+S+F+ +P +    +D   L  +  K  D   L  +N  ++  ID
Sbjct: 2   STDSRNEPTPSIIDKISSFFDLPGNTWESMDEHALEKIYTKAYD---LMKENSFVSAAID 58

Query: 71  EIKTVSSKREEGLKNEIENLMKDNDSIRLERSQAQEESTQSSRDKQK------------- 117
           +IK V   +   +  +  NL  +N  ++ + S       +   +KQK             
Sbjct: 59  DIKHVYEGKINTISQKYFNLQLENKKLKEKESGYLVAREKLVSEKQKEFDSNDALNSEIT 118

Query: 118 -IQNEVESLQEKLSDLD-QERET---LKQDKREV-------------VAVLEEKI----K 155
            I+ ++E++Q   + L+ +ER+T   L+Q K E+             + V E K+    +
Sbjct: 119 LIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQDSLTENSALKEQIGVFEGKLDSMTQ 178

Query: 156 ELESFRTESRKSLDDSKRLRQQVLELETTVQNLKSKELRDQSEIQTITQRLTILQKNSQW 215
           EL    TE++K     K LR+  L LE     +K KE     ++ +  +  + LQ     
Sbjct: 179 ELWLANTENKKLQTGMKLLRENNLYLE-----IKCKETDKNKKLYSSAEDASRLQ----- 228

Query: 216 LEEEVTSKTEQLISTRRKNDDELDRLTSESLSCKNELQLEKSRNQVITTKNEELTKSLQE 275
                               D+L  ++SE LS K+E+         +   NE L+  LQ 
Sbjct: 229 --------------------DQLQIVSSEILSLKSEI-------ATLKYMNESLSTDLQR 261

Query: 276 KLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLENQVKSLQGELNASLDKDNVELLASGE 335
           KL  +KDL D+L   KQEFA E+++KQ++ +LL N++ S          K  +E L S  
Sbjct: 262 KLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASY---------KKQIERLTSKN 312

Query: 336 RNTENEKLIQELITXXXXXXXXXXXXXXXXXXXXXXIPGDDSQDDINNTSSFISLRNKDS 395
             T  +K+IQEL+                       I  D+ +         IS      
Sbjct: 313 LETPEKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKK--------LISKFGNPK 364

Query: 396 SLRDMGILKKELIKERHQKERLQRQVESFIVELEYKIPVINSFKERTSMLEKELNDVALL 455
            L  + IL+++L+KE+  K+ LQRQVESF+VELE K+P+I+SFKER S LE+EL  +   
Sbjct: 365 KL--IEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSS 422

Query: 456 LDHTSNEKEKREREFEALSKKVKDSESSIHTLTRQRTDLAHQVQFLLMNISVQVDSGGLL 515
           L+ T+ E++ ++RE   L KK+ ++E     L RQR+DLAHQVQ+LL+ I    D+    
Sbjct: 423 LEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCI----DNKSPF 478

Query: 516 SAEEVSFIKRIVNNDDPNSESDSQRVISERLVEFNNIATLQEKNMELLKTVRKLAEKLES 575
           + +E + +K+IV+N++  +++DS ++IS+RL+ F N+  LQ+KNMELL+T R+L + LE 
Sbjct: 479 TEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMELLRTTRQLVQTLER 538

Query: 576 EEKDVNKKIQTFENDTIKE-AKEAIVSLQDYNANLESKVEILTKECDAFKAICS 628
           +E++  K ++  +N+ I E AK   V L+ +   LESK+ I+++E D++K + +
Sbjct: 539 QEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVT 592

 Score =  187 bits (474), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 166/443 (37%), Positives = 229/443 (51%), Gaps = 55/443 (12%)

Query: 1272 PLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPEDHKELKEKVSILE 1331
            PLE E+N L   V EK+Q LN+ +EE  RWK RSQ IL +   ++ E H +  EK+  LE
Sbjct: 1106 PLEQEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLE 1165

Query: 1332 TKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAKSELEGKFEAEE 1391
             +L+    EN +L DRF+RLKKQAHEKL+++K  Q  L+ Q+NEL E K  LE   + E 
Sbjct: 1166 EQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQE- 1224

Query: 1392 RKVHELQERLNAHGNDTETVESVQKELSDALEHSRELEQNLSATLQQNEEITKKLNDEID 1451
              + +  +  N   +++E +  ++ EL  +   S ELE+ +        E  KK  +EI+
Sbjct: 1225 --IEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELEKKV--------EDAKKFKNEIE 1274

Query: 1452 SLKLELHSLKEQSAATAKGEISEDL--------SNVVESMRRSF----EEEKINFXXXXX 1499
            SLK EL S+K    +T   +I +DL          ++E M++ F    E+EK        
Sbjct: 1275 SLKSELQSVKAYENSTVNSKIIKDLKESFKREKDELIEQMKKEFKTKLEKEK-------- 1326

Query: 1500 XXXXXXXXXXHTLQVNGNEPQQQPVNYEEIKRQWESEQEESILKRIAEAEENLKKRIRLP 1559
                      + +  NG    Q+  N EE+K++WE EQE  ILKRI EAEENLKKR+RLP
Sbjct: 1327 --ETILAQRKNNILANG----QESANIEELKKKWEEEQEALILKRITEAEENLKKRMRLP 1380

Query: 1560 TEERIKQVVXXXXXXXXXXXXXXXXXXXXXXXXXDGNN--SXXXXXXXXXXXXXFEAEVQ 1617
            +EE+I  V+                         DGN   +             F  E+ 
Sbjct: 1381 SEEKINAVI---EKRRKVLEQEFETKLRELGLNADGNGVVTDTRAQIEKELREKFNLELA 1437

