Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0G06556g5.704ON37937918560.0
TDEL0B021605.704ON3753288081e-105
NCAS0A031905.704ON3983838041e-104
SAKL0E14960g5.704ON3843737741e-100
KNAG0C066105.704ON3863597234e-92
KLTH0E01012g5.704ON3863717201e-91
Kwal_55.196885.704ON3933747141e-90
KAFR0H002005.704ON3893747061e-89
TPHA0D046205.704ON4063916723e-84
CAGL0G02519g5.704ON3783636642e-83
KLLA0A00550g5.704ON3803676364e-79
AFR288C5.704ON4653085947e-72
NDAI0E050505.704ON4513405632e-67
Kpol_YGOB_Anc_5.7045.704ON2072024152e-48
KLTH0C10406g6.48ON553111990.001
Kwal_56.225506.48ON553112820.13
AGR256W6.48ON57995810.17
NDAI0K028706.48ON66294790.35
SAKL0E02068g6.48ON55895770.49
TPHA0M017203.414ON320103677.1
ADL321W3.343ON69785678.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0G06556g
         (379 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0G06556g Chr7 (518731..519870) [1140 bp, 379 aa] {ON} conser...   719   0.0  
TDEL0B02160 Chr2 (384824..385951) [1128 bp, 375 aa] {ON} Anc_5.704    315   e-105
NCAS0A03190 Chr1 (626695..627891) [1197 bp, 398 aa] {ON} Anc_5.704    314   e-104
SAKL0E14960g Chr5 complement(1244456..1245610) [1155 bp, 384 aa]...   302   e-100
KNAG0C06610 Chr3 complement(1282191..1283351) [1161 bp, 386 aa] ...   283   4e-92
KLTH0E01012g Chr5 (96295..97455) [1161 bp, 386 aa] {ON} conserve...   281   1e-91
Kwal_55.19688 s55 (79793..80974) [1182 bp, 393 aa] {ON} [contig ...   279   1e-90
KAFR0H00200 Chr8 (25900..27069) [1170 bp, 389 aa] {ON} Anc_5.704      276   1e-89
TPHA0D04620 Chr4 complement(1010489..1011709) [1221 bp, 406 aa] ...   263   3e-84
CAGL0G02519g Chr7 complement(228822..229958) [1137 bp, 378 aa] {...   260   2e-83
KLLA0A00550g Chr1 (50099..51241) [1143 bp, 380 aa] {ON} conserve...   249   4e-79
AFR288C Chr6 complement(958787..960184) [1398 bp, 465 aa] {ON} N...   233   7e-72
NDAI0E05050 Chr5 complement(1156499..1157854) [1356 bp, 451 aa] ...   221   2e-67
Kpol_YGOB_Anc_5.704 s2001 complement(209387..210010) [624 bp, 20...   164   2e-48
KLTH0C10406g Chr3 complement(862020..863681) [1662 bp, 553 aa] {...    43   0.001
Kwal_56.22550 s56 (176751..178412) [1662 bp, 553 aa] {ON} YLR260...    36   0.13 
AGR256W Chr7 (1223989..1225728) [1740 bp, 579 aa] {ON} Syntenic ...    36   0.17 
NDAI0K02870 Chr11 complement(648772..650760) [1989 bp, 662 aa] {...    35   0.35 
SAKL0E02068g Chr5 (158331..160007) [1677 bp, 558 aa] {ON} simila...    34   0.49 
TPHA0M01720 Chr13 complement(357834..358796) [963 bp, 320 aa] {O...    30   7.1  
ADL321W Chr4 (130698..132791) [2094 bp, 697 aa] {ON} Syntenic ho...    30   8.5  

>ZYRO0G06556g Chr7 (518731..519870) [1140 bp, 379 aa] {ON} conserved
           hypothetical protein
          Length = 379

 Score =  719 bits (1856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/379 (92%), Positives = 351/379 (92%)

Query: 1   MASKESLGIFGEFEYYVTFAKDGSKYTSFQLEKSHAKQXXXXXXXXXXXXLIVLDSLKSG 60
           MASKESLGIFGEFEYYVTFAKDGSKYTSFQLEKSHAKQ            LIVLDSLKSG
Sbjct: 1   MASKESLGIFGEFEYYVTFAKDGSKYTSFQLEKSHAKQSSRASTRSDDSTLIVLDSLKSG 60

Query: 61  IGRTENNDFYSIVIAPILEELNWNHNYIKTTSHDSVSQFAQSLDPLQDYEIWIISGDTTI 120
           IGRTENNDFYSIVIAPILEELNWNHNYIKTTSHDSVSQFAQSLDPLQDYEIWIISGDTTI
Sbjct: 61  IGRTENNDFYSIVIAPILEELNWNHNYIKTTSHDSVSQFAQSLDPLQDYEIWIISGDTTI 120

Query: 121 SEFCNNLPNKKITRNPLRILPLPMGTGNAWANSLGFDSPITAFRNYLNHNLKPRDIPLYR 180
           SEFCNNLPNKKITRNPLRILPLPMGTGNAWANSLGFDSPITAFRNYLNHNLKPRDIPLYR
Sbjct: 121 SEFCNNLPNKKITRNPLRILPLPMGTGNAWANSLGFDSPITAFRNYLNHNLKPRDIPLYR 180

Query: 181 AALPNGYSIIFFMIFSLGFHANLLHACEDPKYAKMGAERFQIAAQSILESYSLDLDISLD 240
           AALPNGYSIIFFMIFSLGFHANLLHACEDPKYAKMGAERFQIAAQSILESYSLDLDISLD
Sbjct: 181 AALPNGYSIIFFMIFSLGFHANLLHACEDPKYAKMGAERFQIAAQSILESYSLDLDISLD 240

Query: 241 GLRRSYAYFALINTPNLEATYKPSPRSNPXXXXXXXXXXXXXXXXQELVEKIMQGYQNKP 300
           GLRRSYAYFALINTPNLEATYKPSPRSNP                QELVEKIMQGYQNKP
Sbjct: 241 GLRRSYAYFALINTPNLEATYKPSPRSNPLERELRLLGYSSSLGRQELVEKIMQGYQNKP 300

