Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0G06512g2.152ON60460428970.0
TDEL0B051402.152ON59960422430.0
SAKL0E10956g2.152ON60052120580.0
Kpol_1048.212.152ON59752120060.0
Kwal_33.147672.152ON59460420030.0
KLTH0B05170g2.152ON59352119920.0
Smik_14.2072.152ON61753819180.0
TPHA0I015102.152ON60360319050.0
YNL121C (TOM70)2.152ON61753819010.0
Ecym_82042.152ON59760618880.0
Suva_14.2192.152ON61753818740.0
Skud_14.2112.152ON61753818730.0
NCAS0G024802.152ON59660118470.0
ABR131W2.152ON59452118280.0
TBLA0C055302.152ON61051918020.0
CAGL0L12936g2.152ON60052617780.0
NCAS0B070102.152ON62562317700.0
NDAI0F028102.152ON60960617560.0
KNAG0H035302.152ON61452817480.0
KLLA0F24046g2.152ON60452217350.0
KAFR0F007202.152ON60852216840.0
Suva_15.3142.152ON64453316030.0
Skud_8.1782.152ON63853315990.0
Smik_8.1952.152ON63553215750.0
YHR117W (TOM71)2.152ON63953215680.0
CAGL0L04048g2.152ON58760315480.0
NDAI0B043402.152ON66453215110.0
NCAS0G008105.617ON584911466e-09
ACR005W6.21ON3271201392e-08
Kpol_1037.266.21ON3421201303e-07
AEL224W5.617ON580791314e-07
TBLA0E033005.617ON582761304e-07
SAKL0G07084g5.617ON585761295e-07
Smik_15.2055.617ON589791296e-07
NDAI0F009105.617ON5831481262e-06
YOR027W (STI1)5.617ON589791262e-06
Suva_8.805.617ON586851252e-06
TPHA0J003406.21ON338881232e-06
TPHA0D032203.481ON5131061242e-06
CAGL0H08195g5.617ON583791242e-06
AAR083C3.481ON5381611233e-06
Ecym_44133.481ON510911233e-06
Kwal_55.199355.617ON593861224e-06
TDEL0A048405.617ON576851224e-06
KAFR0B066103.481ON511971215e-06
Kpol_1018.695.617ON590761207e-06
NDAI0B057903.481ON523921208e-06
Ecym_30256.21ON318981189e-06
KAFR0C058905.617ON575851199e-06
KNAG0M011706.21ON339991171e-05
Skud_15.1925.617ON589881181e-05
NCAS0H008306.21ON3381001161e-05
CAGL0E02739g6.21ON3431001152e-05
NDAI0I022406.21ON3501011143e-05
Kpol_1032.86.21ON3431111143e-05
KLLA0D01155g6.21ON335961124e-05
SAKL0E01210g6.21ON3231041125e-05
TPHA0D028805.617ON585791135e-05
KAFR0L004106.21ON331991115e-05
KLLA0A07062g5.617ON581801126e-05
Ecym_55825.617ON584851126e-05
KLTH0F14542g3.481ON5131061118e-05
TBLA0G010506.21ON3501051108e-05
TPHA0M016303.367ON10431241128e-05
CAGL0D05060g3.481ON510911119e-05
ZYRO0A05676g5.617ON572761111e-04
KNAG0B032005.617ON579851091e-04
TBLA0A072706.21ON373871081e-04
KLTH0E02178g5.617ON593761092e-04
Ecym_20906.328ON172591032e-04
KNAG0A079003.481ON5121061064e-04
ZYRO0C16522g3.367ON9741271064e-04
TDEL0G044806.21ON343981044e-04
Suva_4.3613.367ON9631281064e-04
KAFR0H008703.367ON8871271056e-04
TBLA0C039503.481ON512921046e-04
Smik_2.2543.367ON10201281047e-04
YBR112C (CYC8)3.367ON9661281038e-04
Kpol_505.413.481ON513971038e-04
NCAS0A00490singletonON620971030.001
SAKL0A01672g6.328ON12862950.001
Skud_2.2403.367ON9841281030.001
KNAG0H006103.367ON9731271020.001
Kwal_56.224336.21ON32272990.002
ZYRO0C07788g6.21ON334109990.002
NDAI0D008106.21ON34999980.002
TDEL0E027505.352ON564123990.002
TDEL0D055003.481ON51292990.002
YOR007C (SGT2)6.21ON346104980.003
CAGL0D01364g3.367ON1148127990.003
Skud_15.1686.21ON34871970.003
Suva_3.956.328ON11170900.003
SAKL0F03102g3.481ON513137970.004
Suva_15.1826.21ON346118960.004
KLTH0C11220g6.21ON32772950.005
Smik_15.1766.21ON34585950.005
KAFR0C018505.352ON646104960.006
Kwal_27.118908.506ON33489950.006
NCAS0A112003.367ON907127960.006
Kwal_55.211753.481ON511104960.006
Smik_4.5795.352ON667111960.006
Suva_7.4083.481ON513106950.006
TBLA0H033808.506ON37586950.006
TBLA0H019705.352ON840109960.006
NDAI0C043205.352ON706130950.008
YDR320C (SWA2)5.352ON668111950.008
TPHA0L014208.506ON374118930.010
Kpol_513.28.506ON37489930.011
KNAG0C055005.352ON585121930.011
TDEL0A074306.328ON12447870.012
KLLA0B10912g3.481ON51294920.014
Kpol_172.23.367ON418112910.019
Skud_2.2828.506ON38580900.024
YGR123C (PPT1)3.481ON51391900.025
NDAI0I004406.328ON12867840.031
SAKL0H11946g8.470ON57389890.032
TPHA0E007407.412ON746143900.034
Suva_2.4895.352ON659111890.037
Smik_6.2153.481ON513106890.037
TDEL0C027207.412ON700149890.038
TBLA0F012303.367ON1189121890.039
TBLA0I023106.328ON11661820.040
YCR060W (TAH1)6.328ON11158820.043
ZYRO0B04224g3.481ON51391880.046
Smik_2.2958.506ON385136880.048
YBR155W (CNS1)8.506ON38579870.051
NCAS0F028705.352ON700111880.055
TPHA0E011105.352ON693110860.086
CAGL0H07095g5.352ON661107860.089
AAR054C6.328ON13364810.094
NDAI0A051003.367ON1007109860.095
Skud_7.4323.481ON51391850.10
KNAG0I025206.328ON11790790.12
SAKL0F16236g7.546ON1408185850.12
YPR189W (SKI3)7.546ON143273850.13
KNAG0F040107.546ON141880850.14
AGL294W7.412ON65650840.14
CAGL0H07425g8.506ON38090830.16
Ecym_71427.412ON67550840.16
KLLA0B09966g8.506ON37093830.18
TBLA0H015203.367ON689115830.20
KLLA0C06006g6.38ON51274830.21
Kwal_27.117378.470ON57589820.24
Kpol_339.135.352ON686111820.25
Smik_3.1596.328ON11567760.31
TDEL0B013108.506ON380118810.32
NCAS0D045006.328ON12171760.33
TBLA0D004607.412ON835120810.33
Kpol_1057.142.665ON724231810.36
KLTH0E10934g8.470ON56889810.36
Smik_16.4537.546ON141773810.37
CAGL0K09240g6.328ON14267760.41
NCAS0D026706.21ON351180790.44
TDEL0H002507.546ON139747810.44
AGL268C8.506ON37979790.45
Kwal_23.36703.367ON802139800.46
ZYRO0B03828g7.412ON727141800.47
KAFR0J025706.328ON12159750.51
KNAG0H001602.665ON780102800.53
TPHA0D038606.328ON12073740.56
NCAS0E024907.412ON809147790.58
KLLA0B09262g3.367ON941110790.65
Skud_4.5865.352ON642111780.71
Kpol_1018.1067.412ON753108770.99