Query: 1618 AVKKKAFEEGKQQAAMKSTLLERKISKLESQLHGKXXXXXXXXXXXXXXXXPNLPSKIDE 1677
             +KKKAFEEGKQQ+ MKSTLLERK+SKLESQ                      +PSKI+ 
Sbjct: 1438 EIKKKAFEEGKQQSMMKSTLLERKLSKLESQ--------TLSPTKNNDSNETQVPSKINL 1489

Query: 1678 KSVTTNQSVPNPLVSGEKVLKLD 1700
             ++  N S P PL  GEKVL+L+
Sbjct: 1490 SNI--NSSSP-PL--GEKVLQLN 1507

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
           (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score =  206 bits (524), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 149/465 (32%), Positives = 255/465 (54%), Gaps = 35/465 (7%)

Query: 413 QKERLQRQVESFIVELEYKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEA 472
           Q   L+  +++++ ELE ++P+I +FK     L+  LN   L+++   N+K++  +  ++
Sbjct: 210 QNNGLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMDS 269

Query: 473 LSKKVKDSESSIHTLTRQRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDDP 532
           + K + +  SSI  L  QRTDLAHQ+Q+LL++ S+Q D+ G LS  E+ F++ ++N D  
Sbjct: 270 MKKTINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDKQ 329

Query: 533 NSESDSQRVISERLVEFNNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTI 592
              SD Q VIS+RL++F +I +LQEKNMEL K++R LA  LES+E ++    + ++NDTI
Sbjct: 330 RLSSDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDTI 389

Query: 593 KEAKEAIVSLQDYNANLESKVEILTKECDAFKAIC--SRNGSDQNGSLSANGTQGNRNGS 650
            EAKE I+SLQ+YN  L+ ++  L  +    ++    S+    Q+ +  +N         
Sbjct: 390 NEAKETILSLQEYNNVLKLEIGTLQSKISELQSSIPNSKESEKQHFNYHSNL-------- 441

Query: 651 SDEEKLRTLEARLTSLTVESSQNNKMLNNEIHELYRSKTQISIELEKERSSKTLTEERLK 710
                ++ LE++L+ L+  S    + LN +I  LY  +T I I LEKE+SS  L  E+L 
Sbjct: 442 -----VKDLESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLT 496

Query: 711 LIQHTLELTRNENQQLVKRSQNLQSIFDRQDSRTAETVNELIACNS-------KLAVLET 763
           L+Q++ +L   EN++L  ++  L+   + ++      +N+ I C +       +L +L  
Sbjct: 497 LLQNSYDLLTLENEELSSKNSMLEQQLNEEEKNLNSVLNDYIKCKTNLLDFTNRLTLLNN 556

Query: 764 KVANLETEKELLQSSERTSRENYLKLSEERNSLRIMVSQLQTLQSEREKF---LKEIQTT 820
               LE E   L+   +++ E    L  +   L       Q+L++E  K+   +KE++  
Sbjct: 557 NKLGLEEENNSLKQEIKSNYEQIKDLDSKSKHLE------QSLENEISKYTDKVKELEL- 609

Query: 821 YKENLDSLEQEKADARARLDAKTKEAEDMENSKRTQIQWYQDKLD 865
              N+  L ++K     +L  K  E +D+ +S   QI WYQ KLD
Sbjct: 610 ---NISKLNEQKLILERKLQNKNIEIDDLNSSNYDQISWYQKKLD 651

 Score =  176 bits (447), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 180/644 (27%), Positives = 294/644 (45%), Gaps = 107/644 (16%)

Query: 1121 RQLETSRQHLEDLSTQNSLLYDQIELFSKDNSDGVNGETAEVREILTNLRRERDILGTKL 1180
            ++LE ++  +++L+TQN LL +++E               EV +I  +LR ERD L  ++
Sbjct: 726  KELEDTKVRVQNLATQNRLLLEKLE----------RSANLEVDDIFVSLRYERDTLSDQV 775

Query: 1181 TVSQREEQTLRGSLASVENELDTTKRQLSQFQKE---ITTHSELIGQHEKIIEQLNQLNL 1237
               +++ Q +   L SV++EL+    Q+  F+ +   +  H +     E +IE+L +L+ 
Sbjct: 776  VNYEKDMQVILADLESVQSELNAANSQILNFENQRAMVQDHKKGNVNEETLIEKLTELDE 835

Query: 1238 LRESNITXXXXXXXXXXXXXXXXXXXXXXXXXILPLESELNTLHTSVLEKDQQLNLYKEE 1297
            L+E N+                          + PLE++++ L+  + +KD  +N+  E+
Sbjct: 836  LKERNMELTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIEDKDNIINVSNEK 895

Query: 1298 ANRWKERSQEILHKHDRIDPEDHKELKEKVSILETKLDETNKENKELDDRFNRLKKQAHE 1357
            A  WK R  E+       D ED   L+++V       +E +KEN+EL DRFNRLKKQA+E
Sbjct: 896  AENWKTRFNELTLSAKNNDNEDLINLQKQV-------EEKSKENEELSDRFNRLKKQANE 948

Query: 1358 KLNSSKIAQTTLSNQLNELREAKSELEGKFEAEERKVHELQERLNAHGNDTETVESVQKE 1417
            +L++SK+AQ  L+ Q NEL+   ++LE     +  +  EL+  ++    +  ++  ++++
Sbjct: 949  RLHASKVAQNNLTEQSNELKARNTDLERNLSEQMERFKELENSISLKDQELGSIGDLKEQ 1008