Query: 301 NGDLPTNEDMIYKSITHDFTLVLNDSLEDSSMHKFEICCDGILLNLLDYQSPDKHKPSNE 360
           NGDLPTNEDMIYKSITHDFTLVLNDSLEDSSMHKFEICCDGILLNLLDYQSPDKHKPSNE
Sbjct: 301 NGDLPTNEDMIYKSITHDFTLVLNDSLEDSSMHKFEICCDGILLNLLDYQSPDKHKPSNE 360

Query: 361 IRFQFLNDYSGFQLQVYSL 379
           IRFQFLNDYSGFQLQVYSL
Sbjct: 361 IRFQFLNDYSGFQLQVYSL 379

>TDEL0B02160 Chr2 (384824..385951) [1128 bp, 375 aa] {ON} Anc_5.704
          Length = 375

 Score =  315 bits (808), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 155/328 (47%), Positives = 211/328 (64%), Gaps = 3/328 (0%)

Query: 51  LIVLDSLKSGIGRTENNDFYSIVIAPILEELNWNHNYIKTTSHDSVSQFAQSLDPLQDYE 110
           LIV+DS+ SG GRT  ND Y+IV+ PI E +N +H  IKTTS D+++ +A +LD  Q + 
Sbjct: 49  LIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTLDISQSHT 108

Query: 111 IWIISGDTTISEFCNNLPNKKITRNPLRILPLPMGTGNAWANSLGFDSPITAFRNYLNHN 170
           +  +SGDT+ISEF NNLP    + N L IL  PMG+GNAWA+SLG   P+  F  ++   
Sbjct: 109 VLFLSGDTSISEFINNLPQGAPSAN-LSILSFPMGSGNAWASSLGIMCPVKTFGQFIRGE 167

Query: 171 LKPRDIPLYRAALPNGYSIIFFMIFSLGFHANLLHACEDPKYAKMGAERFQIAAQSILES 230
           +     PLY+A  PNGYSI+FF+I S+GFHANL+HACE P+Y +MG E+FQ+A   IL+ 
Sbjct: 168 MSHSPFPLYKAVFPNGYSIVFFIILSMGFHANLVHACERPEYQRMGIEKFQLAGSVILKE 227

Query: 231 YSLDLDISLDGLRRSYAYFALINTPNLEATYKPSPRSNPXXXXXXXXXXXXXXXXQELVE 290
           Y LDL I+++ L  SY+YFALINTPNLE  Y+PSP S+P                 + + 
Sbjct: 228 YELDLKITVNSLAASYSYFALINTPNLEPAYRPSPESDPLKEELYLLGYSSGLSKDQFLT 287

Query: 291 KIMQGYQNKPNGDLPTNEDMIYKSITHDFTLVLNDSLEDSSMHKFEICCDGILLNLLDYQ 350
           K+M+GY+  P+  LP + D IY   T  F + L+  L +S  +K EICCDG+LLNL D Q
Sbjct: 288 KVMKGYELGPSDKLPLDSDTIYVPFTKGFDVTLDFPLLESPRYKSEICCDGVLLNLQDLQ 347

Query: 351 SPDKHKPSNEIRFQFLNDYSGFQLQVYS 378
           +    + SN+   +FLN YS F ++  S
Sbjct: 348 A--DLEVSNKFSIEFLNHYSKFNIKAMS 373

>NCAS0A03190 Chr1 (626695..627891) [1197 bp, 398 aa] {ON} Anc_5.704
          Length = 398

 Score =  314 bits (804), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 177/383 (46%), Positives = 226/383 (59%), Gaps = 20/383 (5%)

Query: 15  YYVTFAKDGSKYTSFQL--EKS---HAKQXXXXXXXXXXXXLIVLDSLKSGIGRTENNDF 69
           YYV    +GS Y SF L  E S      +            LIV+DS+ SG GRT +NDF
Sbjct: 17  YYVETVLEGSAYKSFNLLIEDSTPLSVDRKLQFVPLKDTAQLIVIDSIHSGGGRTSDNDF 76

Query: 70  YSIVIAPILEELNWNHNYIKTTSHDSVSQFAQSLDPLQDYEIWIISGDTTISEFCNNLPN 129
           Y  V+ PI  +LN  H  +KTTS DSV  FA  LD  + YEI+ +SGDTTISEF N LP 
Sbjct: 77  YRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYEIFFLSGDTTISEFINGLPK 136

Query: 130 KKI----TRNPLRILPLPMGTGNAWANSLGFDSPITAFRNYLNHNLKPRDIPLYRAALPN 185
           + +     +N L ILP P GTGNA ANSLG   P T F NYL  N    + PLY+A  PN
Sbjct: 137 QSLDVNDAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNYLTSNYSINNFPLYKAIFPN 196

Query: 186 GYSIIFFMIFSLGFHANLLHACEDPKYAKMGAERFQIAAQSILESYSLDLDISLDGLR-- 243
           G  I+FF+I SLGFHANLLH CE P Y K+G ERF+IA++ IL +Y LDL+IS++  R  
Sbjct: 197 GNEIVFFVILSLGFHANLLHCCEAPHYKKLGVERFRIASEDILANYDLDLNISIESPRGL 256

Query: 244 ------RSYAYFALINTPNLEATYKPSPRSNPXXXXXXXXXXXXXXXXQELVEKIMQGYQ 297
                 R Y+YF ++NTP LEA Y PSP+SNP                 EL+ +I++GY+
Sbjct: 257 SPIVPSREYSYFVVVNTPKLEAKYIPSPQSNPLRSQLHIIAYSSSLPKDELMARILKGYE 316

Query: 298 NKPNGDLPTNEDMIYKSITHDFTLVLNDSLEDSSMHKFEICCDGILLNLLDYQSPDKHKP 357
           N   GD+  N  + Y  I  +F + LN S E S   KF++CCDG+L NL D+   + + P
Sbjct: 317 NNI-GDVVNNTGVTYLPIEDNFIIKLNYSQEYSPSSKFQLCCDGLLFNLNDFIHKNDNGP 375

Query: 358 --SNEIRFQFLNDYSGFQLQVYS 378
             +NEI  +FL+ YS FQL + S
Sbjct: 376 CKNNEILIEFLSTYSPFQLSLMS 398

>SAKL0E14960g Chr5 complement(1244456..1245610) [1155 bp, 384 aa]
           {ON} conserved hypothetical protein
          Length = 384

