Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0G06578g5.703ON56956927530.0
TDEL0B021705.703ON56755714100.0
NCAS0G002205.703ON59256513261e-177
Suva_9.385.703ON56955813231e-177
KAFR0D022105.703ON58457413091e-175
YIL150C (MCM10)5.703ON57156013041e-174
Skud_9.185.703ON57156012881e-172
Smik_9.195.703ON57255812791e-170
Kpol_1043.715.703ON58556112641e-168
TPHA0E002105.703ON54451912241e-162
NDAI0F002805.703ON61058811851e-156
KNAG0L021505.703ON61659611831e-155
CAGL0H06589g5.703ON58357311671e-153
SAKL0E14938g5.703ON57456610961e-143
TBLA0G010205.703ON59458110781e-140
KLTH0E01034g5.703ON58356210301e-133
Kwal_55.196915.703ON4664499511e-122
AFR287W5.703ON6114608491e-105
KLLA0A00572g5.703ON5775587642e-93
SAKL0G12826g5.204ON33654760.98
Kpol_1010.465.123ON85473706.1
TBLA0E041508.223ON94378698.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0G06578g
         (569 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {...  1065   0.0  
TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {O...   547   0.0  
NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}...   515   e-177
Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON} Y...   514   e-177
KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {O...   508   e-175
YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}  MC...   506   e-174
Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON} Y...   500   e-172
Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON} Y...   497   e-170
Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON} (1515...   491   e-168
TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}...   476   e-162
NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}...   461   e-156
KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5....   460   e-155
CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} simila...   454   e-153
SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, ...   426   e-143
TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.7...   419   e-140
KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp...   401   e-133
Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON...   370   e-122
AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic ho...   331   e-105
KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp...   298   2e-93
SAKL0G12826g Chr7 (1097824..1098834) [1011 bp, 336 aa] {ON} high...    34   0.98 
Kpol_1010.46 s1010 complement(101192..103756) [2565 bp, 854 aa] ...    32   6.1  
TBLA0E04150 Chr5 (1045827..1048658) [2832 bp, 943 aa] {ON} Anc_8...    31   8.9  

>ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {ON}
           similar to uniprot|P32354 Saccharomyces cerevisiae
           YIL150C MCM10 Essential chromatin-associated protein
           involved in the initiation of DNA replication required
           for the association of the MCM2-7 complex with
           replication origins
          Length = 569

 Score = 1065 bits (2753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/569 (92%), Positives = 524/569 (92%)

Query: 1   MRDPREVLNNDLYDVLTSXXXXXXXXXXXXXXXXRQKKDLLQRLNVKKTNPKPLDPNLSH 60
           MRDPREVLNNDLYDVLTS                RQKKDLLQRLNVKKTNPKPLDPNLSH
Sbjct: 1   MRDPREVLNNDLYDVLTSEGEEENEIEAQIAEIERQKKDLLQRLNVKKTNPKPLDPNLSH 60

Query: 61  IQVESSPKKVTNSVLPPTVQQQEPRGEVRNENLNELKAQSQEQIPANTTSFFIEKYSTSK 120
           IQVESSPKKVTNSVLPPTVQQQEPRGEVRNENLNELKAQSQEQIPANTTSFFIEKYSTSK
Sbjct: 61  IQVESSPKKVTNSVLPPTVQQQEPRGEVRNENLNELKAQSQEQIPANTTSFFIEKYSTSK 120

Query: 121 RKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNLWISKRYIPKEEQRSIF 180
           RKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNLWISKRYIPKEEQRSIF
Sbjct: 121 RKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNLWISKRYIPKEEQRSIF 180

Query: 181 ANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSAASPKKYFKFTLTNFQ 240
           ANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSAASPKKYFKFTLTNFQ
Sbjct: 181 ANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSAASPKKYFKFTLTNFQ 240

Query: 241 YSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSGTKAHIKSFNLRISHKFECILE 300
           YSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSGTKAHIKSFNLRISHKFECILE
Sbjct: 241 YSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSGTKAHIKSFNLRISHKFECILE 300

Query: 301 IGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKFRSTNAKRVELSGTYALGAP 360
           IGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKFRSTNAKRVELSGTYALGAP
Sbjct: 301 IGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKFRSTNAKRVELSGTYALGAP 360

Query: 361 TRIDAQPALYRGGSSQKNLNYNIITNGADGGSNKEINPLDINARHFSNRNAAKAFFDERF 420
           TRIDAQPALYRGGSSQKNLNYNIITNGADGGSNKEINPLDINARHFSNRNAAKAFFDERF
Sbjct: 361 TRIDAQPALYRGGSSQKNLNYNIITNGADGGSNKEINPLDINARHFSNRNAAKAFFDERF 420

Query: 421 QNPETXXXXXXXXXXXXXXXXSNILNRELKKNSELDIKHKSAEEIDEIKRTTESTMGSGM 480
           QNPET                SNILNRELKKNSELDIKHKSAEEIDEIKRTTESTMGSGM
Sbjct: 421 QNPETLRNLENKRRKLRDNRKSNILNRELKKNSELDIKHKSAEEIDEIKRTTESTMGSGM 480

Query: 481 MKNLGFDPTQGKIASVFKHQRSDSDKKPLTEKDSSVASLLSFKKDNVKLKPSKEILIKQK 540
           MKNLGFDPTQGKIASVFKHQRSDSDKKPLTEKDSSVASLLSFKKDNVKLKPSKEILIKQK
Sbjct: 481 MKNLGFDPTQGKIASVFKHQRSDSDKKPLTEKDSSVASLLSFKKDNVKLKPSKEILIKQK 540

Query: 541 RRRERVWKEHFXXXXXXXXXXXXXLEIVS 569
           RRRERVWKEHF             LEIVS
Sbjct: 541 RRRERVWKEHFGSGGDEKDDSDSDLEIVS 569

>TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {ON}
           Anc_5.703 YIL150C
          Length = 567

 Score =  547 bits (1410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/557 (50%), Positives = 383/557 (68%), Gaps = 14/557 (2%)

Query: 1   MRDPREVLNNDLYDVLTSXXXXXXXXXXXXXXXXRQKKDLLQRLNVKKTNPKPLDPNLSH 60
           M DPREV+  D +  LTS                RQK+DL++RL  K+   K  DPN   
Sbjct: 1   MNDPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKSKR-QLKSKDPNFDA 59

Query: 61  IQVESSP-KKVTNSVLPPTVQQQEPRGEVRNENLNELKAQSQEQIPANTTSFFIEKYSTS 119
           IQVESSP KK   S+    V+    +  +  ENLNE K +S+ QIPANTTS+FI+ +  S
Sbjct: 60  IQVESSPVKKPAESI---KVEPSRTKRVLDIENLNEKKVESRSQIPANTTSYFIDNFRNS 116

Query: 120 KRKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNLWISKRYIPKEEQRSI 179
           K+++    + +++LLS RVHTF+G     ++K +   E+EE+S+LW+ +RYI +++ R +
Sbjct: 117 KKEEQKSQQERQELLSKRVHTFRGIDGNHKFKAVAVEEVEEYSDLWVKQRYISQDDLRKV 176

Query: 180 FANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSAASPKKYFKFTLTNF 239
              +KILRLSKLFAK+KPPKF EP YSNWA IG+IS KG+VKF+S+  P KYFKFTLT+F
Sbjct: 177 LHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSSSGKPMKYFKFTLTDF 236

Query: 240 QYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSGTKAHIKSFNLRISHKFECIL 299
           QY++D Y+FGK+GVERYYNLRVGDI+AILNP+VLPWRPS     IKSFNLRISH F CIL
Sbjct: 237 QYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSEKGNFIKSFNLRISHDFPCIL 296

Query: 300 EIGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKFRSTNAKRVELSGTYALGA 359
           EIG SRD+ WC  FNKS+N+ C  PINK KE CC++HRE++FRS +AKR+EL+G++ALGA
Sbjct: 297 EIGQSRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQFRSNHAKRIELNGSFALGA 356

Query: 360 PTRIDAQPALYRGGSSQKNLNYNIITNGADGGSNKEINPLDINARHFSNRNAAKAFFDER 419
           PT++D+ PALYR  S+  + N+ ++ N       K     D+   HFSN NAAKAFF++ 
Sbjct: 357 PTKVDSGPALYREKSAGAHRNFKVLPNHYQKSVGKN---SDLRGIHFSNGNAAKAFFNDE 413