Query: 1418 LSDALEHSRELEQNLSATLQQNEEITKKLNDEIDSLKLELHSLKEQSAATAKGEISEDLS 1477
            L++AL+ S++ E+ L  T+ ++E +   L +EI+SL  +L S KE S    + EI     
Sbjct: 1009 LANALDKSKKFEEELIKTVSESESLVSDLKNEIESLNEKLKS-KESSVGLQESEIENAKK 1067

Query: 1478 NVVESMRRSFEEEKINFXXXXXXXXXXXXXXXHTLQVNGNEPQQQPVNYEEIKRQWESEQ 1537
             ++  +     EEK+N                H                EE+K   ++E 
Sbjct: 1068 ILIAEL-----EEKLN-------KTKSELDLKHK---------------EELKV-LKTEY 1099

Query: 1538 EESILKRIAEAEENLKKRIRLPTEERIKQVVXXXXXXXXXXXXXXXXXXXXXXXXXDGNN 1597
            E  I KR+AEAEE LK++IRLP+EE+I  ++                         +   
Sbjct: 1100 EGDIQKRVAEAEEALKRKIRLPSEEKINTIIESKVADLEEDYKKKLETVSAESTDIEK-- 1157

Query: 1598 SXXXXXXXXXXXXXFEAEVQAVKKKAFEEGKQQAAMKSTLLERKISKLESQLHGKXXXXX 1657
                          FE  +   KKKAFEEGKQQA+MK+  LE KI+KLESQL        
Sbjct: 1158 ----------IKQEFEDNLVNAKKKAFEEGKQQASMKTKFLENKIAKLESQLQ------- 1200

Query: 1658 XXXXXXXXXXXPNLPSKIDEKSV---TTNQSVPNPLVSGEKVLKLDPSKXXXXXXXXXXX 1714
                        N  S + +K     TT+    NP +  ++     PS            
Sbjct: 1201 ------------NNESDVTDKEAEVKTTDNEKSNPELDKQEA---KPS------------ 1233

Query: 1715 XXXXXXPQNNDTMGT--------SAFGFKPTFTLSNNSNKSSGT 1750
                  P N++   T        S FG KPTF+L  N  K S  
Sbjct: 1234 -FTFSPPPNSNPFTTTQDTDSPVSVFGIKPTFSLGANPFKISPV 1276

>TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1284

 Score =  129 bits (324), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 129/480 (26%), Positives = 248/480 (51%), Gaps = 28/480 (5%)

Query: 399 DMGILKKELIKERHQKERLQRQVESFIVELEYKIPVINSFKERTSMLEKELNDVALLLDH 458
           D  ILKKE+ K   Q++ LQ ++E  I ELE   P +N+  ++       +N++ LLL  
Sbjct: 297 DFIILKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNNQYDK-------INELELLLSK 349

Query: 459 TSNEKEKR-------EREFEALSKKVKDSESSIHTLTRQRTDLAHQVQFLLMNISVQVDS 511
             N  E         E E + +  ++K S+  I TL  +  DL +Q+QF+L++ S+Q D 
Sbjct: 350 EKNTSEHFKTTIKEIENEKKNIISRLKLSDDKIETLREENNDLTNQIQFMLISNSIQNDK 409

Query: 512 GGLLSAEEVSFIKRIVNNDDPNSES---DSQRVISERLVEFNNIATLQEKNMELLKTVRK 568
            G L+  E+ FIK +       S +   +SQ +IS+RL+ F ++ +LQ+KNMEL+KT+R 
Sbjct: 410 YGELTENEIKFIKALREKGTETSFNELYNSQDIISDRLIRFESVISLQQKNMELIKTLRL 469

Query: 569 LAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQDYNANLESKVEILTKECDAFKAICS 628
           + +KL+++E ++  K +   +D + EAKE I+ +   +  L+ K+  L ++ +A + +  
Sbjct: 470 ITKKLDNQEHELRAKWEAENDDVLNEAKEEILKVVSESDKLKEKISELQQQLNANRPVSH 529

Query: 629 -RNGSDQNGSLSANGTQGNRNGSSDEEKLRTLEARLTSLTVESSQNNKMLNNEIHELYRS 687
            +NG +   + +   T+G+R        L  L+  +   T ++S    M  +++  LY  
Sbjct: 530 EKNGHESVLAENKLYTEGDR------LILDELKNNIPEFTKQASNIISMNFDQLTSLYNK 583

Query: 688 KTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQLVKRSQNLQSIFDRQDSRTAET 747
             +++ +  K   S+ +T+++L L+Q   +     N++L +  + ++    R+D     T
Sbjct: 584 NLELTADRLKAYQSRDITQKKLDLLQDKYDYLSISNEKLKEHMEVIKDTIRRKDETLNST 643

Query: 748 VNELIACNSKLAVLETKVANLETE-KELLQSSERTSR-ENYLKLSEERNSLRIMVSQLQT 805
           +   + C + L  +   + +L T+  EL    ++ SR  N LK+  ER  L++ +  ++T
Sbjct: 644 IANHVDCKASLLSVTNDMNSLMTKYDELKYLKDQQSRITNELKM--EREQLKMELLNIKT 701

Query: 806 LQSEREKFLKEIQTTYKENLDSLEQEKADARARLDAKTKEAEDMENSKRTQIQWYQDKLD 865
           +Q + +    E + +    ++ LE   ++    L  K +E +D  ++K  ++ WYQ K D
Sbjct: 702 VQIQSDLESAEYKASVASKINDLEITNSNLSKDLRTKEQELQDFISTKNRELDWYQKKFD 761