 Score =  302 bits (774), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 165/373 (44%), Positives = 220/373 (58%), Gaps = 6/373 (1%)

Query: 10  FGEFEYYVTFAKDGSKYTSFQL--EKSHAKQXXXXXXXXXXXXLIVLDSLKSGIGRTENN 67
            G   Y V   KDGS Y+SF L  EK                 LI+LDS+ SGIGR    
Sbjct: 12  IGSTLYSVDIEKDGSVYSSFVLKAEKLSTVSSSLISLPSANSELIILDSVMSGIGRKTQA 71

Query: 68  DFYSIVIAPILEELNWNHNYIKTTSHDSVSQFAQSLDPLQDYEIWIISGDTTISEFCNNL 127
           DF + VI PILE+L   H  IKT S  S+++FA+ ++P + Y I  +SGDT+ISEF N++
Sbjct: 72  DFSTQVIKPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYTIIFLSGDTSISEFLNHI 131

Query: 128 PNKKI-TRNPLRILPLPMGTGNAWANSLGFDSPITAFRNYLNHNLKPRDIPLYRAALPNG 186
           P +   +++ L I P+PMGTGNAWA+SL    P+ +F+ +L ++L     PLYRA+ PNG
Sbjct: 132 PTQNSNSKHALNIYPIPMGTGNAWASSLNLKCPVESFQKFLKNDLIASKFPLYRASFPNG 191

Query: 187 YSIIFFMIFSLGFHANLLHACEDPKYAKMGAERFQIAAQSILESYSLDLDISL-DGLRRS 245
           YS IFF+I S+GFHANLLH C   KY  MG ERF+ A+  I ++Y L   +S+ + +   
Sbjct: 192 YSTIFFIILSIGFHANLLHLCNHSKYKVMGVERFKAASAQIFKNYDLKYKVSIPNRVSGC 251

Query: 246 YAYFALINTPNLEATYKPSPRSNPXXXXXXXXXXXXXXXXQELVEKIMQGYQNKPNGDLP 305
           YAYFA+INTPNLE TYKPSP S+P                 EL+++I +G +    GD  
Sbjct: 252 YAYFAIINTPNLEPTYKPSPLSDPLTSALHLLGFESSLKSSELIKRITRG-RTAQKGDDI 310

Query: 306 TNEDMIYKSITHDFTLVLNDSLEDSSMHKFEICCDGILLNLLDYQSPDKHKPSNEIRFQF 365
            +  +IY+ +  DF +V+  S   S   KFEICCDG LLNLLD Q  +       I+  F
Sbjct: 311 MDTGVIYEKLEKDFDIVVEHSPSASDRIKFEICCDGQLLNLLDMQGTEGSF-DGTIKVSF 369

Query: 366 LNDYSGFQLQVYS 378
           L DYS F L+V S
Sbjct: 370 LQDYSPFNLKVLS 382

>KNAG0C06610 Chr3 complement(1282191..1283351) [1161 bp, 386 aa]
           {ON} Anc_5.704
          Length = 386

 Score =  283 bits (723), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 155/359 (43%), Positives = 210/359 (58%), Gaps = 5/359 (1%)

Query: 17  VTFAKDGSKYTSFQLEKSHAKQXXXXXXXXXXXXLIVLDSLKSGIGRTENNDFYSIVIAP 76
           V   KDGSKYT F L      Q            LIVLDS+ SG GRT  ND    VI P
Sbjct: 19  VEIDKDGSKYTKFALLSEPCPQECAPPQLFTRENLIVLDSVHSGTGRTSGNDITVNVIEP 78

Query: 77  ILEELNWNHNYIKTTSHDSVSQFAQSLDPLQDYEIWIISGDTTISEFCNNL-PNKKITRN 135
           +L  L+  +  +K+ +  SV++F   LDP Q Y I  +SGDT++SEF N +       R+
Sbjct: 79  VLRRLHARYQVVKSQNSKSVAEFGNQLDPTQSYTILFVSGDTSVSEFFNGVGAGVPSPRS 138

Query: 136 PLRILPLPMGTGNAWANSLGFDSPITAFRNYLNHNLKPRDIPLYRAALPNG-YSIIFFMI 194
            L ILP+ MGTGNA ANSL  + P+ AF ++L   L   + PLYRA LP+G  S++FF++
Sbjct: 139 SLTILPIAMGTGNALANSLNLNCPVEAFASFLRGELVTAEFPLYRAILPDGETSVVFFIV 198

Query: 195 FSLGFHANLLHACEDPKYAKMGAERFQIAAQSILESYSLDLDISLD--GLRRSYAYFALI 252
            SLGFHANLLHA E+ KY  MG ERFQ A+  IL++Y L   I+LD  G+  SYAYFAL+
Sbjct: 199 LSLGFHANLLHAAENEKYKSMGVERFQEASGDILQNYKLQEQITLDKQGVAGSYAYFALV 258

Query: 253 NTPNLEATYKPSPRSNPXXXXXXXXXXXXXXXXQELVEKIMQGYQNKPNGDLPTNEDMIY 312
           N PNLEA+Y PSP+S+P                ++L+E+IM GY+N+   +L  +    Y
Sbjct: 259 NVPNLEASYIPSPQSDPFKHELHLLAYSSSLNRKQLLERIMAGYKNRRGDELTADPYTTY 318

Query: 313 KSITHDFTLVLNDSLEDSSMHKFEICCDGILLNLLDYQSPDKHKPSNEIRFQFLNDYSG 371
           K I+  F + L +  E  +   FE+C DG L NLL Y+S D+H+    I+ + ++   G
Sbjct: 319 KRISEGFEIKLQNKQEGPNDPAFELCLDGQLYNLLQYKS-DQHQEELTIQVELIDSALG 376

>KLTH0E01012g Chr5 (96295..97455) [1161 bp, 386 aa] {ON} conserved
           hypothetical protein
          Length = 386

 Score =  281 bits (720), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 151/371 (40%), Positives = 211/371 (56%), Gaps = 11/371 (2%)

Query: 14  EYYVTFAKDGSKYTSFQL---EKSHAKQXXXXXXXXXXXXLIVLDSLKSGIGRTENNDFY 70
           +++     D +KYTSF L      +               ++++DS+KSG GR   N+F 
Sbjct: 16  QFWACVETDDNKYTSFSLVSRPNEYGDASLDPQLTRGQKDILIVDSIKSGTGRDSRNNFG 75