Query: 420 FQNPETXXXXXXXXXXXXXXXXSNILNRELK----KNSELDIKHKSAEEIDEIKRTTEST 475
           FQNP+                 S IL ++LK    +++ ++I+ K +++ +EI  TTE+T
Sbjct: 414 FQNPDILNNLDSKRRKRQDDKKSLILQQQLKRINSRHAAIEIE-KGSKKYEEICETTEAT 472

Query: 476 MGSGMMKNLGFDPTQGKIASVFKHQRSD-SDKKPLTEKDSSVASLLSFKKDNVKLKPSKE 534
           + SG+++NLGFDPT G+I +V K    D S+   L +K   V+SLL FKK++V+LKP+KE
Sbjct: 473 LQSGLIQNLGFDPTHGEIGNVLKQAAKDKSNNGQLNKKQKEVSSLLKFKKEHVELKPAKE 532

Query: 535 ILIKQKRRRERVWKEHF 551
           +L+++KR RER W+E+F
Sbjct: 533 VLLQRKRDRERAWQENF 549

>NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}
           Anc_5.703 YIL150C
          Length = 592

 Score =  515 bits (1326), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 266/565 (47%), Positives = 382/565 (67%), Gaps = 18/565 (3%)

Query: 1   MRDPREVLNNDLYDVLTSXXXXXXXXXXXXXXXXRQKKDLLQRLNVKKTNPKPLDPNLSH 60
           M DPREVL  D YD ++S                R+++DLL R+  K+ + K LDPN   
Sbjct: 1   MNDPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNFQQ 60

Query: 61  IQVESSPKKVTNSVLPPTVQQQEPRGEVRNENLNELKAQSQE-QIPANTTSFFIEKYSTS 119
           +QV  SP K T + +P  +++     E+ +EN NEL+ + +  Q+P+NTT++F+EK+  S
Sbjct: 61  LQVPCSPVKKTETNVPVAMKKSTNEMEIPHENPNELRIREKSGQLPSNTTTYFMEKFQKS 120

Query: 120 KRKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNLWISKRYIPKEEQRSI 179
           K++++ +++  E++++ RVHTFQ    + E+KPI  NE+EE+SN+W+ KRYIP+ E R +
Sbjct: 121 KKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSNIWLKKRYIPQSELRKM 180

Query: 180 FANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSAASPKKYFKFTLTNF 239
             NIKILRLSKLFAKV+PPKF+EP YSNWA +G+IS KG+ KFT+   PKKY KFT+T+F
Sbjct: 181 LHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTTTDKPKKYLKFTMTDF 240

Query: 240 QYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSGTKAHIKSFNLRISHKFECIL 299
           Q+ +D YIFGK GVERYYNLRVGD+IAILNP+V PWRPSG    IKSFNLRI+H F+CIL
Sbjct: 241 QHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPSGKGQFIKSFNLRINHDFKCIL 300

Query: 300 EIGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKFRSTNAKRVELSGTYALGA 359
           EIG+S+DLG+C + +++   +C  PIN  KED C+YH+E++FR  N+KR+EL+G++ALGA
Sbjct: 301 EIGSSKDLGFCKVTSRN-GTLCNTPINMSKEDRCDYHQEIRFRDNNSKRIELNGSFALGA 359

Query: 360 PTRIDAQPALYRGGS-----SQKNLNYNIITNGADGGSNKEINPLDINARHFSNRNAAKA 414
           PT+++  P LYR  +     S+KN   N   + + G  NK+    D+  RHFSN N+AKA
Sbjct: 360 PTKVENNPTLYRKKNGETRHSRKN-RQNFSVSASFGSINKD--QFDLRNRHFSNNNSAKA 416

Query: 415 FFDERFQNPETXXXXXXXXXXXXXXXXSNILNRELKK----NSELDIKHKSAEEIDEIKR 470
           FFDE+FQNP+                    +++EL K     +  D+  +SA E+ ++KR
Sbjct: 417 FFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAIGNRASDDLGERSAMEVKQMKR 476

Query: 471 TTESTMGSGMMKNLGFDPTQGKIASVFKHQRSDSDKKPLTEKDSS----VASLLSFKKDN 526
            TE+T+ SG+++ LGFDPT GKIA+V +   S  +K  L+E+ S     V  LL F+K +
Sbjct: 477 ATETTLQSGVIQRLGFDPTHGKIANVLRTTHSKEEKDTLSEQMSGKKDKVNDLLHFRKSH 536

Query: 527 VKLKPSKEILIKQKRRRERVWKEHF 551
           V L P++  LI+++ RRER+W+E+F
Sbjct: 537 VILAPTRNELIERRDRRERIWQENF 561

>Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON}
           YIL150C (REAL)
          Length = 569

 Score =  514 bits (1323), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 264/558 (47%), Positives = 364/558 (65%), Gaps = 15/558 (2%)

Query: 1   MRDPREVLNNDLYDVLTSXXXXXXXXXXXXXXXXRQKKDLLQRLNVKKTNPKPLDPNLSH 60
           M DPRE+L  D Y+ +TS                R+K+ L++RL  K+   KP DPN   
Sbjct: 1   MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 60

Query: 61  IQVESSPKKVTNSVLPPTVQQQEPRGEVRNENLNELKAQSQEQIPANTTSFFIEKYSTSK 120
           ++V  SP K +         +Q  R    N N + L  QSQE  P+NTT++F++K+  +K
Sbjct: 61  VEVPQSPAKKSIVKKSQDALKQAIRPVASNINESMLSQQSQES-PSNTTTYFMQKFQDAK 119

Query: 121 RKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNLWISKRYIPKEEQRSIF 180
           R +D ++   E +++ RVHTF    +  EYKPI TNELE FSNLW+ KRYIP+E+ +   
Sbjct: 120 RNEDKQIAKYEGMMNARVHTFGTDNK--EYKPIITNELESFSNLWVKKRYIPEEDLKRAL 177

Query: 181 ANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSAASPKKYFKFTLTNFQ 240
             IKILRL+KLFAK++PPKF EP Y+NWA +GLIS+K ++KFTS+  P K+F FT+T+FQ
Sbjct: 178 HEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQ 237

Query: 241 YSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSGTKAHIKSFNLRISHKFECILE 300
           +S+D YIFGK+GVERYYNLR+GD+IAILNP+VLPWRPSG    IKSFNLRISH F+CILE
Sbjct: 238 HSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILE 297

Query: 301 IGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKFRSTNAKRVELSGTYALGAP 360
           IG+SRDLGWCP+ NK  ++ C +PIN +   CC+YHRE++FR T AKR+EL+G YALGAP
Sbjct: 298 IGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIELNGGYALGAP 357

Query: 361 TRIDAQPALYRG-GSSQKNLNYNIITNGADGGSNKEINPLDINARHFSNRNAAKAFFDER 419
           T++D+QP+LYR  G +Q    +NI+ +   G S +E   +  N+ +F+N N+AKAFFDE+
Sbjct: 358 TKVDSQPSLYRAKGENQ----FNIVRSTRKGLSEEE-ERVKRNSHNFTNSNSAKAFFDEK 412

Query: 420 FQNPETXXXXXXXXXXXXXXXXSNILNREL----KKNSELDIKHKSAEEIDEIKRTTEST 475
           FQNP+                 S  L+REL    ++     ++ KS  E  ++K+TTES 
Sbjct: 413 FQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTESA 472

Query: 476 MGSGMMKNLGFDPTQGKIASVFKHQRSDSDKKP--LTEKDSSVASLLSFKKDNVKLKPSK 533
           + +G+++ LGFDPT GKI+ V K      +  P  +  K + +  LL +KK+ V L PSK
Sbjct: 473 LQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSK 532

Query: 534 EILIKQKRRRERVWKEHF 551
               K++  RE VW+ HF
Sbjct: 533 NEWFKKRSHREEVWQRHF 550

>KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {ON}
           Anc_5.703 YIL150C
          Length = 584

 Score =  508 bits (1309), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 264/574 (45%), Positives = 378/574 (65%), Gaps = 31/574 (5%)

Query: 1   MRDPREVLNNDLYDVLTSXXXXXXXXXXXXXXXXRQKKDLLQRLNVKKTNPKPLDPNLSH 60
           M DPRE+  NDLY  +T                   K+DLL+RL+ KK   +  DPN + 
Sbjct: 1   MSDPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNFTG 60

Query: 61  IQVESSPKKVTNSVLPPTVQQQEP------RGEVRNENLNELKAQSQEQIPAN------- 107
           +QV +SP K     L   V+Q++       R E  NEN NEL  Q + Q           
Sbjct: 61  VQVPASPVKKHELQL---VEQKDQKLKNINRFEESNENPNELCLQQRFQKQTARLNDSNA 117

Query: 108 TTSFFIEKYSTSKRKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNLWIS 167
           +T +F+EK+  +KRK+   +   E ++ +RVHTF G   ++EY+ +  +ELE++SNLWI+
Sbjct: 118 STEYFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDELEQYSNLWIN 177

Query: 168 KRYIPKEEQRSIFANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSAAS 227
           KRY P    +S+   +KILRL+KLFAKV+PPKF EP YSNW V+G++S+K ++KFT++  
Sbjct: 178 KRYTPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSDIKFTASNK 237

Query: 228 PKKYFKFTLTNFQYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSGTKAHIKSF 287
           P+KY KFTLT+F++ +DTYIFGKEGVERYYNLR+GDIIA+LNP++LPWRPSG + +IKSF
Sbjct: 238 PQKYLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPSGKQNYIKSF 297

Query: 288 NLRISHKFECILEIGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKFRSTNAK 347
           NLRISH ++CILEIG SRDL  CP+  +S ++ C  PINK  + CCEYHRE++ R   +K
Sbjct: 298 NLRISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVDRCCEYHREMEIRKGPSK 357

Query: 348 RVELSGTYALGAPTRIDAQPALYRGGSSQKNLNYNI-ITNGADGGSNKEINPLDIN---- 402
           R++LSG YALGAPT++++QPALYRG ++Q     N+ I N     S  + NP  I+    
Sbjct: 358 RLDLSGQYALGAPTKLESQPALYRGHTAQ-----NVKIQNFKLTPSYSQNNPHLIDKYGE 412

Query: 403 -ARHFSNRNAAKAFFDERFQNPETXXXXXXXXXXXXXXXXSNILNRELKK--NSELDIKH 459
            ++ FSNRNAAKAFFD+ FQNP+                 SN+LNREL +    + D++ 
Sbjct: 413 KSKFFSNRNAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNRELDRLLRKDQDLEG 472

Query: 460 KSAEEIDEIKRTTESTMGSGMMKNLGFDPTQGKIASVFKHQRSDSDKKP--LTEKDSSVA 517
           K+ EE++++K+TT+ T+ SG+ + +GFDPT GKI+ + K++    D +P  L++KD +V 
Sbjct: 473 KTREEVEKMKQTTQRTLQSGLFQKVGFDPTGGKISRILKNKERSKDGEPKFLSQKDRTVD 532

Query: 518 SLLSFKKDNVKLKPSKEILIKQKRRRERVWKEHF 551
            L++FKK+ + L PSK  L+ +K +RE+VW+E+F
Sbjct: 533 DLMAFKKEYIILAPSKVDLLNKKNKREKVWQENF 566

>YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}
           MCM10Essential chromatin-associated protein involved in
           the initiation of DNA replication; required for the
           association of the MCM2-7 complex with replication
           origins
          Length = 571

 Score =  506 bits (1304), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 261/560 (46%), Positives = 365/560 (65%), Gaps = 17/560 (3%)

Query: 1   MRDPREVLNNDLYDVLTSXXXXXXXXXXXXXXXXRQKKDLLQRLNVKKTNPKPLDPNLSH 60
           M DPRE+L  D Y+ +TS                R+++ L++RL  K+   KP DPN   
Sbjct: 1   MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 60

Query: 61  IQVESSPKKVTNSVLPPTVQQQEPRGEVRNENLNELKA---QSQEQIPANTTSFFIEKYS 117
           I+V  SP K    V      QQ  + E    N+NE++    Q Q + PA+TT++F+EK+ 
Sbjct: 61  IEVPQSPTKNRVKVGSHNATQQGTKFE--GSNINEVRLSQLQQQPKPPASTTTYFMEKFQ 118

Query: 118 TSKRKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNLWISKRYIPKEEQR 177
            +K+ +D ++   E +++ RVHTF  +  + +Y PI TNELE FSNLW+ KRYIP+++ +
Sbjct: 119 NAKKNEDKQIAKFESMMNARVHTF--STDEKKYVPIITNELESFSNLWVKKRYIPEDDLK 176

Query: 178 SIFANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSAASPKKYFKFTLT 237
                IKILRL KLFAK++PPKF EP Y+NWA +GLIS+K ++KFTS+  P K+F FT+T
Sbjct: 177 RALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTIT 236

Query: 238 NFQYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSGTKAHIKSFNLRISHKFEC 297
           +FQ+++D YIFGK+GVERYYNLR+GD+IAILNP+VLPWRPSG    IKSFNLRISH F+C
Sbjct: 237 DFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKC 296

Query: 298 ILEIGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKFRSTNAKRVELSGTYAL 357
           ILEIG+SRDLGWCP+ NK  ++ C +PIN     CC+YHRE++FR T+AKR+EL+G YAL
Sbjct: 297 ILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYAL 356

Query: 358 GAPTRIDAQPALYRGGSSQKNLNYNIITNGADGGSNKEINPLDINARHFSNRNAAKAFFD 417
           GAPT++D+QP+LY+         +NII  G     ++E   L  ++ +F+N N+AKAFFD
Sbjct: 357 GAPTKVDSQPSLYKAKGEN---GFNII-KGTRKRLSEEEERLKKSSHNFTNSNSAKAFFD 412

Query: 418 ERFQNPETXXXXXXXXXXXXXXXXSNILNREL----KKNSELDIKHKSAEEIDEIKRTTE 473
           E+FQNP+                 S  L+REL    ++     ++ KS  E  ++KRTTE
Sbjct: 413 EKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKMKRTTE 472

Query: 474 STMGSGMMKNLGFDPTQGKIASVFKHQRSDSDKKP--LTEKDSSVASLLSFKKDNVKLKP 531
           S + +G+++ LGFDPT GKI+ V K   S S+ K   L +K + +  LL +KK+ V L P
Sbjct: 473 SALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVILAP 532

Query: 532 SKEILIKQKRRRERVWKEHF 551
           SK    K++  RE VW++HF
Sbjct: 533 SKNEWFKKRSHREEVWQKHF 552

>Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON}
           YIL150C (REAL)
          Length = 571

 Score =  500 bits (1288), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 256/560 (45%), Positives = 362/560 (64%), Gaps = 17/560 (3%)

Query: 1   MRDPREVLNNDLYDVLTSXXXXXXXXXXXXXXXXRQKKDLLQRLNVKKTNPKPLDPNLSH 60
           M DPRE L  D Y+ +TS                R+K+ L++RL  K+   +  DPN   
Sbjct: 1   MDDPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEA 60

Query: 61  IQVESSPKKVTNSVLPPTVQQQEPRGEVRNENLNELKA---QSQEQIPANTTSFFIEKYS 117
           I+V  SP K  N +      +++ R      N+N+LK    Q ++++P+NTT +F++K+ 
Sbjct: 61  IEVPQSPAKNRNIMKSQNTMKRDMRPAA--SNINDLKLSQLQQKQELPSNTTGYFMQKFQ 118

Query: 118 TSKRKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNLWISKRYIPKEEQR 177
            +KR ++ +    E++++ RVHTF   ++  EY+    NELEEFSN+W+ KRYIP+++ +
Sbjct: 119 NAKRNEEKQRAKYENMMNARVHTFGTDKK--EYRATIANELEEFSNIWVKKRYIPEDDLK 176

Query: 178 SIFANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSAASPKKYFKFTLT 237
                IKILRL KLFAK++PPKF EP Y+NWAV+GLIS+K +VKFTS+  P K+F FT+T
Sbjct: 177 RALHEIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTSSDKPAKFFMFTIT 236

Query: 238 NFQYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSGTKAHIKSFNLRISHKFEC 297
           +FQ+++D YIFGK+ VERYYNLR+GD+IAILNP+VLPWRPSG    IKSFNLRISH F+C
Sbjct: 237 DFQHTLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSGQGNFIKSFNLRISHDFKC 296

Query: 298 ILEIGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKFRSTNAKRVELSGTYAL 357
           ILEIG+SRDLGWCP+ N+ KNE C +PIN     CC+YHRE++FR T+AKR+EL+G YAL
Sbjct: 297 ILEIGSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYHREVQFRGTSAKRIELNGGYAL 356

Query: 358 GAPTRIDAQPALYRGGSSQKNLNYNIITNGADGGSNKEINPLDINARHFSNRNAAKAFFD 417
           GAPT++DAQP LYR        N+N++ +     S +E   +  N+ +F N N+AKAFFD
Sbjct: 357 GAPTKVDAQPTLYRAKGEN---NFNLVRSIRKTLSEEE-ERMKKNSHNFRNSNSAKAFFD 412