 Score = 50.4 bits (119), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 44/63 (69%)

Query: 1339 KENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAKSELEGKFEAEERKVHELQ 1398
            KEN E  DRFNRLKKQA+ +L+SSK  Q  L+ Q++ L++  +E++ K E + + V EL+
Sbjct: 982  KENDENIDRFNRLKKQANARLHSSKEEQNALNEQISSLKKDLAEVQSKLEVQSKTVQELE 1041

Query: 1399 ERL 1401
             ++
Sbjct: 1042 TQI 1044

 Score = 37.4 bits (85), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 65/150 (43%), Gaps = 25/150 (16%)

Query: 1672 PSKIDEKSVTTNQS-VPNPLVSGEKVLKLDPSKXXXXXXXXXXXXXXXXXPQNNDTMGTS 1730
            PSK++  + TT  S +PN  ++        PS                  P NN    TS
Sbjct: 1154 PSKMESDTTTTKPSFLPNQNLTQ-------PSVTSSFTFSPLAMENPFTSP-NNAKTPTS 1205

Query: 1731 AFGFKPTFTLSNN---SNKSS-GTKIDSSSTENKPANPFSSFTETGASSPERESSNTAMT 1786
            +FG KP F+  +N   SN +S GTK+ S+   N     FS   +    +  +ESS  A+ 
Sbjct: 1206 SFGMKPAFSFGSNPFTSNTNSLGTKM-STPDSNSTGGLFSQKNDESKDTASQESS--AID 1262

Query: 1787 PTPGEGASTPSKRAAEDDDNEVGSESKKPR 1816
               G       KR +E +DN   SE+KK +
Sbjct: 1263 TNAG-------KRNSESEDN--SSETKKTK 1283

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1183

 Score =  102 bits (255), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 70/210 (33%), Positives = 130/210 (61%), Gaps = 11/210 (5%)

Query: 403 LKKELIKERHQKERLQRQVESFIVELEYKIPVI--NSFKERTSMLEKELNDVALLLDHTS 460
           +K ELIKE+++K  L+++   F+ ++E K+P +  NS +  T+   K + +  ++ +H S
Sbjct: 286 IKTELIKEKYEKSLLEKKFNDFLFDIESKLPYLQNNSVENETNNGNK-IEEQKIIHEHDS 344

Query: 461 NEKEKREREFEALSKKVKDSESSIHTLTRQRTDLAHQVQFLLMNIS-VQVDSGGLLSAEE 519
                 + E ++L  K+ D ES++ TL +QR+DL HQ+ +LL+  S +  D+  +L+  E
Sbjct: 345 -----LKLENQSLKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENE 399

Query: 520 VSFIKRIVNNDDPNSESDSQRVISERLVEFNNIATLQEKNMELLKTVRKLAEKLESEEKD 579
           ++FI+ +V        +++Q +ISERL++F+N++ L  KN++L+  VR+L  K+ES EK 
Sbjct: 400 LNFIRNLVAQPTNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQ 459

Query: 580 VNKKIQTFEND--TIKEAKEAIVSLQDYNA 607
            ++K    E D  +I EAK+ ++ L++ N 
Sbjct: 460 NSQKFGDLEMDFKSIDEAKQRMIVLKEENV 489

>Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON}
           (206286..209306) [3021 nt, 1007 aa]
          Length = 1006

 Score = 50.8 bits (120), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 64/249 (25%), Positives = 113/249 (45%), Gaps = 56/249 (22%)

Query: 397 LRDMGILKKELIKERHQKERLQRQVESFIVELEYKIPVINSFKERTSMLEKELNDVALLL 456
           L D  +LKK L+ E++   +LQ ++ S ++EL +K+P + S KE+   L+    ++    
Sbjct: 206 LNDNKVLKKLLVHEKNSNLKLQEELNSILLELNFKLPSLTSLKEKNHELQSVFENII--- 262

Query: 457 DHTSNEK-----EKREREFEALSKKVKDSESSIHTLTRQRTDLAHQVQFLLMNISVQVDS 511
             +SNE+          +  +++ K+ D E S+  L  QRT+L   + ++L  ++V   +
Sbjct: 263 --SSNEELLQQFHSNTDKIASMNNKIVDYEQSLKQLLSQRTNL---ISYILNLLNVINLN 317

Query: 512 GGL--LSAEEVSFIKRIVNNDDPNSESDSQRVISERLVEFNNIATLQEKNMELLKTVRKL 569
                LS  E   I+ + NN              ER+  F     LQEKN+    T+ ++
Sbjct: 318 SKYLNLSESEGCLIQNLFNN--------------ERIQRF-----LQEKNL----TLTEI 354

Query: 570 AEKLESEEKDVNKKIQTFENDTIK-------EAKEAIVSLQDYNANLESKVEILTKECDA 622
            + L +    V+     F    IK        +KE I+       N ++++ +L   CDA
Sbjct: 355 FDNLNT----VDITFNNFNRSDIKVLPPTESASKEEII-------NYKNEIILLENNCDA 403

Query: 623 FKAICSRNG 631
           +K I   NG
Sbjct: 404 YKMILYNNG 412

 Score = 38.5 bits (88), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 43/72 (59%)

Query: 1330 LETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAKSELEGKFEA 1389
            L+   +E +KE +E +D+F+RLK+QA+E+LN+SK  Q  LS+ +  L + ++  +     
Sbjct: 653  LKKSFEEKSKEVEEANDKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHISK 712