SAKL0H06886g8.662ON287104761.0
Kpol_1067.251.456ON391100771.0
SAKL0B07986g3.367ON880106771.1
Suva_16.5217.546ON142473771.1
TPHA0M002706.21ON37784761.1
Kpol_1050.1127.546ON136049761.3
KLTH0F10428g3.367ON795106761.5
Ecym_34593.367ON1115106751.7
KLTH0E11748g8.506ON37879751.7
KLTH0H14872g5.352ON623109751.7
Suva_4.4058.506ON38575741.8
KAFR0E029808.506ON38089741.8
TBLA0B079705.72ON687113751.8
Suva_2.347.412ON76366752.0
Smik_2.367.412ON75154752.0
KLLA0C08910g6.328ON11546702.1
YBL084C (CDC27)7.412ON75866742.2
ZYRO0D00572g2.665ON785205742.3
KNAG0B022407.412ON739144742.3
ADL344W3.367ON910106742.5
NDAI0G037103.5ON112198742.6
KAFR0A023708.235ON120693742.7
ZYRO0F08624g8.506ON37979732.7
Skud_16.4937.546ON142573733.2
KAFR0B002507.546ON142047733.4
TDEL0C050903.367ON75992723.9
NDAI0E040407.412ON783145724.1
NDAI0F004005.689ON76499724.2
KAFR0C038202.665ON70464715.0
TDEL0B016608.470ON54989707.5
Ecym_25598.506ON37079697.6
KLLA0B10197g5.352ON621120707.7
CAGL0H10098g3.265ON86170708.1
Suva_8.1295.689ON74149698.5
CAGL0K05599g5.689ON71049698.5
NDAI0C052908.506ON37980699.1
KLTH0A00638g7.546ON141191699.2
TPHA0G002407.546ON1430165699.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0G06512g
         (604 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...  1120   0.0  
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...   868   0.0  
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...   797   0.0  
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...   777   0.0  
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...   776   0.0  
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...   771   0.0  
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...   743   0.0  
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...   738   0.0  
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...   736   0.0  
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...   731   0.0  
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...   726   0.0  
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...   726   0.0  
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...   716   0.0  
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...   708   0.0  
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...   698   0.0  
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...   689   0.0  
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...   686   0.0  
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...   681   0.0  
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...   677   0.0  
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...   672   0.0  
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...   653   0.0  
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...   622   0.0  
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...   620   0.0  
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...   611   0.0  
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...   608   0.0  
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...   600   0.0  
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...   586   0.0  
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    61   6e-09
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...    58   2e-08
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...    55   3e-07
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    55   4e-07
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    55   4e-07
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    54   5e-07
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    54   6e-07
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     53   2e-06
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    53   2e-06
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    53   2e-06
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...    52   2e-06
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    52   2e-06
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    52   2e-06
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    52   3e-06
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    52   3e-06
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    52   4e-06
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    52   4e-06
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    51   5e-06
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    51   7e-06
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    51   8e-06
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...    50   9e-06
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    50   9e-06
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...    50   1e-05
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    50   1e-05
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...    49   1e-05
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...    49   2e-05
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...    49   3e-05
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...    49   3e-05
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...    48   4e-05
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...    48   5e-05
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    48   5e-05