Query: 418 ERFQNPETXXXXXXXXXXXXXXXXSNILNREL----KKNSELDIKHKSAEEIDEIKRTTE 473
           E+FQNP+                 S  L+REL    ++     ++ K  EE  +IK+TTE
Sbjct: 413 EKFQNPDMLANLDSKRRKIIDSKKSTALSRELGKIMRRKGSSGLEDKCDEEKQKIKQTTE 472

Query: 474 STMGSGMMKNLGFDPTQGKIASVFKHQRSDSD--KKPLTEKDSSVASLLSFKKDNVKLKP 531
           S + +G+++ LGFDPT GKI+ V K      +   K +  K + +  LL++KK+ V L P
Sbjct: 473 SALQTGLLQRLGFDPTHGKISKVLKSSVPGGEPRNKVMGGKKTVIDDLLNYKKEKVILAP 532

Query: 532 SKEILIKQKRRRERVWKEHF 551
           SK    K++  RE VW++HF
Sbjct: 533 SKNEWFKKRSHREEVWQKHF 552

>Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON}
           YIL150C (REAL)
          Length = 572

 Score =  497 bits (1279), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 254/558 (45%), Positives = 357/558 (63%), Gaps = 13/558 (2%)

Query: 1   MRDPREVLNNDLYDVLTSXXXXXXXXXXXXXXXXRQKKDLLQRLNVKKTNPKPLDPNLSH 60
           M DPRE+L  D Y+ +TS                R+++ L++RL  K+   KP DPN   
Sbjct: 1   MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 60

Query: 61  IQVESSPKKVTNSVLPPTVQQQEPRGEVRNENLNEL-KAQSQEQIPANTTSFFIEKYSTS 119
           I+V  SP K           +Q  R E  N N + L + Q Q ++P NTT++F++K+  +
Sbjct: 61  IEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNA 120

Query: 120 KRKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNLWISKRYIPKEEQRSI 179
           K+ +D ++   E ++  RVHTF    ++  YKPI  NELE FSNLW+ KRYIP+++ +  
Sbjct: 121 KKDEDRQIAKFESMMDARVHTFGTDNKK--YKPIIANELEGFSNLWVKKRYIPEDDLKRS 178

Query: 180 FANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSAASPKKYFKFTLTNF 239
              IKILRL KLFAKV+PPKF  P Y+NWA +GLIS+K ++KFTS+  P K+F FT+T+F
Sbjct: 179 LHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDF 238

Query: 240 QYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSGTKAHIKSFNLRISHKFECIL 299
           Q+++D YIFGK+GVERYYNLR+GDIIAILNP+VLPWRPSG    IKSFNLRISH F+CIL
Sbjct: 239 QHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCIL 298

Query: 300 EIGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKFRSTNAKRVELSGTYALGA 359
           EIG+SRDLGWCP+ N   ++ C +PIN     CC+YHRE++FR T+AKR+EL+G YALGA
Sbjct: 299 EIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGA 358

Query: 360 PTRIDAQPALYRGGSSQKNLNYNIITNGADGGSNKEINPLDINARHFSNRNAAKAFFDER 419
           PT++++QP+LY+     +   +NII +   G S +E   +  ++ +F+N N+AKAFFDE+
Sbjct: 359 PTKVNSQPSLYKAKGENR---FNIIRDARKGLSEEE-ERMKKSSHNFTNSNSAKAFFDEK 414

Query: 420 FQNPETXXXXXXXXXXXXXXXXSNILNREL----KKNSELDIKHKSAEEIDEIKRTTEST 475
           FQNP+                 S  LNREL    ++     ++ KS  E  ++K+TTE+ 
Sbjct: 415 FQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENA 474

Query: 476 MGSGMMKNLGFDPTQGKIASVFKHQ--RSDSDKKPLTEKDSSVASLLSFKKDNVKLKPSK 533
           + +G+++ LGFDPT G+I+ V K      +S    L  K + +  LL +KK+ V L PSK
Sbjct: 475 LQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILAPSK 534

Query: 534 EILIKQKRRRERVWKEHF 551
               K++  RE VW+ HF
Sbjct: 535 NEWFKKRNHREEVWQRHF 552

>Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON}
           (151546..153303) [1758 nt, 586 aa]
          Length = 585

 Score =  491 bits (1264), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 265/561 (47%), Positives = 370/561 (65%), Gaps = 18/561 (3%)

Query: 1   MRDPREVLNNDLYDVLTSXXXXXXXXXXXXXXXXRQKKDLLQRLNVKKTNPKPLDPNLSH 60
           M DPRE    DLY  L+S                RQK+DLL+RL  KK     LDPN   
Sbjct: 1   MNDPREHAKEDLYSNLSSDEGEQDEISEQLKAIERQKQDLLERLKKKKERKSKLDPNF-- 58

Query: 61  IQVESSPKKVTNSVLPPTVQQQEPRGEVRNENLNELKAQSQEQIPANTTSFFIEKYSTSK 120
           +QV SSPKK     L PT +  +   E   EN NE+   +++     TTS+F+EK+  SK
Sbjct: 59  VQVPSSPKKSRVVELKPTSKPIDNNEEEEEENPNEVALMTKDDSNYGTTSYFMEKFYNSK 118

Query: 121 RKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNLWISKRYIPKEEQRSIF 180
           +  + +V A   ++S+RVHTF G   + E+KP   +EL+++SNLW+  RYIP +E   + 
Sbjct: 119 KDHERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSRYIPVDELNLML 178

Query: 181 ANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSAASPKKYFKFTLTNFQ 240
            +IKILRL KLFAKV+PPKF EP YSNW V G+I++K ++K+TS++ P KYFKFT+++FQ
Sbjct: 179 LDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPTKYFKFTISDFQ 238

Query: 241 YSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPS----GTKAHIKSFNLRISHKFE 296
           +++D +IFG +GVE+YYNLRVGD++AILNP++LPWRPS    G+ + IKSFNLRISHKF+
Sbjct: 239 HNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGGSGSTIKSFNLRISHKFD 298

Query: 297 CILEIGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKFRSTNAKRVELSGTYA 356
           CILEIGASRDLGWCP+ N SKN +C+ PINK KED C+YHRE++FR T + RVELSGTYA
Sbjct: 299 CILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTTSNRVELSGTYA 358

Query: 357 LGAPTRIDAQPALY--RGGSSQKNL--NYNIITNGADGGSNKEINPLDINARHFSNRNAA 412
           LGAPT++DA+PALY  RG S+   +  +YN++++ +     K+ N L+    HFS  N+A
Sbjct: 359 LGAPTKVDARPALYQNRGTSNNSRVQKSYNMVSD-SHYQKRKDSNKLETRMHHFSTMNSA 417

Query: 413 KAFFDERFQNPETXXXXXXXXXXXXXXXXSNILNRELKKNSELDIKHKSAEEIDEIKRTT 472
           KAFFDE FQNP+                    L + LK   +     K ++    +K  T
Sbjct: 418 KAFFDEDFQNPDILNNLDSKRRKIKDSKMERNLVKALKNTVD-----KESKNFKNLKNAT 472

Query: 473 ESTMGSGMMKNLGFDPTQGKIASVFKHQRSDSD--KKPLTEKDSSVASLLSFKKDNVKLK 530
           ++T+ +G+++ LGFDPT GK++SV ++  S+++   K   EK  ++  L++F+KD V LK
Sbjct: 473 QATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEALDDLMTFRKDTVNLK 532

Query: 531 PSKEILIKQKRRRERVWKEHF 551
           PSK+ LIK++  R+R WK+ F
Sbjct: 533 PSKDDLIKRRIDRQRNWKKLF 553

>TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}
           Anc_5.703 YIL150C
          Length = 544

 Score =  476 bits (1224), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 244/519 (47%), Positives = 350/519 (67%), Gaps = 13/519 (2%)

Query: 41  LQRLNVKKTNPKPLDPNLSHIQVESSPKKVTNSVLPPTVQQQEP-RGEVRNENLNELKAQ 99
           ++RL  KK + K LDPN + IQ++ SP+K  ++  P T     P +  V + N NE K  
Sbjct: 1   MKRLKAKKEDQKKLDPNFTDIQIQRSPEKKKSN--PNTTVNPIPLKRLVEDVNPNEAKVV 58

Query: 100 SQEQIPANTTSFFIEKYSTSKRKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELE 159
           S   +PANTTS+F++ +  +K+++  +V+  +  +S+RVH+F GA    +Y+ I   ELE
Sbjct: 59  SNANLPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKYQSIIVEELE 118