Query: 71  SIVIAPILEELNWNHNYIKTTSHDSVSQFAQSLDPLQDYEIWI-ISGDTTISEFCNNLPN 129
             V+ P+   L   H  ++T   D+  Q   +  P  +  I I +SGDTTISEF N L N
Sbjct: 76  KNVLEPLFTLLGIPHKVVRTQDSDAAGQLGHTFQPSTENTILIFLSGDTTISEFLNGL-N 134

Query: 130 KKI---TRNPLRILPLPMGTGNAWANSLGFDSPITAFRNYLNHNLKPRDIPLYRAALPNG 186
           +++    R+ L ++PLP+GTGNAWANSLG   P  +   +L   L PR  PLY+A  PNG
Sbjct: 135 RRVFEGLRHTLSLVPLPLGTGNAWANSLGLRCPAASLSCFLQGQLTPRKFPLYKATFPNG 194

Query: 187 YSIIFFMIFSLGFHANLLHACEDPKYAKMGAERFQIAAQSILESYSLDLDISLDGL-RRS 245
           + +IFF+I S+GFHANLLH C+  ++  +G ERF+IA+  IL+ Y L+  + + GL  R 
Sbjct: 195 FEMIFFIILSIGFHANLLHLCKQQRFQSLGVERFKIASLEILQKYPLEYRLQVSGLPTRD 254

Query: 246 YAYFALINTPNLEATYKPSPRSNPXXXXXXXXXXXXXXXXQELVEKIMQGYQNKPNGDLP 305
           Y+YFALINTPNLEA+YKPSP+SN                   LV KIM+GY N+   D+ 
Sbjct: 255 YSYFALINTPNLEASYKPSPQSNSLHFQLHVLGYSSKLQQASLVSKIMKGYSNRAGDDI- 313

Query: 306 TNEDMIYKSITHDFTLVLNDSLEDSSMHKFEICCDGILLNLLDYQSPDKHKPSNEIRFQF 365
           + + +IY+   H   +V +   E+ S   FEICCDG LLN+L  Q P   K    IR QF
Sbjct: 314 SGDGVIYEPYNHALEVVFDQVPENVSNTYFEICCDGHLLNMLSLQ-PQDQKFDGRIRIQF 372

Query: 366 LNDYSGFQLQV 376
           L ++S F+L V
Sbjct: 373 LKNFSSFELNV 383

>Kwal_55.19688 s55 (79793..80974) [1182 bp, 393 aa] {ON} [contig
           159] FULL
          Length = 393

 Score =  279 bits (714), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 152/374 (40%), Positives = 217/374 (58%), Gaps = 12/374 (3%)

Query: 14  EYYVTFAKDGSKYTSFQLEKSHAKQXXXXX----XXXXXXXLIVLDSLKSGIGRTENNDF 69
           ++ V    +GSK  SF L +    Q                ++V+DS+KSG GR   NDF
Sbjct: 16  QFSVVVETEGSKNVSFSLLRHPNDQFSATLDPELVSRKKGDILVVDSIKSGTGRDVKNDF 75

Query: 70  YSIVIAPILEELNWNHNYIKTTSHDSVSQFAQSLDPL-QDYEIWIISGDTTISEFCNNLP 128
            + VI P+  EL  ++  +KT + +SV++  ++  P  Q+  +  +SGDT+ISEF NNL 
Sbjct: 76  CTNVIQPVFTELGLDYRVVKTENENSVAELGRNFRPCGQNTTVIFLSGDTSISEFVNNLT 135

Query: 129 NKK--ITRNPLRILPLPMGTGNAWANSLGFDSPITAFRNYLNHNLKPRDIPLYRAALPNG 186
            ++    R  + +L LP+GTGNAWANSLGF +  TA   +L   LKP++ PLY+A  PNG
Sbjct: 136 QEQQGTIRPTVNLLALPLGTGNAWANSLGFRTAATALAEFLQGFLKPKNFPLYKAIFPNG 195

Query: 187 YSIIFFMIFSLGFHANLLHACEDPKYAKMGAERFQIAAQSILESYSLD--LDISLDGLRR 244
           Y I+FF+I S+GFHANLLH C+ P++ K+G ERF++A++ I E Y LD  L ++   L  
Sbjct: 196 YEIVFFIILSIGFHANLLHLCDQPRFKKLGVERFRLASKEIFEDYILDYPLQVTQRPLEH 255

Query: 245 SYAYFALINTPNLEATYKPSPRSNPXXXXXXXXXXXXXXXXQELVEKIMQGYQNKPNGDL 304
            Y+YFALINTPNLE  YKPSP+SNP                  L+ +IM+GY N+P  D+
Sbjct: 256 -YSYFALINTPNLEQNYKPSPKSNPLTSELHLLGYSSGLPQPMLINRIMKGYSNQPETDI 314

Query: 305 PTNEDMIYKSITHDFTLVLNDSLEDSSMHKFEICCDGILLNLLDYQSPDKHKPSNEIRFQ 364
              E + Y++ ++D  +V     E      F+ICCDG LLN+L  Q P        I  +
Sbjct: 315 -NEEGVTYQAFSNDLDVVFAQDPELVPRSAFDICCDGHLLNMLS-QQPAHGSFDGRIHVK 372

Query: 365 FLNDYSGFQLQVYS 378
           FL ++S F L+V S
Sbjct: 373 FLKEHSSFHLKVLS 386

>KAFR0H00200 Chr8 (25900..27069) [1170 bp, 389 aa] {ON} Anc_5.704
          Length = 389

 Score =  276 bits (706), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 152/374 (40%), Positives = 223/374 (59%), Gaps = 10/374 (2%)

Query: 11  GEFEYYVTFAKDGSKYTSFQLEKSHAKQXXXXXXXXXXXXLIVLDSLKSGIGRTENNDFY 70
           G   + V   KDGSKY +F+L     K             ++V+DS+ SG GR +NN FY
Sbjct: 16  GSQSFEVKITKDGSKYHAFKLVAKEVKDDKPCSPPHYEN-VVVIDSVSSGTGRNKNNHFY 74