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...    47   5e-05
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    48   6e-05
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    48   6e-05
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    47   8e-05
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...    47   8e-05
TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa] ...    48   8e-05
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    47   9e-05
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    47   1e-04
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    47   1e-04
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...    46   1e-04
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    47   2e-04
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    44   2e-04
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    45   4e-04
ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]...    45   4e-04
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...    45   4e-04
Suva_4.361 Chr4 complement(631697..632812,632933..633154,633188....    45   4e-04
KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.3...    45   6e-04
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    45   6e-04
Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {O...    45   7e-04
YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}  ...    44   8e-04
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    44   8e-04
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       44   0.001
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    41   0.001
Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON...    44   0.001
KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.36...    44   0.001
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...    43   0.002
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...    43   0.002
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...    42   0.002
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...    43   0.002
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    43   0.002
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...    42   0.003
CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} simil...    43   0.003
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...    42   0.003
Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W (R...    39   0.003
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    42   0.004
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...    42   0.004
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...    41   0.005
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...    41   0.005
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...    42   0.006
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    41   0.006
NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa] ...    42   0.006
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    42   0.006
Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {...    42   0.006
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    41   0.006
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    41   0.006
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...    42   0.006
NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {O...    41   0.008
YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}...    41   0.008
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    40   0.010
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    40   0.011
KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON} Anc_5...    40   0.011
TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6....    38   0.012
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    40   0.014
Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)...    40   0.019
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    39   0.024
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    39   0.025
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    37   0.031
SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]...    39   0.032
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    39   0.034
Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON...    39   0.037
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    39   0.037
TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.4...    39   0.038
TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {...    39   0.039
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    36   0.040
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    36   0.043
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    39   0.046
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    39   0.048
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    38   0.051
NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {O...    39   0.055
TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.3...    38   0.086
CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} simila...    38   0.089
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    36   0.094
NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON} Anc_...    38   0.095
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    37   0.10 