Query: 160 EFSNLWISKRYIPKEEQRSIFANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGE 219
           E+S   ISKRY+PKEE      NIKILRL+KLFAK++PPKF+EP Y+NWAV G+I +K +
Sbjct: 119 EYSRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGIICSKED 178

Query: 220 VKFTSAASPKKYFKFTLTNFQYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSG 279
           +K TS+ +P K+FKFT+TNFQ+++D +IFG  GVE+YYNLRVGDII ILNP+VLPWRP  
Sbjct: 179 IKLTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVLPWRPEF 238

Query: 280 TKAHIKSFNLRISHKFECILEIGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHREL 339
               IKSFNLRISHKF+CILEI  S+D+ WC   N+     C  PINK K+D C+YH+E+
Sbjct: 239 KGNSIKSFNLRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINKSKQDVCDYHKEM 298

Query: 340 KFRSTNAKRVELSGTYALGAPTRIDAQPALYRGGSSQKNL----NYNIITNGADGGSNKE 395
           +FRS NAKRVELSGTYALGAPT+ID++PALYR  ++  NL    N+NI+ +       KE
Sbjct: 299 QFRSANAKRVELSGTYALGAPTQIDSRPALYRSKNTS-NLKPGNNFNIVADRR-YMKKKE 356

Query: 396 INPLDINARHFSNRNAAKAFFDERFQNPETXXXXXXXXXXXXXXXXSNILNRELKK---N 452
            +P++    HFS+ N+AKAFFDE FQNP+                   +L R L++   N
Sbjct: 357 NDPINSKRHHFSSSNSAKAFFDEDFQNPDMLVNLENKRRKIKDDKRDVMLQRALRESVGN 416

Query: 453 SELDIKHKSAEEIDEIKRTTESTMGSGMMKNLGFDPTQGKIASVFKHQRSDSDKKPLT-E 511
           S+L +K KS +EI  ++ TT++T+ +G ++ LGFDPT G+I  V +     S +  L  +
Sbjct: 417 SKLLLKDKSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLEKSADKSTQSKLQKQ 476

Query: 512 KDSSVASLLSFKKDNVKLKPSKEILIKQKRRRERVWKEH 550
           K +++ +L++FKK +V LKPS+E+L+++   RE+ + ++
Sbjct: 477 KSNAMENLVTFKKSSVNLKPSREVLLEKLHHREQSFAQY 515

>NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}
           Anc_5.703 YIL150C
          Length = 610

 Score =  461 bits (1185), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 261/588 (44%), Positives = 359/588 (61%), Gaps = 40/588 (6%)

Query: 1   MRDPREVLNNDLYDVLTSXXXXXXXXXXXXXXXXRQKKDLLQRLNVKKTNPKPLDPNLSH 60
           M DPRE    D +  L+                 R+K DLL RL   K   K  DPN   
Sbjct: 1   MNDPRECSPEDPFADLSDKEENEDAVLEELEDLDRRKSDLLGRLKELKERQKRRDPNFDE 60

Query: 61  IQVESSPKKVTNSVLPP--TVQQQEPR-----------GEVRNENLNELKAQSQEQ---- 103
           +Q+  +P++   ++     T+ Q   R           GE R  N NELK + +E+    
Sbjct: 61  VQIPGTPEEKNTNIFTSEQTILQNRDRKEEEVEEEEFSGE-RLPNPNELKVREREENLEK 119

Query: 104 IPANTTSFFIEKYSTSKRKQDYEVRAQEDLLSNRVHTFQGARRQD-----EYKPIPTNEL 158
           +P+NTTS+F+EK+   K+K++ E    E +L  RVH FQG  +       EY+P   NE+
Sbjct: 120 LPSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPEAANEV 179

Query: 159 EEFSNLWISKRYIPKEEQRSIFANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKG 218
           EE+S L I KRYIPK+E   IF NIKILRL+KLFAKV+PPKF EP YSNW  +G+I+ KG
Sbjct: 180 EEYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQKG 239

Query: 219 EVKFTSAASPKKYFKFTLTNFQYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPS 278
            +KFTS+  PKKYFKFT+++F+Y++D +IF K  VERYYNLR+GDIIAILNP+VLPWRPS
Sbjct: 240 SIKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWRPS 299

Query: 279 GTK--AHIKSFNLRISHKFECILEIGASRDLGWCPMFNK-SKNEICRAPINKDKEDCCEY 335
             K    IKSFNLRI+H + CI+E+G S+DLG+CP+ NK +++  C  PI+  KED C Y
Sbjct: 300 NNKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISKEDRCSY 359

Query: 336 HRELKFRSTNAKRVELSGTYALGAPTRIDAQPALYRG------GSSQKNLNYNIITNGAD 389
           H+E++FR+  +KR+EL+G++ALGAP ++ AQP LYR       G    N  +N++  G++
Sbjct: 360 HQEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVYHGN-RFNVVK-GSE 417

Query: 390 GGSNKEINPLDINARHFSNRNAAKAFFDERFQNPETXXXXXXXXXXXXXXXXSNILNREL 449
              N+     +   R+FS+ N+AKAFFDE+FQNP+                 SN L++EL
Sbjct: 418 IRKNESKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNYLDQEL 477

Query: 450 K-----KNSELDIKHKSAEEIDEIKRTTESTMGSGMMKNLGFDPTQGKIASVFKHQR-SD 503
                 K+S     +K+ +E  ++K  TE+T+ +G+++ LGFDPT GKIA V +  + S 
Sbjct: 478 SKAIENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQTGKDSG 537

Query: 504 SDKKPLTEKDSSVASLLSFKKDNVKLKPSKEILIKQKRRRERVWKEHF 551
            D    T K   V  LL FKK  V L P+KE LIK+K RRE VW++HF
Sbjct: 538 KDNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHF 585

>KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5.703
           YIL150C
          Length = 616

 Score =  460 bits (1183), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 251/596 (42%), Positives = 364/596 (61%), Gaps = 53/596 (8%)

Query: 3   DPREVLNNDLYDVLTSXXXXXXXXXXXXXXXXRQKKDLLQRLNVKKTNPKPLDPNLS-HI 61
           DPR+V+  D YD +TS                R+KKDL +RL +K+ + KP D NL   +
Sbjct: 4   DPRDVITADPYDNITSDEDEESKIQRELEEMERRKKDLEKRLKLKRAHVKPTDLNLQLDV 63

Query: 62  QVESSPKKVTNSVLPPTVQQQEPRGEVRNENLN-----------------ELKAQSQEQI 104
           QV SSP+K + S +    +++E    ++  NL+                 +L     +Q 
Sbjct: 64  QVPSSPQKRSVSAIDVARKRREEAEAIKKRNLSLALNTAQKVNLNEARFAQLDGDDGKQS 123

Query: 105 PANTTSFFIEKYSTSKRKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNL 164
              TTS+F+EK+  SK+ +  E+ AQE +LS RVHTFQG  +  E++    NELE+FS+L
Sbjct: 124 VNATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQGVDK--EFQLEAVNELEQFSDL 181

Query: 165 WISKRYIPKEEQRSIFANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTS 224
           WISKRYIPK+       ++K+LRL+KLFAKV+PPKF EP YSNWAV+ +IS K EVKFT+
Sbjct: 182 WISKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEVKFTT 241

Query: 225 AASPKKYFKFTLTNFQYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSGTKAH- 283
           + +P+K+ +FTLTNFQ  +D ++FG  GV+RYYNLR GDI+A+LNP++LPWRPSG     
Sbjct: 242 SKNPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRPSGGSQQT 301

Query: 284 --IKSFNLRISHKFECILEIGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKF 341
             IKSFNL+I+HKF+CILEIG SRDLG+CP+  K  NE C + IN  ++  CEYHREL+ 
Sbjct: 302 TSIKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEYHRELQM 361

Query: 342 RSTNAKRVELSGTYALGAPTRIDAQPALYRGGS-----SQKNL------------NYNII 384
           R  ++KR++L+G +ALGAPT++  QP L+R  S     S ++L            ++N  
Sbjct: 362 RQNSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFYTEPSWN-- 419

Query: 385 TNGADGGSNKEINPLDINARHFSNRNAAKAFFDERFQNPETXXXXXXXXXXXXXXXXSNI 444
           +    GGS++E     +  + F++ NAAKAFFD+ FQNP+                 S  
Sbjct: 420 SRHGQGGSSEE--NYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDSKKSRQ 477

Query: 445 LNRELK----KNSELDIKHKSAEEIDEIKRTTESTMGSGMMKNLGFDPTQGKIASVFKHQ 500
           L+R+LK    K+ +     K+  E+  +KRTTE+ + +G+++ LGFDPT G+ ASV K +
Sbjct: 478 LDRKLKRLLSKDEDRATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVMKKR 537