Query: 71  SIVIAPILEELNWNHNYIKTTSHDSVSQFAQSLDPLQDYEIWIISGDTTISEFCNNLPNK 130
           +IVI PI +     H+Y KTT   S+S +A+SLD  + Y +  ISGDT+ISEF NNLP  
Sbjct: 75  NIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKSYTVIFISGDTSISEFINNLPPL 134

Query: 131 KITRNPLR----ILPLPMGTGNAWANSLGFDSPITAFRNYLNHNLKPRDIPLYRAALPNG 186
             T N L+    ILPLPMGTGNA+++S+G   PI    ++L++  +P   PLY    PNG
Sbjct: 135 LETSNGLKHTISILPLPMGTGNAFSSSIGHKCPIQTLSSFLHNRTQPSHFPLYEVIFPNG 194

Query: 187 YSIIFFMIFSLGFHANLLHACE-DPKYAKMGAERFQIAAQSILESYSLDLDISLDGLRRS 245
            ++IFF+I SLG HAN+LH CE DP+Y K G ERF++A + ++ +Y L++ + +  L  S
Sbjct: 195 KTVIFFIILSLGLHANVLHLCENDPQYKKYGEERFKLAFEKVMTTYDLNVRLQIPELDLS 254

Query: 246 --YAYFALINTPNLEATYKPSPRSNPXXXXXXXXXXXXXXXXQELVEKIMQGYQNKPNGD 303
             ++YF LINTPNLE++Y PSP S+P                ++L+  + QGY NK   +
Sbjct: 255 GAFSYFILINTPNLESSYIPSPLSDPFLEQLHVLGYSSSLNNEDLLNYVTQGYSNKLGDE 314

Query: 304 LPTNEDMIYKSITHDFTLVLNDSLEDSSMHKFEICCDGILLNLLDYQSPDKHKPSNEIRF 363
           L  + +M+YK I+ + ++VL +  E+S  +K++ICCDG+L NL D    +  K    ++ 
Sbjct: 315 LVESSNMVYKPISRNVSIVLTED-EESEKYKYDICCDGLLFNLRDMLPENPTKEDYVLKT 373

Query: 364 QFLN-DYSGFQLQV 376
            F + D   F++QV
Sbjct: 374 NFKSRDSLPFEVQV 387

>TPHA0D04620 Chr4 complement(1010489..1011709) [1221 bp, 406 aa]
           {ON} Anc_5.704
          Length = 406

 Score =  263 bits (672), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 149/391 (38%), Positives = 220/391 (56%), Gaps = 24/391 (6%)

Query: 11  GEFEYYVTFAKDGSKYTSFQLEKSHAKQXXXXXXXX---XXXXLIVLDSLKSGIGRTENN 67
           G+  Y V   K GSKY+SF+LE     +               L+V+DS+ SG+GRT  N
Sbjct: 17  GDMVYDVVAEKKGSKYSSFKLESYKCTEESAALEVHSLLASSELVVIDSICSGVGRTGQN 76

Query: 68  DFYSIVIAPILEELNWNHNYIKTTSHDSVSQFAQSLDPLQDYEIWIISGDTTISEFCNNL 127
           DFY+ V+ P+ +E N+ H YI+T   DS+   A   +  +DY I  +SGDT++SEF NNL
Sbjct: 77  DFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTIIFLSGDTSVSEFINNL 136

Query: 128 PNKKI--------TRNPLRILPLPMGTGNAWANSLGFDSPITAFRNYLNHNLKPRDIPLY 179
              +          +  + I  +P+GTGNA A+S+   SP   F+ +LN+ L  +D PLY
Sbjct: 137 TKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLSSPHQVFQKFLNNELIIKDFPLY 196

Query: 180 RAALPNGYSIIFFMIFSLGFHANLLHACEDPKYAKMGAERFQIAAQSILESYSLDLDISL 239
              LPN  +IIFF+IFS+GFHANLLHAC+  +Y KMG ERF  A+++I ++Y L++ ++ 
Sbjct: 197 TVTLPNKKTIIFFIIFSMGFHANLLHACDSDEYQKMGTERFAKASENIFKNYDLNIGLTT 256

Query: 240 ----DGLRRSYAYFALINTPNLEATYKPSPRSNPXXXXXXXXXXXXXXXXQELVEKIMQG 295
               + + R+YAYFA+INTPNLE  Y PSP S+                 ++LV KIM G
Sbjct: 257 KNGSESISRNYAYFAIINTPNLELNYMPSPDSDVFKNELHLLGYDASLSTEKLVNKIMAG 316

Query: 296 YQNKPNGDLPTNEDMIYK-----SITHDFTLVLNDSLEDSSMHKFEICCDGILLNLLDYQ 350
           Y  K    +   +++ Y      S T    ++  DS +    +K++ICCDG+LLNL D  
Sbjct: 317 YSYKEREKINNKDNLTYYYPVNLSGTGLQIILETDSDKKLEKYKYDICCDGLLLNLDDIN 376

Query: 351 SPDKHKPSNEIRF---QFLNDYSGFQLQVYS 378
           +      SN+ +    +F ND + FQL +++
Sbjct: 377 NQHGVAESNKNKITISKFPNDLN-FQLNLFA 406

>CAGL0G02519g Chr7 complement(228822..229958) [1137 bp, 378 aa] {ON}
           similar to KLLA0A00550g Kluyveromyces lactis
          Length = 378

 Score =  260 bits (664), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 145/363 (39%), Positives = 213/363 (58%), Gaps = 10/363 (2%)

Query: 13  FEYYVTFAKDGSKYTSFQLEKSHAKQXXXXXXXXXXXXLIVLDSLKSGIGRTENNDFYSI 72
            +Y V   +   K  S++L K++ +             +IV+DS+KSG  R + +D Y +
Sbjct: 13  IKYSVEIVEVKGKVESYKLIKANDRSTDCFLKFDRDTQIIVIDSVKSGTSRNDRSDLYKL 72

Query: 73  VIAPILEELNWNHNYIKTTSHDSVSQFAQ--SLDPLQDYEIWIISGDTTISEFCNNLPNK 130
           VI P+ + L   + YIKT S +S+  FA+  S      Y+I  +SGDT+ISEF N L   
Sbjct: 73  VIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQSGFKYDILFLSGDTSISEFINALDTT 132