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    35   0.12 
SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON} sim...    37   0.12 
YPR189W Chr16 (912664..916962) [4299 bp, 1432 aa] {ON}  SKI3Ski ...    37   0.13 
KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7....    37   0.14 
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    37   0.14 
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    37   0.16 
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    37   0.16 
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    37   0.18 
TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.3...    37   0.20 
KLLA0C06006g Chr3 complement(530169..531707) [1539 bp, 512 aa] {...    37   0.21 
Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244...    36   0.24 
Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}...    36   0.25 
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    34   0.31 
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    36   0.32 
NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.32...    34   0.33 
TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {O...    36   0.33 
Kpol_1057.14 s1057 (25908..28082) [2175 bp, 724 aa] {ON} (25908....    36   0.36 
KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} simila...    36   0.36 
Smik_16.453 Chr16 (775191..779444) [4254 bp, 1417 aa] {ON} YPR18...    36   0.37 
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    34   0.41 
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...    35   0.44 
TDEL0H00250 Chr8 complement(33258..37451) [4194 bp, 1397 aa] {ON...    36   0.44 
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    35   0.45 
Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C...    35   0.46 
ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} simila...    35   0.47 
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    33   0.51 
KNAG0H00160 Chr8 complement(21501..23843) [2343 bp, 780 aa] {ON}...    35   0.53 
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    33   0.56 
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    35   0.58 
KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly...    35   0.65 
Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {...    35   0.71 
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    34   0.99 
SAKL0H06886g Chr8 complement(604406..605269) [864 bp, 287 aa] {O...    34   1.0  
Kpol_1067.25 s1067 (57301..58476) [1176 bp, 391 aa] {ON} (57301....    34   1.0  
SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {...    34   1.1  
Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR18...    34   1.1  
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...    34   1.1  
Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..25389...    34   1.3  
KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly...    34   1.5  
Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar ...    33   1.7  
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    33   1.7  
KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]...    33   1.7  
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    33   1.8  
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    33   1.8  
TBLA0B07970 Chr2 (1887119..1889182) [2064 bp, 687 aa] {ON} Anc_5...    33   1.8  
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    33   2.0  
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    33   2.0  
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    32   2.1  
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    33   2.2  
ZYRO0D00572g Chr4 complement(42511..44830,45510..45547) [2358 bp...    33   2.3  
KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {O...    33   2.3  
ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic ho...    33   2.5  
NDAI0G03710 Chr7 complement(894337..897702) [3366 bp, 1121 aa] {...    33   2.6  
KAFR0A02370 Chr1 (489885..493505) [3621 bp, 1206 aa] {ON} Anc_8....    33   2.7  
ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} simila...    33   2.7  
Skud_16.493 Chr16 (854949..859226) [4278 bp, 1425 aa] {ON} YPR18...    33   3.2  
KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON...    33   3.4  
TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {O...    32   3.9  
NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.4...    32   4.1  
NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}...    32   4.2  
KAFR0C03820 Chr3 complement(774134..776248) [2115 bp, 704 aa] {O...    32   5.0  
TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {O...    32   7.5  
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    31   7.6  
KLLA0B10197g Chr2 complement(891842..893707) [1866 bp, 621 aa] {...    32   7.7  
CAGL0H10098g Chr8 complement(984334..986919) [2586 bp, 861 aa] {...    32   8.1  
Suva_8.129 Chr8 (231888..234113) [2226 bp, 741 aa] {ON} YOR080W ...    31   8.5  
CAGL0K05599g Chr11 (545761..547893) [2133 bp, 710 aa] {ON} simil...    31   8.5  
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    31   9.1  
KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {O...    31   9.2  
TPHA0G00240 Chr7 complement(37417..41709) [4293 bp, 1430 aa] {ON...    31   9.2  