Query: 501 RSD-----SDKKPLTEKDSSVASLLSFKKDNVKLKPSKEILIKQKRRRERVWKEHF 551
            S+     ++   L++K++ V  LL +K+D   L PS+  L  +K+ R  VW+E F
Sbjct: 538 DSERGSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETF 593

>CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} similar
           to uniprot|P32354 Saccharomyces cerevisiae YIL150c DNA43
          Length = 583

 Score =  454 bits (1167), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 256/573 (44%), Positives = 352/573 (61%), Gaps = 34/573 (5%)

Query: 3   DPREVLNNDLY-DVLTSXXXXXXXXXXXXXXXXRQKKDLLQRL--NVKKTNPKPLDPNLS 59
           DPREV   D Y D+                   R+K+DL+ RL  N +K   K LDPN+ 
Sbjct: 8   DPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSKQLDPNMK 67

Query: 60  HI------QVESSPKKVTNSVLPPTVQQQEPRGEV-RNENLNELKAQSQEQIPAN----- 107
           +I      +V  SPK+ +   LP     Q    +V  N+  N  KA   E+         
Sbjct: 68  NINSRGRVEVPRSPKRES---LPAQENLQHNVPQVTHNQAANNKKANPNEEDIVRKELDV 124

Query: 108 --TTSFFIEKYSTSKRKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNLW 165
             TTS+F  K+  SK  ++  V A + ++S R HTF G+    + K I  +ELE +SN  
Sbjct: 125 VATTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDNKTIQCDELEPYSNFH 184

Query: 166 ISKRYIPKEEQRSIFANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSA 225
           I KRYIPK+E   +   IKILRL+KLFAKV+PP F+EP YSNW  IG IS+K +VK T+A
Sbjct: 185 IKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSKEDVKLTNA 244

Query: 226 ASPKKYFKFTLTNFQYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSGTKAHIK 285
           A P KYFKFTLT+F++++D Y+FGK+ VERYYNLRVGDIIA+LNP++LPWRPSG    IK
Sbjct: 245 AKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWRPSGCVNGIK 304

Query: 286 SFNLRISHKFECILEIGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKFRSTN 345
           SFNLRI H F CILEIGASRDLGWC M N  +++IC +PIN   + CCE+HREL+ RST 
Sbjct: 305 SFNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSPINTKTDRCCEFHRELQMRSTA 364

Query: 346 AKRVELSGTYALGAPTRIDAQPALYRGGSSQKNLN------YNIITNGADGGSNKEINPL 399
           +KR+ELSG+YALGAPT++  QP++Y+  +  +N N      ++I  +G+     KE +  
Sbjct: 365 SKRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTNPAKHKMFSITGHGSKKEQEKEKH-- 422

Query: 400 DINARHFSNRNAAKAFFDERFQNPETXXXXXXXXXXXXXXXXSNILNRELKKNSELDIKH 459
           +I A HFSN+ AAKAFFD+ FQ+P                     L + L  N E   + 
Sbjct: 423 EIEAHHFSNKRAAKAFFDDSFQDPSLLANLESKRRKIKASKMDRNLLKAL--NGEDASQS 480

Query: 460 KSAEEIDEIKRTTESTMGSGMMKNLGFDPTQGKIASVFKHQR-SDSDKKPLTEKDSSVAS 518
           K+ +++ EI   TE T+ +G+++ LGFDP+ G+IA V    R + +D   +++K   +  
Sbjct: 481 KNKQQVKEI---TEKTLQTGVIQRLGFDPSGGQIAKVLDKSRGTKTDDPTISKKMGLIND 537

Query: 519 LLSFKKDNVKLKPSKEILIKQKRRRERVWKEHF 551
           L+ FKKD +KLKPS+EI ++++ RRE +WK+HF
Sbjct: 538 LIHFKKDKIKLKPSREIQLEKRHRREAIWKKHF 570

>SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, 574
           aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
           required for the association of the MCM2-7 complex with
           replication origins
          Length = 574

 Score =  426 bits (1096), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 238/566 (42%), Positives = 341/566 (60%), Gaps = 29/566 (5%)

Query: 1   MRDPREVLNNDLYDVLTSXXXXXXXXXXXXXXXXRQKKDLLQRLNVKKTNPKPLDPNLSH 60
           M DPRE    D++D L+                 R+KKDL QRL       K +DPN S 
Sbjct: 1   MEDPREPREIDIFDELSCDEDDDLHKRLDELE--REKKDLKQRLQDISQRKKKIDPNFSG 58

Query: 61  IQVESSPKKVTNSVLPPTVQQQEPRGEV--RNENLNELKAQSQEQIPANTTSFFIEKYST 118
           ++V  SP K  +  +  T + ++ R      +ENLNEL+ Q +  + + +T +F + +S+
Sbjct: 59  VEVPRSPSKSKHVAVKETSRSKDDRESCFPAHENLNELQVQKKASLSSISTPYFAQNFSS 118

Query: 119 SKRKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNLWISKRYIPKEEQRS 178
           SK+ Q+ E R + ++L+ RVHTF G     EY PI  NE EEFS  WISKRYI  E+ R 
Sbjct: 119 SKKAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIAVNEEEEFSGKWISKRYITAEQARK 178

Query: 179 IFANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSAASPKKYFKFTLTN 238
           I    K+LRL KLFAKV+PP F EP YSNW  IG+IS K  VK T+   P +YF  TLT+
Sbjct: 179 ILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMTTGTKPSRYFTLTLTD 238

Query: 239 FQYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPS------GTKAHIKSFNLRIS 292
           F+++I+ Y+FG + VE+YYNL+VGDIIA+LNP++ PWRPS       ++A IKSFNL I 
Sbjct: 239 FKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHEQSSQAVIKSFNLCIK 298

Query: 293 HKFECILEIGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKFRSTNAKRVELS 352
           H F  ILEIG SRD G+C ++NK + + C  PINK  ED C YH+E++FR  NAKR+EL+
Sbjct: 299 HNFNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKSVEDRCYYHQEVQFRQVNAKRLELN 358

Query: 353 GTYALGAPTRIDAQPALYRGGSSQKNLNYNIITNGADGGSNKEINPLDINARHFSNRNAA 412
           G  +L +PT+   +  LY    S K   Y+++    D  + +  +    N  +FSN NAA
Sbjct: 359 GNKSLRSPTKNGVKHILYGKNKSGK---YDLL---PDRYAPQTQSKDSQNVLYFSNPNAA 412

Query: 413 KAFFDERFQNPETXXXXXXXXXXXXXXXXSNILNREL-----KKNSELDIKHKSAEEIDE 467
           +AFFD+ +QNP+                   +L ++L     K NS L  K++++ + DE
Sbjct: 413 RAFFDDDYQNPDFLNNLDSKRRKLEVGKKEKLLQKQLQQVIGKSNSNL-FKNETSTKQDE 471

Query: 468 IKRTTESTMGSGMMKNLGFDPTQGKIASVFKHQRSDSDKKPLTE--KDSSVASLLSFKKD 525
           I+R T++ + SG++K +GFDPT G+++SV K+     + K L E  K+S+V  +L  KK+
Sbjct: 472 IRRATKNALESGLIKKIGFDPTSGRMSSVLKN-----NSKGLKEQAKNSAVEEILQIKKE 526

Query: 526 NVKLKPSKEILIKQKRRRERVWKEHF 551
            ++LKPSKE L ++ ++RE VW  HF
Sbjct: 527 KIELKPSKEALRQKFKKREEVWNHHF 552

>TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.703
           YIL150C
          Length = 594

 Score =  419 bits (1078), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 233/581 (40%), Positives = 348/581 (59%), Gaps = 40/581 (6%)

Query: 1   MRDPREVLNNDLYDVLTSXXXXXXXXXXXXXXXXRQKKDLLQRLNVKKTNPKPLDPNL-- 58
           M DPREV  NDL+D ++                 RQK+DL +RL  K+   + +DPN   
Sbjct: 1   MNDPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFIS 60

Query: 59  ----------SHIQVESSPKKVT--NSVLPPTVQQQEPRGEVRNENLNELKAQSQ---EQ 103
                     S IQV  SP+K+   ++ L  T   ++  G    +N NELK ++Q     
Sbjct: 61  TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTG--IQDNPNELKLKNQIEPAS 118