Query: 131 KITRNPLRI--LPLPMGTGNAWANSLGFDSPITAFRNYLNHNLKPRDIPLYRAALPNGYS 188
            +     RI  LP+P+G+GNA A SLGF +P+ A   YLN N K   +PLY A LPN  S
Sbjct: 133 ILRSAKYRISILPVPLGSGNALATSLGFKTPLQALITYLNSNKKCSPLPLYDAQLPNSTS 192

Query: 189 IIFFMIFSLGFHANLLHACEDPKYAKMGAERFQIAAQSILESYSLDLDISLDGLR-RSYA 247
           +IFF+I SLGFHANLLH  EDPKY  MG ERFQ+A++++ ESY L++ I+++GL+ +SY+
Sbjct: 193 MIFFIILSLGFHANLLHCAEDPKYKSMGVERFQVASKTVFESYDLNVGIAVNGLQSQSYS 252

Query: 248 YFALINTPNLEATYKPSPRSNPXXXXXXXXXXXXXXXXQELVEKIMQGYQNKPNGDLPTN 307
           YFA+I  PNLE TYKPSP+S+                 ++L +KIM+GY NK   D+   
Sbjct: 253 YFAVIAAPNLEPTYKPSPKSSVLKKELHILGYKAGICLEDLQDKIMRGYHNKDGEDI-QE 311

Query: 308 EDMIYKSITHDFTLVLNDSLEDSSMHKFEICCDGILLNLLDYQSPDKHKPSNEIRFQFLN 367
              IY+    +  L +     ++  +++++C DG LLNL D  S D      +I  +F++
Sbjct: 312 IGTIYQCFQKNLELSIKTG-HNAPKYRYDMCIDGYLLNLEDCNSKDNEY---KILIRFID 367

Query: 368 DYS 370
           D++
Sbjct: 368 DHA 370

>KLLA0A00550g Chr1 (50099..51241) [1143 bp, 380 aa] {ON} conserved
           hypothetical protein
          Length = 380

 Score =  249 bits (636), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 144/367 (39%), Positives = 206/367 (56%), Gaps = 13/367 (3%)

Query: 2   ASKESLGIFGEFEYYVTFAKDGSKYTSFQLEKS--HAKQXXXXXXXXXXXXLIVLDSLKS 59
            +K+ LGI+    + +          S+QL       ++            L+++DS+ S
Sbjct: 10  VTKQELGIYNGVSFTIVTKLLAEGAKSYQLGSKLLDDEKLLANKKFEYSGELLIVDSVFS 69

Query: 60  GIGRTENNDFYSIVIAPILEELNWNHNYIKTTSHDSVSQFAQSLDPLQDYEIWIISGDTT 119
           G GR ++ DF + VIA   E++   +  IKTTS  SV + A S+D  + Y +  +SGDT+
Sbjct: 70  GSGRDKDCDFATNVIAQFFEQVIVPYRLIKTTSKSSVIELASSIDSTRQYTVLFLSGDTS 129

Query: 120 ISEFCNNLPNKKITRNPLRILPLPMGTGNAWANSLGFDSPITAFRNYLNHNLKPRDIPLY 179
           ISEF NNLP   +  + + +LP PMGTGNAWA+SL    P   F  ++N  L   D PLY
Sbjct: 130 ISEFVNNLP---LNHDCISVLPFPMGTGNAWASSLKLMDPAVIFSQFVNGKLSCNDFPLY 186

Query: 180 RAALPNGYSIIFFMIFSLGFHANLLHACEDPKYAKMGAERFQIAAQSILESYSLDLDISL 239
           RA   NGY + FF+I SLGFHANLLH CE+ +Y KMG ERF++A+Q IL  Y L+  +S+
Sbjct: 187 RATFDNGYVLKFFIILSLGFHANLLHLCEEDEYQKMGIERFRVASQRILREYKLESRVSI 246

Query: 240 -DGLRRSYAYFALINTPNLEATYKPSPRSNPXXXXXXXXXXXXXXXXQELVEKIMQGYQN 298
            D L  S++YFALINT NLE TY PSP S+P                 E  +++  GY N
Sbjct: 247 PDILEGSFSYFALINTTNLEPTYMPSPDSDPLESQLHVLAYQSSLDRVEFQKRVFMGYSN 306

Query: 299 KPNGDLPTNEDMIYKSITHDFTL-VLNDSLEDSSMHKFEICCDGILLNLLDYQSPDKHKP 357
             + ++  N    Y+ +   F + VL+D  + S+   FE+CCDG LLNLL+ +   K+ P
Sbjct: 307 TKHSNILQN-GTFYRPLPFCFNVEVLDDPSQKSN---FEVCCDGQLLNLLELEG--KNTP 360

Query: 358 SNEIRFQ 364
            + IR +
Sbjct: 361 PSTIRIE 367

>AFR288C Chr6 complement(958787..960184) [1398 bp, 465 aa] {ON}
           NOHBY633; No homolog in Saccharomyces cerevisiae;
           Methionine is very probably wrong'
          Length = 465

 Score =  233 bits (594), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 122/308 (39%), Positives = 179/308 (58%), Gaps = 13/308 (4%)

Query: 51  LIVLDSLKSGIGRTENNDFYSIVIAPILEELNWNHNYIKTTSHDSVSQFAQSLDPLQDYE 110
           L+VLDS++SG GR    DFY+ V+ P+L  L+  H Y++T+S  SV + A++     +  
Sbjct: 137 LVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRTSETT 196

Query: 111 IWIISGDTTISEFCNNLPNKKITRNPLRILPLPMGTGNAWANSLGFDSPITAFRNYLNHN 170
           + ++SGDTTISEF N L +       + +  LP+GT NAWA+S+G  +P  A + ++   
Sbjct: 197 VLVMSGDTTISEFVNALGSGA----GVTVYALPLGTANAWAHSVGLGTPAKALQAFVQGR 252

Query: 171 LKPRDIPLYRAALPNGYSIIFFMIFSLGFHANLLHACEDPKYAKMGAERFQIAAQSILES 230
           +     PLYRA  P+GYSI FF++ S GFHANLLH C D +Y ++G ERF+ A+  IL+ 
Sbjct: 253 VHAVPFPLYRARFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVERFREASTEILDR 312