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score = 1120 bits (2897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 560/604 (92%), Positives = 560/604 (92%)

Query: 1   MSSDNSVAGFISRNKXXXXXXXXXXXXXXXXYLYYRQLQDAAGSDDKKGESPDGTXXXXX 60
           MSSDNSVAGFISRNK                YLYYRQLQDAAGSDDKKGESPDGT     
Sbjct: 1   MSSDNSVAGFISRNKTAIITTAAAGTAAVGAYLYYRQLQDAAGSDDKKGESPDGTAASKK 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXXXDEKGEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQK 120
                                  DEKGEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQK
Sbjct: 61  KRKNKKKKQGSSPSPSAAVSYPVDEKGEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQK 120

Query: 121 DYDNALKYYDYALTLKKDPVFYSNISACYVSMNQLDKVVENSTKALELKPDYSKALLRRA 180
           DYDNALKYYDYALTLKKDPVFYSNISACYVSMNQLDKVVENSTKALELKPDYSKALLRRA
Sbjct: 121 DYDNALKYYDYALTLKKDPVFYSNISACYVSMNQLDKVVENSTKALELKPDYSKALLRRA 180

Query: 181 SANESLENYPDAMFDLSVLSLNGDFGGSSIEPMLERNLNKQAMTVLKDKLGQQKNQLLPS 240
           SANESLENYPDAMFDLSVLSLNGDFGGSSIEPMLERNLNKQAMTVLKDKLGQQKNQLLPS
Sbjct: 181 SANESLENYPDAMFDLSVLSLNGDFGGSSIEPMLERNLNKQAMTVLKDKLGQQKNQLLPS 240

Query: 241 DTALASFFGIFTPETEFANYDETSEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAYA 300
           DTALASFFGIFTPETEFANYDETSEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAYA
Sbjct: 241 DTALASFFGIFTPETEFANYDETSEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAYA 300

Query: 301 KLREGNSDDAALKEKDAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIM 360
           KLREGNSDDAALKEKDAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIM
Sbjct: 301 KLREGNSDDAALKEKDAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIM 360

Query: 361 ADKGKAEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFP 420
           ADKGKAEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFP
Sbjct: 361 ADKGKAEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFP 420

Query: 421 YIQLACLAYRENKFDDCETLFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKR 480
           YIQLACLAYRENKFDDCETLFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKR
Sbjct: 421 YIQLACLAYRENKFDDCETLFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKR 480

Query: 481 LEEAVDGIHVGISPLVGKATLLARQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQLKL 540
           LEEAVDGIHVGISPLVGKATLLARQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQLKL
Sbjct: 481 LEEAVDGIHVGISPLVGKATLLARQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQLKL 540

Query: 541 QQEDIDDAIKLFEEAASLARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKA 600
           QQEDIDDAIKLFEEAASLARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKA
Sbjct: 541 QQEDIDDAIKLFEEAASLARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKA 600

Query: 601 QGVI 604
           QGVI
Sbjct: 601 QGVI 604

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score =  868 bits (2243), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/604 (72%), Positives = 490/604 (81%), Gaps = 5/604 (0%)