Query: 104 IPANTTSFFIEKYSTSKRKQDYEVRAQEDLLSNRVHTFQG-ARRQDEYKPIPTNELEEFS 162
           +PA +T++F+  +++SK+ +  +++  E L+S RVH+F      Q E + I   E E++S
Sbjct: 119 VPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYS 178

Query: 163 NLWISKRYIPKEEQRSIFANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKF 222
            LWIS+RY+ +E    +  +IKILRL+KLFAK++PPKF  P YSNW  +G+I+ K   K 
Sbjct: 179 GLWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKL 238

Query: 223 TSAASPKKYFKFTLTNFQYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSGTKA 282
           TS+ +P+KYFKFT+ +FQ +I  ++F +E + +YYNLRVGDII ILNP + PWRPS    
Sbjct: 239 TSSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEENG 298

Query: 283 HIKSFNLRISHKFECILEIGASRDLGWCPMFNKSK-NEICRAPINKDKEDCCEYHRELKF 341
           +IKSFNL I  K++CI+EIG SRDLGWC +  KSK  + C  PINK K+ CCE+HRE +F
Sbjct: 299 YIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRETEF 358

Query: 342 RSTNAKRVELSGTYALGAPTRIDAQPALYRGGSS---QKNLNYNII--TNGADGGSNKEI 396
           R+  AKR+EL+G++ALGAPT+ D  P+LY+  ++    KN  +N++   N    G +K  
Sbjct: 359 RNAAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKN-QFNVVRRRNARKEGDSK-- 415

Query: 397 NPLDINARHFSNRNAAKAFFDERFQNPETXXXXXXXXXXXXXXXXSNILNRELKK----- 451
               ++  +F + N AKAFF++ FQNP+                  + L +EL K     
Sbjct: 416 ----LHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKE 471

Query: 452 -NSELDIKHKSAEEIDEIKRTTESTMGSGMMKNLGFDPTQGKIASVFKHQRSDSDKKPLT 510
            N   +++ KS E++ E++  TE+ M  GM+KN+G+DPT GK+  + K + +  D    +
Sbjct: 472 DNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMK-KSNGKDPSYTS 530

Query: 511 EKDSSVASLLSFKKDNVKLKPSKEILIKQKRRRERVWKEHF 551
            + ++V  LL FKKD V LKP K  L+ +KR+R+ +W E+F
Sbjct: 531 NRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYF 571

>KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp,
           583 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 583

 Score =  401 bits (1030), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 224/562 (39%), Positives = 320/562 (56%), Gaps = 23/562 (4%)

Query: 3   DPREVLNNDLYDVLTSXXXXXXXXXXXXXXXXRQKKDLLQRLNVKKTNPKPLDPNLSHIQ 62
           DPREVL  D++D++TS                RQ++DL  RL  K +  K    +L  ++
Sbjct: 6   DPREVLQLDVHDIVTSDEDEDTKIKQQLDELERQQRDLRDRLEQKASRKKAQRQSLERVE 65

Query: 63  VESSPKKVTNSVLPPTVQQQEPRGEVRNENLNELKAQSQEQIPANTTSFFIEKYSTSKRK 122
           V +SPK+   S   P  Q+      +   + N+      +  P+NTTS+F+E +  +++ 
Sbjct: 66  VPASPKEERKSKASPQSQKSSKGITLAANSNNDSIEVPWKNGPSNTTSYFVENFVNARKV 125

Query: 123 QDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNLWISKRYIPKEEQRSIFAN 182
           ++ +++ +  LLS RVHTF+G       +P+  +E E +S   IS+RY+   E   I   
Sbjct: 126 EEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYSGFNISRRYMSTSELDEIMRE 185

Query: 183 IKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSAASPKKYFKFTLTNFQYS 242
           IK+LRL KLF+KV+PPKF EP Y+NW  IG+IS K EVK TS++ P KYFK TLT+F ++
Sbjct: 186 IKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSSKPSKYFKMTLTDFTHN 245

Query: 243 IDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSGTKAH------IKSFNLRISHKFE 296
           +D YIF  + VE+YYNLRVGDIIAILNP +LPWRPS           +KSFNL I H F+
Sbjct: 246 LDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFSGPVVKSFNLSIRHNFD 305

Query: 297 CILEIGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKFRSTNAKRVELSGTYA 356
           C+LEIG S+DLG+C + NK+  + C APIN+   D CEYH++++FR  NA+RVEL+G+ +
Sbjct: 306 CVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCEYHQDVRFRHVNAQRVELNGSTS 365

Query: 357 LGAPTRIDAQPALYRGGSSQKNLNY---NIITNGADGGSNKEINPLDINARHFSNRNAAK 413
           L +P +   + ALY     ++ L            DG S         N   FSN N AK
Sbjct: 366 LRSPVKNGKKQALYGTSGVKRKLQLLPDKHAPQAQDGESQ--------NTLFFSNPNYAK 417

Query: 414 AFFDERFQNPET----XXXXXXXXXXXXXXXXSNILNRELKKNSELDIKHKSAEEIDEIK 469
           AFFD+ +QNP+                      N LN  + K       +KS EE  ++K
Sbjct: 418 AFFDDSYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQSFNNKSKEEQKQMK 477

Query: 470 RTTESTMGSGMMKNLGFDPTQGKIASVFKHQRSDSDKKPLTEKDSSVASLLSFKKDNVKL 529
             TE  + SG+++++GFDP +GK+  V K  ++ +    L  K S V  ++SFKK NV L
Sbjct: 478 DATEQVLNSGLLRDIGFDPFRGKMREVLKFGKNVNSG--LNSKSSQVKEIMSFKKSNVSL 535

Query: 530 KPSKEILIKQKRRRERVWKEHF 551
            PSK    K+  RRE+VW+EHF
Sbjct: 536 APSKAEQKKRLLRREQVWREHF 557

>Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON}
           YIL150C (DNA43) - (putative) involved in DNA replication
           [contig 159] FULL
          Length = 466

 Score =  370 bits (951), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 190/449 (42%), Positives = 279/449 (62%), Gaps = 17/449 (3%)

Query: 113 IEKYSTSKRKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNLWISKRYIP 172
           +E ++ S++ ++  ++ + ++L +RVHTF+G +     KPI   E E  S LW+S+RYI 
Sbjct: 1   MENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIA 60

Query: 173 KEEQRSIFANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSAASPKKYF 232
            +E   I  +IKILRL KLF+KV+PPKF EP Y+NW  +G++ +K  VK TS++ P KYF
Sbjct: 61  SDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYF 120

Query: 233 KFTLTNFQYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSG------TKAHIKS 286
           K T+T+F +S+D Y+F    VE+YYNLRVGDIIAILN  +LPWRPS       + A +KS
Sbjct: 121 KMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKS 180

Query: 287 FNLRISHKFECILEIGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKFRSTNA 346
           FNL I   ++C+LEIG SRDLG+C ++NK+K ++C APIN+   D C+YH+E++FR  NA
Sbjct: 181 FNLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQVNA 240

Query: 347 KRVELSGTYALGAPTRIDAQPALYRGGSSQKNLNYNIITNGADGGSNKEINPLDINARHF 406
           +RVEL+G+ +L +P +   + ALY  GSS      N++    D  + ++ +    N  +F
Sbjct: 241 QRVELNGSMSLRSPVKNGKKQALY--GSSGVKRKLNLL---PDKHAPQQQDRESQNTLYF 295

Query: 407 SNRNAAKAFFDERFQNPETXXXXXXXXXXXXXXXXSN----ILNRELKKNSELDIKHKSA 462
           SN N AKAFFD+ +QNP+                        L+R L K+ +     K+ 
Sbjct: 296 SNPNYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSEKTK 355

Query: 463 EEIDEIKRTTESTMGSGMMKNLGFDPTQGKIASVFKHQRSDSDKKPLTEKDSSVASLLSF 522
           +E  ++K+ TE T+ SG++KN+GFDPT+GK+  V K  +  + K     K   V  ++  
Sbjct: 356 QEQKQMKQATEQTIHSGLLKNIGFDPTKGKMRDVLKVGK--NSKNSTDTKSIQVREIIET 413

Query: 523 KKDNVKLKPSKEILIKQKRRRERVWKEHF 551
           +K NV L PSK    K+  RRE+VWKEHF
Sbjct: 414 RKTNVSLAPSKADQKKRLLRREQVWKEHF 442

>AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL150C (MCM10)
          Length = 611

 Score =  331 bits (849), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 178/460 (38%), Positives = 268/460 (58%), Gaps = 29/460 (6%)

Query: 108 TTSFFIEKYSTSKRKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNLWIS 167
           TTS+F EK++ ++      +R +++LL  RV+TF       EY     +E+E +SN+ I+
Sbjct: 134 TTSYFAEKFARARDSSASTMRRKQELLKRRVYTFSDRDTAIEYTTFAVDEVETYSNMRIN 193

Query: 168 KRYIPKEEQRSIFANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSAAS 227
           KRY+P+E+ + I  +IK+LRL KLFAKV+PPKF+EP Y+NW  +G IS K +VK TS   
Sbjct: 194 KRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLGAISYKSDVKSTSQEK 253

Query: 228 PKKYFKFTLTNFQYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSG------TK 281
           P KYF   +T+F Y +   +FG++ VE+YY LRVGD+IAILNP++ PW+ S        +
Sbjct: 254 PAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEIYPWKESAKTTGETAR 313

Query: 282 AHIKSFNLRISHKFECILEIGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKF 341
              +SF L I H   CILEIG S++LG+CP  NK+K   C APINK KE  C YH+E   
Sbjct: 314 TTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKTKGAPCGAPINKLKEQVCSYHQETHL 373

Query: 342 RSTNAKRVELSGTYALGAPTRIDAQPALYRGGSSQK---NLNYNIITNGADGGSNKEINP 398
           RS NAKRVEL+G  +L APTR   Q A Y   +S      L  ++    A G   K    
Sbjct: 374 RSVNAKRVELNGNISLRAPTRDGIQQAGYMTRNSHGTKIGLLPDVYAPRAPGAEQK---- 429

Query: 399 LDINARHFSNRNAAKAFFDERFQNPETXXXXXXXXXXXXXXXXSNILNRELK---KNSEL 455
                 HF++ NA +A+FD  + NP+                    +N++L      +  
Sbjct: 430 ---FREHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQINKQLSLVLGKNHT 486

Query: 456 DIKHKSAEE-IDEIKRTTESTMGSGMMKNLGFDPTQGKIASVF---KHQRSDSDKKPLTE 511
            +K + +EE + + ++ T++ M +G+++++GFDPT G++A+V     H  +D+ ++P   
Sbjct: 487 QVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGGRMAAVLYQGDHGPADTVREP--- 543

Query: 512 KDSSVASLLSFKKDNVKLKPSKEILIKQKRRRERVWKEHF 551
              S++ +L+ KK N+ LKPSKE   K+ ++R  V+   F
Sbjct: 544 ---SISEILANKKRNIDLKPSKEARRKRIQQRNEVYNSIF 580

>KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp,
           577 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 577

 Score =  298 bits (764), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 191/558 (34%), Positives = 301/558 (53%), Gaps = 16/558 (2%)

Query: 1   MRDPREVLNNDLYDVLTSXXXXXXXXXXXXXXXXRQKKDLLQRLNV--KKTNPKPLDPNL 58
           + DPRE+   D Y+ L+                  +K+DL  RL    KK N K  DPN 
Sbjct: 5   LTDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTNRLLELEKKRNLK--DPNF 62

Query: 59  SHIQVESSPKKVTNSVLP-PTVQQQEPRGEVRNENLNELKAQSQEQIP-ANTTSFFIEKY 116
             I V  SPKK  N+      ++   P  ++     N  +   +E++    TTS+F EK 
Sbjct: 63  DSIDVPESPKKSDNATKGIEDIKHIAPVADIEEATFNVNEDYVREKVKKLGTTSYFTEKL 122

Query: 117 STSKRKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNLWISKRYIPKEEQ 176
            +    +   ++ +++LL++RV+TF G    DEY+PI  +E ++ S L I +RY+P    
Sbjct: 123 RSINTNEHEAIKRKKELLAHRVYTFNGDMF-DEYEPITVDEKDDLSGLVIDRRYVPLAVL 181

Query: 177 RSIFANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSAASPKKYFKFTL 236
           R    NIK+LRL KLF+KV+ PKF+EP Y NW V+G+IS K E + T++  P K+F  T+
Sbjct: 182 RKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSVKPVKFFSLTI 241

Query: 237 TNFQYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWR--PSGTKAHIKSFNLRISHK 294
           ++FQ+ ++   FGK  VE+YY LR+GD+IAILNP+++P +   +G      +F+L++S  
Sbjct: 242 SDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAGASPSYATFSLKVSKD 301

Query: 295 FECILEIGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKFRSTNAKRVELSGT 354
              ILE+G S++ G C  + K+K ++C APINK  ++ C YH+E K R  +++RVE+S +
Sbjct: 302 TNNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQNSSRRVEISSS 361

Query: 355 YALGAPTRIDAQPALYRGGSSQKNLNYNII--TNGADGGSNKEINPLDINARHFSNRNAA 412
            A+ AP     Q  + +   SQ N     I      D    +E    + N   FS+ NA+
Sbjct: 362 VAMRAPVVKGYQQTIVK---SQHNNGKTSIRYQQNPDKPFVREPAAAETNRFLFSSANAS 418

Query: 413 KAFFDERFQNPETXXXXXXXXXXXXXXXXSNILNRELKKNSELDIKHKSAEEIDEIKRT- 471
            AFFD+ ++NP+                 +  L ++LK  S+  +  K      E K+T 
Sbjct: 419 TAFFDDDYENPDILANLDNKRRKIQELRNNRNLEKKLKGLSDKLLSKKEDRVNQEAKKTA 478

Query: 472 TESTMGSGMMKNLGFDPTQGKIASVFKHQRSDSDKKPLTEKDSSVASLLSFKKDNVKLKP 531
           T S    G+   +G+DPT+GK AS+   + S  +K P  +K  ++  + + KKDNV LKP
Sbjct: 479 TLSMFQHGLANQIGYDPTKGK-ASLEMLEYSTENKAPKNDKQLAITDICNIKKDNVSLKP 537

Query: 532 SKEILIKQKRRRERVWKE 549
           SK+ L ++  +R  ++ E
Sbjct: 538 SKKQLKEKIEKRNAIFNE 555

>SAKL0G12826g Chr7 (1097824..1098834) [1011 bp, 336 aa] {ON} highly
           similar to uniprot|Q07938 Saccharomyces cerevisiae
           YLR017W MEU1 Methylthioadenosine phosphorylase (MTAP)
           catalyzes the initial step in the methionine salvage
           pathway affects polyamine biosynthesis through
           regulation of ornithine decarboxylase (Spe1p) activity
           regulates ADH2 gene expression
          Length = 336

 Score = 33.9 bits (76), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 8/54 (14%)

Query: 227 SPKKYFKFT-----LTNFQYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPW 275
           +P+K+ + T      T F  SID  I G  G   +Y L   + IAIL P   PW
Sbjct: 11  APRKFIRMTESQKLPTTFDGSIDLAIIGGTG---FYKLNCLEPIAILPPMSTPW 61

>Kpol_1010.46 s1010 complement(101192..103756) [2565 bp, 854 aa]
           {ON} complement(101192..103756) [2565 nt, 855 aa]
          Length = 854

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 4/73 (5%)

Query: 91  ENLNELKAQSQEQIPANTTSFFIEKYSTSKRKQDYEVRAQEDLLSNRVHTFQGARRQDEY 150
           ENL +L A + + I +NT    +E Y    R QD      +DLL +++   Q       +
Sbjct: 186 ENLPKLAAHADKNIRSNTMDLIVEIYDKLGRNQD----IIQDLLLDQLKPIQQRDLITLF 241

Query: 151 KPIPTNELEEFSN 163
             +PTN++ + S+
Sbjct: 242 NKLPTNDINDNSD 254

>TBLA0E04150 Chr5 (1045827..1048658) [2832 bp, 943 aa] {ON}
           Anc_8.223 YDR089W
          Length = 943

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 3/78 (3%)

Query: 445 LNRELKKNSELDIKHKSAEEIDEIKRTTESTMG-SGM-MKNLGFDPTQGKIASVFKHQRS 502
           L ++L K + ++ K  S + I+ IK ++E T+G  G+   NL  DP   +I+ + +   S
Sbjct: 126 LFKKLLKYTPVEYKQLSLKAINSIKHSSEYTVGYEGITFSNLQLDPYLQEISVILEQVES 185

Query: 503 DSDKKPLTEKDSSVASLL 520
           DS    L +K  S+ SLL
Sbjct: 186 DSCDTKLNKK-PSLNSLL 202

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,397,385
Number of extensions: 2788271
Number of successful extensions: 7887
Number of sequences better than 10.0: 60
Number of HSP's gapped: 8168
Number of HSP's successfully gapped: 60
Length of query: 569
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 454
Effective length of database: 40,294,809
Effective search space: 18293843286
Effective search space used: 18293843286
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)