Query: 231 YSLDLDISL---DG---LRRSYAYFALINTPNLEATYKPSPRSNPXXXXXXXXXXXXXXX 284
           Y+L   + +   DG   L   YAYFAL+NTP+LE TY PSP S+P               
Sbjct: 313 YALAEHVRVRAADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHVLAFEAELS 372

Query: 285 XQELVEKIMQGYQNKPNGDLPTNEDMIYKSITHDFTLVLNDSLEDSSMHKFEICCDGILL 344
             +L E +M GY     G   +   ++Y+++   FTL + +   D   +  E+C DG LL
Sbjct: 373 RDKLNELLMAGYSTI-RGSALSAPGLVYRNLGDSFTLSIENGASDRVAN--ELCVDGHLL 429

Query: 345 NLLDYQSP 352
           NL+D Q+P
Sbjct: 430 NLVDLQAP 437

>NDAI0E05050 Chr5 complement(1156499..1157854) [1356 bp, 451 aa]
           {ON} Anc_5.704
          Length = 451

 Score =  221 bits (563), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 137/340 (40%), Positives = 194/340 (57%), Gaps = 39/340 (11%)

Query: 51  LIVLDSLKSGIGRTENNDFYSIVIAPILEELNWNHNYIKTTSHDSVSQFAQSL-----DP 105
           LI++DS  SG+GR + NDFY+I++ PIL +LN      KTTS DS+  FA +      D 
Sbjct: 84  LIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFELFKTTSKDSIKSFANNFSIKTKDT 143

Query: 106 LQ-DYEIWIISGDTTISEFCNNLPNK--KITRNPLRILPLPMGTGNAWANSLGFDSPITA 162
            + DY +  +SGDTTISEF NNLP +  + ++  L IL +PMGT NAW+NSL  + PI  
Sbjct: 144 TKIDYNLIFLSGDTTISEFFNNLPPQQPQTSKINLNILTIPMGTANAWSNSLNLNCPIDI 203

Query: 163 FRNYLNHNLKPRDIPLYRAALPNGY-------------SIIFFMIFSLGFHANLLHACE- 208
           F+ +L + L     PLY   LP+               +I FF++ S+GFHANLLH C  
Sbjct: 204 FQKFLLNKLTVSPFPLYSLILPHSPSSSSSSGKTGGKNTIYFFIVLSMGFHANLLHLCSN 263

Query: 209 DPKYAKMGAERFQIAAQSILESYSLDLDISLDG--------LRRSYAYFALINTPNLEAT 260
           D KY+ +G ERF++A+  IL +Y+L+L+I+++         L  S++YF L+NTP LE  
Sbjct: 264 DEKYSNLGLERFKLASDEILSNYNLNLNITIESCNDKSHIILNDSFSYFNLMNTPKLEYN 323

Query: 261 YKPSPRSNPXXXXXXXXXXXXX-XXXQELVEKIMQGYQNKPNGDLPTNED---MIYKSIT 316
           Y PSP S+P                 Q+L++ IM+GY N+       N D   +IY  I 
Sbjct: 324 YIPSPLSDPLKNNLHVLAYKSHPYNKQQLIKNIMKGYSNELGQKNIQNIDEDGIIYFPIN 383

Query: 317 -HDFTLVLND----SLEDSSMHKFEICCDGILLNLLDYQS 351
              F + LN+    S   S  H +E+CCDG+L NLL+YQ+
Sbjct: 384 DKKFKITLNNPSPISSSLSLSHNYELCCDGMLFNLLNYQT 423

>Kpol_YGOB_Anc_5.704 s2001 complement(209387..210010) [624 bp, 207
           aa] {ON} ANNOTATED BY YGOB -
          Length = 207

 Score =  164 bits (415), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 121/202 (59%), Gaps = 7/202 (3%)

Query: 181 AALPNGYSIIFFMIFSLGFHANLLHACEDPKYAKMGAERFQIAAQSILESYSLDLDISLD 240
           A  P+   I FF+I SLGFHA LLHAC  P+  KMG ERFQ+AA+ ILE+Y LDL+I ++
Sbjct: 2   ATFPDDSRIYFFIILSLGFHATLLHACSRPELLKMGTERFQLAAKEILETYDLDLNIKVN 61

Query: 241 GLRRSYAYFALINTPNLEATYKPSPRSNPXXXXXXXXXXXXXXXXQELVEKIMQGYQNKP 300
              R YAYFA+INT NLE TY PSP+SN                  ELV+KIM+GY  + 
Sbjct: 62  KSTRRYAYFAIINTSNLELTYCPSPKSNVLENSLQLLGYSSKLSRAELVDKIMKGYIIRK 121

Query: 301 NGDLPTNEDMIYKSI---THDFTLVLNDSLEDSSMHKFEICCDGILLNLLDYQSPDKHKP 357
              + T+E   Y+++        +++++ + +S+ HKFEICCDG+LL+L++     K + 
Sbjct: 122 GDVIKTDEYTYYETLDLSQSGIDIIVDEKMNNSNTHKFEICCDGLLLDLME---KSKGRT 178

Query: 358 SN-EIRFQFLNDYSGFQLQVYS 378
            N  I    + DY  F LQV +
Sbjct: 179 DNLTIHINSVKDYLSFDLQVLT 200

>KLTH0C10406g Chr3 complement(862020..863681) [1662 bp, 553 aa] {ON}
           similar to uniprot|Q12246 Saccharomyces cerevisiae
           YLR260W LCB5 Minor sphingoid long-chain base kinase
           paralog of Lcb4p responsible for few percent of the
           total activity possibly involved in synthesis of long-
           chain base phosphates which function as signaling
           molecules and similar to YOR171c
          Length = 553

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 48/111 (43%), Gaps = 4/111 (3%)

Query: 62  GRTENNDFYSIVIAPILEELNWNHNYIKTTSHDSVSQFAQSLDPLQDYEIWIISGDTTIS 121
           G+      Y   + PIL   N     ++TT H   +  A+++D  +   I   SGD    
Sbjct: 189 GKGHAKKLYLSKVKPILAASNCTVETVETTYHGHATDLAKTVDADKFDIIACASGDGIPH 248

Query: 122 EFCNNL---PNKKITRNPLRILPLPMGTGNAWANSL-GFDSPITAFRNYLN 168
           E  N L   P++    N L I  LP G+GNA + S  G  +P  A  N L 
Sbjct: 249 EVLNGLFQRPDRADAFNKLIITQLPCGSGNAMSVSCHGTTNPSHAALNILK 299