Query: 1390 EERKVHELQERL 1401
             E  ++ L   L
Sbjct: 713  LEVDINNLNNAL 724

>KLTH0D09504g Chr4 (783223..785379) [2157 bp, 718 aa] {ON} weakly
           similar to uniprot|Q08581 Saccharomyces cerevisiae
           YOR195W SLK19 Kinetochore-associated protein required
           for normal segregation of chromosomes in meiosis and
           mitosis component of the FEAR regulatory network which
           promotes Cdc14p release from the nucleolus during
           anaphase potential Cdc28p substrate
          Length = 718

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 66/237 (27%), Positives = 110/237 (46%), Gaps = 31/237 (13%)

Query: 694 ELEKERSSKTLTEERLKLIQHTLELTRNENQQLVKRSQNLQSIFD---RQDSRTAETVNE 750
           E+EK  + KT  EER+  ++  L   RNE + + + SQ LQ  F    +Q+ R    V+E
Sbjct: 262 EIEKLSTEKTSLEERVSRLKLRLSEARNEMKMINQNSQILQEKFQTQIQQNERLQNQVSE 321

Query: 751 LIACNSKLAVLETKVANLETEKELLQSSERTSRE------NYLKLSEERNSLRIMVSQLQ 804
           L    ++L V      N  ++K + +  ERT  E         K   E   L++ VS+ Q
Sbjct: 322 LEDSENQLRVHIENTTN--SKKRVEEEIERTRAELALLTEGKFKTQSENEDLKLSVSKAQ 379

Query: 805 TLQSEREKFLKEIQTTYKENLDS-------LEQEKADARARLDAKTKEAEDMENSK---- 853
           TL +E+ KF++E+Q   + + D+       LEQ   D     +   +E EDM   +    
Sbjct: 380 TLLAEKTKFIEELQANLRASHDTKQKSTIELEQRINDLTLEKNELVRELEDMSTLRSKIE 439

Query: 854 --RTQIQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVEESEARIQS 908
               +IQ  + +LD      QHLK+E        ++L    R LE +++ S  ++++
Sbjct: 440 ESENEIQSVKTELDRTQVALQHLKEE-------HSELREHCRSLEAELKTSHQKLET 489

>SAKL0E06930g Chr5 complement(573913..574932) [1020 bp, 339 aa] {ON}
           similar to uniprot|P53112 Saccharomyces cerevisiae
           YGL153W PEX14 Peroxisomal membrane protein that is a
           central component of the peroxisomal protein import
           machinery interacts with PTS1 (Pex5p) and PTS2 (Pex7p)
           peroxisomal matrix protein signal recognition factors
           and membrane receptor Pex13p
          Length = 339

 Score = 40.0 bits (92), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 52/85 (61%), Gaps = 13/85 (15%)

Query: 106 EESTQSSRDKQKIQNEVESLQEKLSDLDQERETLKQDKREVVAVLEEKIKELESFRTESR 165
           E  T+ ++DK++I  + + +++ LS ++QE+ET +Q +       EEK+KEL+    E +
Sbjct: 120 EPKTKLAQDKEEILGQFDKVEKLLSSIEQEQETYRQQE-------EEKLKELDKTVVELQ 172

Query: 166 KSLDDSKRLRQQV------LELETT 184
            +LDD+ R RQ++      L+LE T
Sbjct: 173 TTLDDTSRTRQRIEDEFRMLKLEMT 197

>Ecym_4169 Chr4 (359440..361047) [1608 bp, 535 aa] {ON} similar to
            Ashbya gossypii AGL116C
          Length = 535

 Score = 39.7 bits (91), Expect = 0.075,   Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 1730 SAFGFKPTFTLSNNSNKSSGTKIDSSSTENKPANPFSSFTETGASSPERESSNTAMTPTP 1789
            +AFGF      SN  NK+SG  + +S  E KP +PF+       SS  +  S ++ T   
Sbjct: 432  NAFGFGQNGMTSNLFNKTSGANLPASHFEQKPPDPFNGIKNVFNSSSNQPVSTSSATSFV 491

Query: 1790 GEGASTPSKRAAEDD 1804
             +G  T   +  EDD
Sbjct: 492  -QGLPTADDKITEDD 505

>SAKL0H03300g Chr8 (309151..314274) [5124 bp, 1707 aa] {ON} similar to
            uniprot|P25386 Saccharomyces cerevisiae YDL058W USO1
            involved intracellular protein transport coiled-coil
            protein necessary for protein transport from ER to Golgi
            Integrin analogue gene
          Length = 1707

 Score = 38.9 bits (89), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 113/219 (51%), Gaps = 40/219 (18%)

Query: 112  SRDKQKIQNEV-ESLQEKLSDLDQERETLKQDKREVVAVLEEK---IKELESFRTESRKS 167
            +++KQ ++NE+ +S +E     +Q  +  K+D++ +   L +K   +K+L+ F T     
Sbjct: 843  TKEKQDLENEINKSGKEN----EQRLQKFKKDEKRLSEGLAQKDAEVKKLQEFVT----- 893

Query: 168  LDDSKRLRQQVLELETTVQNLKSK--ELRDQSE-----IQTITQRLTILQKNSQWLEEEV 220
                 RL+ Q+ ELET+   L S+   LR + E     I  +T++L  L KN + LE+E 
Sbjct: 894  -----RLQNQIQELETSKNELSSELNSLRPRFESHNALIPKLTEKLKSLAKNFKQLEQEK 948

Query: 221  TSKTEQLISTRRKNDDELDRLTSESLSCKNELQLEKSRNQVITTKNEELTKSL----QEK 276
               +++L+S  + ND+E+  L SE  +  +E+       + +  + E+  K +    QE 
Sbjct: 949  ELISQELVSKGKFNDEEISSLKSEISTLASEI-------ETLVGQKEDFEKKVTHLGQEV 1001

Query: 277  LMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLENQVKSL 315
              ++K L DS    K +   E+S  QK ID L  QVK++
Sbjct: 1002 ASKVKLLQDS----KIDHDSEVSSLQKTIDSLNAQVKTI 1036

>YDR192C Chr4 complement(843569..844861) [1293 bp, 430 aa] {ON}
            NUP42FG-nucleoporin component of central core of the
            nuclear pore complex (NPC); also part of the NPC
            cytoplasmic filaments; contributes directly to
            nucleocytoplasmic transport and maintenance of the NPC
            permeability barrier and is involved in gene tethering at
            the nuclear periphery; interacts with Gle1p
          Length = 430

 Score = 37.4 bits (85), Expect = 0.41,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 45/90 (50%), Gaps = 6/90 (6%)

Query: 1724 NDTMGTSAFGFKPTFTLSNNSNKSSGTKIDSSSTENKPANPFSSF-TETGASSPERESSN 1782
            N +  +SAFG KPTF  + N+    GT  ++S++     +PF +F T +   SP     +
Sbjct: 194  NASSTSSAFG-KPTFGAATNTQSPFGTIQNTSTSSGTGVSPFGTFGTNSNNKSPFSNLQS 252

Query: 1783 TAMTPTPGEGASTPSKRAAEDDDNEVGSES 1812
             A   +   G +T    +  +++N VGS +
Sbjct: 253  GAGAGSSPFGTTT----SKANNNNNVGSSA 278

>TDEL0A05490 Chr1 (962132..964477) [2346 bp, 781 aa] {ON} Anc_8.604
            YOR195W
          Length = 781

 Score = 36.2 bits (82), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 82/154 (53%), Gaps = 20/154 (12%)

Query: 1318 EDHKE-LKEKVSILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNEL 1376
            EDH E L+E++S L+ +L   N E         RL+KQ  E +++ K A   +  +LNE+
Sbjct: 421  EDHNEKLREEISDLKERLTTKNGE-------LERLQKQLDETISAGKGANDEVLAELNEV 473

Query: 1377 REAKSELEGKFEA----EERKVHELQERLN-AHGNDTETVESVQKELSDALEHSRELEQN 1431
               ++ LE + EA     E   ++L+++L+ A       V  VQ EL D   HS  L+  
Sbjct: 474  IAQRANLEAELEALRVASEADGNKLRDQLHEAVTRSNLMVLEVQ-ELKD---HSDGLQAG 529

Query: 1432 LSATLQQNEEITKK---LNDEIDSLKLELHSLKE 1462
            L+A + + E+++KK   LND+ +  K E+  L+E
Sbjct: 530  LNARVSEIEQMSKKIEELNDDAEIGKAEIKELQE 563

>Skud_4.457 Chr4 complement(810243..811535) [1293 bp, 430 aa] {ON}
            YDR192C (REAL)
          Length = 430

 Score = 35.4 bits (80), Expect = 1.4,   Method: Composition-based stats.
 Identities = 24/70 (34%), Positives = 35/70 (50%), Gaps = 5/70 (7%)

Query: 1724 NDTMGTSAFGFKPTFTLSNNSNKSSGTKIDSSSTENKPANPFSSFTETGASSPERES-SN 1782
            N +  +SAFG KP FT ++N+    G   ++S+     A PF SF   GA+S  +    N
Sbjct: 190  NPSSTSSAFG-KPAFTTTSNTQSPFGAIQNTSANAGTGAAPFGSF---GANSNNKSPFGN 245

Query: 1783 TAMTPTPGEG 1792
                 +PG G
Sbjct: 246  LQSGASPGFG 255

>KAFR0A07360 Chr1 complement(1485231..1486403) [1173 bp, 390 aa]
           {ON} Anc_2.98 YNL160W
          Length = 390

 Score = 35.0 bits (79), Expect = 2.0,   Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 2/60 (3%)

Query: 29  FYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTIDEIKTVSSKREEGLKNEIE 88
           F  VPE+  V++ GGI+ IL    L++  L + +L LN T  ++  VS+  +E L N+ +
Sbjct: 108 FPAVPEELQVVVTGGIVPILNQTHLNYTVLFNTSLPLNAT--QLYNVSATVDELLTNDTK 165

>TDEL0E04360 Chr5 complement(809654..811633) [1980 bp, 659 aa] {ON}
            Anc_5.193 YGR186W
          Length = 659

 Score = 35.0 bits (79), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 36/77 (46%), Gaps = 10/77 (12%)

Query: 1738 FTLSNNSNKSSGTKIDSSSTENKPANPFSSFTETGASSPERESSNTAMTPTPGEGASTPS 1797
            F    + +K  G K ++ S     A P  +   T AS         AM+PTP  G S P 
Sbjct: 144  FKNKQDHDKDVGVKRETESETPNAATPIETKENTPAS---------AMSPTPASGTSVPP 194

Query: 1798 KRAAEDDDNEVGSESKK 1814
             RA+ + D+EV SE KK
Sbjct: 195  -RASTNGDSEVKSEVKK 210

>YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subunit
           of the multiprotein cohesin complex, essential protein
           involved in chromosome segregation and in double-strand
           DNA break repair; SMC chromosomal ATPase family member,
           binds DNA with a preference for DNA with secondary
           structure
          Length = 1225