>Kwal_56.22550 s56 (176751..178412) [1662 bp, 553 aa] {ON} YLR260W
           (LCB5) - sphingoid long chain base (LCB) kinase [contig
           185] FULL
          Length = 553

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 49/112 (43%), Gaps = 6/112 (5%)

Query: 62  GRTENNDFYSIVIAPILEELNWNHNYIKTTSHDSVSQFAQSLDPLQDYE-IWIISGDTTI 120
           G+      Y   + PIL         I+TT H    + A++++ +  Y+ I   SGD   
Sbjct: 187 GKGHAKKLYLSKVKPILTASPSFVEAIETTYHGHAIELAKNIN-IDKYDVIACASGDGIP 245

Query: 121 SEFCNNL---PNKKITRNPLRILPLPMGTGNAWANSL-GFDSPITAFRNYLN 168
            E  N L   P++    N L I  LP G+GNA + S  G  +P  A  N L 
Sbjct: 246 HEVLNGLYQRPDRAAAFNKLVITQLPCGSGNAMSVSCHGTTNPSHAALNVLK 297

>AGR256W Chr7 (1223989..1225728) [1740 bp, 579 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR260W (LCB5) and
           YOR171C (LCB4)
          Length = 579

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 42/95 (44%), Gaps = 3/95 (3%)

Query: 62  GRTENNDFYSIVIAPILEELNWNHNYIKTTSHDSVSQFAQSLDPLQDYEIWIISGDTTIS 121
           G+ + +  Y     PIL   +   + ++T      ++ A ++D  +   I   SGD    
Sbjct: 205 GKGKAHKLYVTKAKPILVASDCQIDVVETKYSSHAAEIAATMDINKYDVIACASGDGIPH 264

Query: 122 EFCNNL---PNKKITRNPLRILPLPMGTGNAWANS 153
           E  N L   P++    N L I  LP G+GNA + S
Sbjct: 265 EVLNGLFTRPDRVAAFNKLAITQLPCGSGNAMSIS 299

>NDAI0K02870 Chr11 complement(648772..650760) [1989 bp, 662 aa] {ON}
           Anc_6.48 YLR260W
          Length = 662

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 43/94 (45%), Gaps = 5/94 (5%)

Query: 62  GRTENNDFYSIVIAPILEELNWNHNYIKTTSHDSVSQFAQSLDPLQDYE-IWIISGDTTI 120
           G+ + +  ++    PIL   N     I TT     +  A+SLD +  Y+ I   SGD   
Sbjct: 272 GKGKASKLFNKWSKPILSTSNCKFEIINTTYSSHATDIAKSLD-ISKYDIIACASGDGIP 330

Query: 121 SEFCNNL---PNKKITRNPLRILPLPMGTGNAWA 151
            E  N L   P++    N L I  +P G+GNA +
Sbjct: 331 YEVINGLYQRPDRVDAFNKLTITQIPCGSGNAMS 364

>SAKL0E02068g Chr5 (158331..160007) [1677 bp, 558 aa] {ON} similar
           to uniprot|Q12246 Saccharomyces cerevisiae YLR260W LCB5
           Minor sphingoid long-chain base kinase paralog of Lcb4p
           responsible for few percent of the total activity
           possibly involved in synthesis of long-chain base
           phosphates which function as signaling molecules and
           similar to YOR171c
          Length = 558

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 39/95 (41%), Gaps = 3/95 (3%)

Query: 62  GRTENNDFYSIVIAPILEELNWNHNYIKTTSHDSVSQFAQSLDPLQDYEIWIISGDTTIS 121
           G+   N  Y     PIL         ++TT H      AQ++D  +   I   SGD    
Sbjct: 191 GKGRANKLYVSKAKPILIASQCTVEILETTYHRHAIDIAQNIDIDKYDVIACASGDGIPH 250

Query: 122 EFCNNL---PNKKITRNPLRILPLPMGTGNAWANS 153
           E  N L    ++    N + I  LP G+GNA + S
Sbjct: 251 EVLNGLYRRADRAKAFNKVAITQLPCGSGNAMSVS 285

>TPHA0M01720 Chr13 complement(357834..358796) [963 bp, 320 aa] {ON}
           Anc_3.414 YGR084C
          Length = 320

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 42/103 (40%), Gaps = 14/103 (13%)

Query: 175 DIPLY-RAALPNGYSI--IFFMIFSLGFHANLLHACEDPKYA----------KMGAERFQ 221
           +IP + +A     Y I   F  I +   H N +    DP  A            G + F 
Sbjct: 141 NIPKFQKAGNVEAYDIDHFFNAILTCNLHRNKIKVYNDPTIALKKINVAFTNSKGTDTFG 200

Query: 222 IAAQSILESYSLDLDISLDGLRRSYAYFALINTPNLEATYKPS 264
           +A + +++  +  L+ S D L   Y     IN P LE T KPS
Sbjct: 201 LA-KPLIQQLAKQLNFSADELISKYKMAQEINLPQLEETNKPS 242

>ADL321W Chr4 (130698..132791) [2094 bp, 697 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR102C (EXO84)
          Length = 697

 Score = 30.4 bits (67), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 37/85 (43%), Gaps = 2/85 (2%)

Query: 178 LYRAALPNGYSIIFFMIFSLGFHANLLHACEDPKYAKMGAERFQIAAQSILESYSLDLDI 237
           LYR+  P GY+ +   I S       ++  E+    K+    F    QS  +S S D+  
Sbjct: 368 LYRSRTPTGYTALLNEIKSAKDELRDIYQAEEDNARKL--RDFFTYLQSTQQSPSRDISS 425

Query: 238 SLDGLRRSYAYFALINTPNLEATYK 262
              G  R  +   L NTP+  +TY+
Sbjct: 426 PARGHSRQRSLGTLQNTPSRASTYQ 450

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,328,641
Number of extensions: 1802301
Number of successful extensions: 4204
Number of sequences better than 10.0: 24
Number of HSP's gapped: 4241
Number of HSP's successfully gapped: 24
Length of query: 379
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 268
Effective length of database: 40,753,473
Effective search space: 10921930764
Effective search space used: 10921930764
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)