 Score = 34.3 bits (77), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 67/255 (26%), Positives = 119/255 (46%), Gaps = 40/255 (15%)

Query: 84  KNEIENLMKDNDSIRLERSQAQEESTQSSRDKQKIQNEVESLQEKLSDL----DQERETL 139
           K E ++LM   D + ++  +       +S   ++++N V  L   +++L     Q++ +L
Sbjct: 679 KEEYQSLMSLKDKLLIQIDELSNGQRSNSIRAREVENSVSLLNSDIANLRTQVTQQKRSL 738

Query: 140 KQDKREVVAVLEEKIKELESFRTESRKSLDDSKRLRQQVLELETTVQNL-KSKELRDQSE 198
            +++ E+    +   KE++   TE +K LDD          LE T  NL K KE    + 
Sbjct: 739 DENRLEIKYHNDLIEKEIQPKITELKKKLDD----------LENTKDNLVKEKEALQNNI 788

Query: 199 IQTITQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDRLTSESLSCKNELQLEKSR 258
            +  T ++    K       E  + + +L+   R+   EL +L  + L+ +N+LQ E  R
Sbjct: 789 FKEFTSKIGFTIK-------EYENHSGELM---RQQSKELQQLQKQILTVENKLQFETDR 838

Query: 259 NQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEM---SMKQKL------IDLLE 309
                 + E+  K L+   +EMK L      E+QE+A EM   S++ KL      +D L+
Sbjct: 839 LSTTQRRYEKAQKDLENAQVEMKSL------EEQEYAIEMKIGSIESKLEEHKNHLDELQ 892

Query: 310 NQVKSLQGELNASLD 324
            +  + Q ELN+S D
Sbjct: 893 KKFVTKQSELNSSED 907

>Kpol_1042.19 s1042 (43301..43636,43639..44628) [1326 bp, 441 aa]
           {ON} (43301..43636,43639..44628) [1326 nt, 442 aa]
          Length = 441

 Score = 33.9 bits (76), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 52/92 (56%), Gaps = 16/92 (17%)

Query: 50  NKVLDFNELKSQNLRLNVTIDEIKTVSSKREEGLKNEIENLMKDNDSIRLERSQAQEEST 109
           N +L  N+L      +   I+EI  +SS+ ++G+ +E+++  K  +++RL+R   Q ES 
Sbjct: 174 NSLLKLNKLIEYKFHI---INEIADISSRVQDGMNHEVKH--KRWENVRLQRYIRQLESR 228

Query: 110 QSSRDKQKIQNEVESLQEKLS------DLDQE 135
            S + +     E++ LQEKLS      ++DQE
Sbjct: 229 TSKKHR-----ELKRLQEKLSVNEIEQEIDQE 255

>SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} similar
           to uniprot|P38125 Saccharomyces cerevisiae YBR180W DTR1
           Multidrug resistance dityrosine transporter of the major
           facilitator superfamily essential for spore wall
           synthesis facilitates the translocation of bisformyl
           dityrosine through the prospore membrane
          Length = 596

 Score = 33.9 bits (76), Expect = 4.9,   Method: Composition-based stats.
 Identities = 29/119 (24%), Positives = 56/119 (47%), Gaps = 14/119 (11%)

Query: 66  NVTIDEIKTVSS------------KREEGLKNEIENLMKDNDSIRLERSQAQEESTQSSR 113
           ++ +DEIK+  S              EE + +E +++   ND I  E+ +   E +  S 
Sbjct: 9   SIIMDEIKSGDSTPLGDPTEWVLVNPEENINSE-QHIQSKNDLIEQEKVEVSSEKSFHSS 67

Query: 114 DKQKIQNEVESLQEKLSDLDQERETLKQDKREVVAVLEEKIKELESFRTESRKSLDDSK 172
           D Q ++   + LQ+  S + +  E +++  +E + + E++I    S    S KS + SK
Sbjct: 68  DSQIVKLVNKPLQKVPSPIIESEEDIEKKSKEELKI-EKRIATATSTEETSLKSANRSK 125

>TDEL0E01330 Chr5 (260599..265572) [4974 bp, 1657 aa] {ON} Anc_4.238
            YDL058W
          Length = 1657

 Score = 33.9 bits (76), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 54/166 (32%), Positives = 87/166 (52%), Gaps = 21/166 (12%)

Query: 1315 IDPEDHKELKEKV-SILET--KLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSN 1371
            I+ +D  +LKEK+   +ET  KL+   KEN  LD R  +LK +  E + + ++   TLS+
Sbjct: 1399 INAKDLNQLKEKLQCFVETMNKLETLEKENAVLDQRVKKLKNEKEETVKNLEVKLETLSS 1458

Query: 1372 QLNELREAKSELEGKFEAEERKVHE---LQERLNAHGNDTETVESVQKELSDALEHSREL 1428
            +   L+E       K + +   +++   L+E  N+     E++E    EL+DA + S  L
Sbjct: 1459 EKQSLKE-------KLQGQSISLNDNESLREENNSLKKKIESLE----ELTDACDKS--L 1505

Query: 1429 EQNLSATLQQNEEITKKLNDEIDSLKLELHSLKEQSAATAKGEISE 1474
            E++ S  +Q  E I K LN    +LK EL  LKE + A ++  I E
Sbjct: 1506 EESKSMIVQHEEGI-KSLNSINSTLKSEL-DLKESALALSEKLIQE 1549

>KLLA0F20702g Chr6 complement(1927059..1929767) [2709 bp, 902 aa] {ON}
            uniprot|Q9C403 Kluyveromyces lactis Putative EBS1- like
            protein
          Length = 902

 Score = 33.9 bits (76), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 37/78 (47%), Gaps = 15/78 (19%)

Query: 1733 GFKPTFTLSNNSNKSSGTKIDSSSTENK----------PANPFSSFTETGASSPERESSN 1782
            GF   FT   NSN S G+ +D S++ +           PANP  ++  +G+S+P+   S 
Sbjct: 636  GFSVAFTTRENSNASGGSSMDMSTSPHYTEEAVKDNTTPANPVWNY--SGSSAPQPPLS- 692

Query: 1783 TAMTPTPGEGASTPSKRA 1800
                 TP    ST  +R+
Sbjct: 693  --FNVTPSFSVSTTVERS 708

>NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5.88
           YGR238C
          Length = 1086

 Score = 33.9 bits (76), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 45/79 (56%), Gaps = 9/79 (11%)

Query: 148 AVLEEKIKELESFRTES-RKSLDDSKRLRQQVLELETTVQNLKSKELRDQSE----IQTI 202
           A+LE+   ELE  +T+   K+++ S R++    ELE  +QNLK+  +  Q E    +  +
Sbjct: 729 AMLEQMRSELEGLKTDGETKAIEASSRIQ----ELEAELQNLKANRMDKQVEPELDVVKL 784

Query: 203 TQRLTILQKNSQWLEEEVT 221
             R  +L+ N+  LE++VT
Sbjct: 785 QSRCDVLEGNNHILEDKVT 803

>TDEL0G04370 Chr7 complement(789063..791345) [2283 bp, 760 aa] {ON}
           Anc_6.32 YOL006C
          Length = 760

 Score = 33.5 bits (75), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 84/165 (50%), Gaps = 23/165 (13%)

Query: 752 IACNSKLAVLETKVANLETEKELLQSSERTSRENYLKLSEERNSLRIMVSQLQTLQSERE 811
           I CN + +V +T   +++      ++S++     + K+  ++  L++   Q++    ER 
Sbjct: 546 ILCNHQRSVTKTHAQSVQ------KASDKIRELEWQKIRLKKAILQLDKKQMK----ERP 595

Query: 812 KFLKEIQTTYKENLDSL-------EQEKADARARLDAKTKEAEDMENSKRTQIQWYQDKL 864
           KF +E++   KE+  ++       E EK   +   D   ++ E+ME  K + ++ + DK+
Sbjct: 596 KFFEEVEDITKEDEMAIHKRIIEREVEKCHKKFARDNDKRKFENMELLKESDLKEWLDKV 655

Query: 865 DSVVAESQHLKQELQTKTFLV-TDLESEVRKLEKQVEESEARIQS 908
                E Q L  E + KT +V   + S V KL+KQ+E+ + RIQ+
Sbjct: 656 -----EEQRLNFEQELKTGVVELKMASTVEKLDKQIEKLDQRIQN 695

>KAFR0G02090 Chr7 complement(437389..439587) [2199 bp, 732 aa] {ON}
           Anc_8.604 YOR195W
          Length = 732

 Score = 33.1 bits (74), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 65/129 (50%), Gaps = 8/129 (6%)

Query: 120 NEVESLQEKLSDLDQERETLKQDKREVVAVLEEKIKELESFRTESRKSLDDSKRLRQQVL 179
           NEV SLQE+  +L ++ E ++ DK   V++LE KI  L    +  +    + + L     
Sbjct: 414 NEVNSLQEERKELQKKLEKIELDKENEVSILESKISALNETISSLQSCQKEIENLNSTKT 473

Query: 180 ELETTVQNLKSK--ELRDQSEIQTITQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDE 237
            LE  +  LKSK  E+ D S I+T      + + NSQ   E +    +QL     K D+E
Sbjct: 474 NLENDLTALKSKFEEVNDNSSIRTA----EVTELNSQI--ESLRESNDQLQELNSKLDEE 527

Query: 238 LDRLTSESL 246
           ++ L SESL
Sbjct: 528 IEILKSESL 536

>SAKL0D06930g Chr4 complement(573700..575772) [2073 bp, 690 aa] {ON}
            similar to uniprot|P40368 Saccharomyces cerevisiae
            YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
            forms a subcomplex with Nup159p and Nsp1p interacts with
            Nup116p and is required for proper localization of
            Nup116p in the NPC
          Length = 690

 Score = 33.1 bits (74), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 54/105 (51%), Gaps = 11/105 (10%)

Query: 1295 KEEANRWKERSQEILHKHDRIDPEDHKELKEKVSILETKLDETNKENKELDDRFNRLKKQ 1354
            + E  R  ERS EILHK         K L+E+     ++ +  +K+ + +D RF +L+ +
Sbjct: 537  RYELTRQLERSSEILHK--------AKCLQERYPDQNSRWEHVSKKQENIDSRFEKLQSR 588

Query: 1355 AHEKLNSSKIAQTTLSN-QLNELREAKSE--LEGKFEAEERKVHE 1396
             +E  +S K+    +S  ++   +E KS+  L  KF  +++ V E
Sbjct: 589  LNEISSSGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQQQDVKE 633

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.304    0.122    0.307 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 172,951,269
Number of extensions: 7823441
Number of successful extensions: 89392
Number of sequences better than 10.0: 4084
Number of HSP's gapped: 74869
Number of HSP's successfully gapped: 11635
Length of query: 1820
Length of database: 53,481,399
Length adjustment: 124
Effective length of query: 1696
Effective length of database: 39,262,815
Effective search space: 66589734240
Effective search space used: 66589734240
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 73 (32.7 bits)