Query: 1   MSSDNSVAGFISRNKXXXXXXXXXXXXXXXXYLYYRQLQDAAGSDDKKGESPDGTXXXXX 60
           MSSDNSV+ F+SRNK                Y YYRQ Q AA  +D+KG           
Sbjct: 1   MSSDNSVSSFVSRNKTAIIATAAAGSAAIGAYYYYRQAQRAALDEDEKG-----AEGSES 55

Query: 61  XXXXXXXXXXXXXXXXXXXXXXXDEKGEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQK 120
                                   + GEP L+N+ E+S+E +E+++TALKD+GNEFFK+K
Sbjct: 56  SKKKKKNKKKKSGENGGTPVYPVGQNGEPLLENIEELSQELRETYATALKDRGNEFFKKK 115

Query: 121 DYDNALKYYDYALTLKKDPVFYSNISACYVSMNQLDKVVENSTKALELKPDYSKALLRRA 180
           DYDNALKYY+YAL +KKDPVFYSNISACYVS+ QLDKVVENSTKALELKPDYSKALLRRA
Sbjct: 116 DYDNALKYYNYALVVKKDPVFYSNISACYVSLGQLDKVVENSTKALELKPDYSKALLRRA 175

Query: 181 SANESLENYPDAMFDLSVLSLNGDFGGSSIEPMLERNLNKQAMTVLKDKLGQQKNQLLPS 240
           SANESLENY DAMFDLSVLSLNGDF GSSIEPMLERNLNKQAM VLKDKLG   +Q LPS
Sbjct: 176 SANESLENYADAMFDLSVLSLNGDFNGSSIEPMLERNLNKQAMFVLKDKLGNNVSQQLPS 235

Query: 241 DTALASFFGIFTPETEFANYDETSEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAYA 300
           +TALASFFGIF PET FANY+E  EAD  LK GLE+LYKRSSEGY+ ADE F ++   + 
Sbjct: 236 NTALASFFGIFPPETTFANYNENDEADVGLKNGLEDLYKRSSEGYKLADEAFVKSASFFT 295

Query: 301 KLREGNSDDAALKEKDAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIM 360
                  DDA LKEK AIALEH GIF+FLKNDPL AH+D++KAI LHPR+NSYIYMALIM
Sbjct: 296 NKLSEFPDDAVLKEKTAIALEHNGIFKFLKNDPLEAHDDIEKAIQLHPRLNSYIYMALIM 355

Query: 361 ADKGKAEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFP 420
           ADKG+AEEYY++FDKAI LDP     YYHRGQMY+IT QYEKAG+DFDKAK+ +E NIFP
Sbjct: 356 ADKGQAEEYYQYFDKAIALDPNYGPAYYHRGQMYYITGQYEKAGKDFDKAKECDENNIFP 415

Query: 421 YIQLACLAYRENKFDDCETLFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKR 480
           YIQLACLAYRE+KFDDCETLFSEAKRKF TAPEVPNF+AEIL DKGDLE ALKQY+IAKR
Sbjct: 416 YIQLACLAYREDKFDDCETLFSEAKRKFPTAPEVPNFYAEILGDKGDLEAALKQYEIAKR 475

Query: 481 LEEAVDGIHVGISPLVGKATLLARQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQLKL 540
           LEEA+DGIHVG++PLVGKATLLARQPSVENF EAT LLEEAC +DP SEQ KVGLAQLKL
Sbjct: 476 LEEALDGIHVGVAPLVGKATLLARQPSVENFREATLLLEEACRRDPTSEQAKVGLAQLKL 535

Query: 541 QQEDIDDAIKLFEEAASLARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKA 600
           QQE++D+AI LFEEAA+LARTVDEKLQATTFAEAAKVQKRI+ADP+VSAKIEETLAAY+A
Sbjct: 536 QQEEVDEAINLFEEAANLARTVDEKLQATTFAEAAKVQKRIKADPVVSAKIEETLAAYRA 595

Query: 601 QGVI 604
           QG++
Sbjct: 596 QGMM 599

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score =  797 bits (2058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/521 (73%), Positives = 455/521 (87%)

Query: 84  DEKGEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTLKKDPVFYS 143
           DE GEPKLD++ ++++EQKE ++  LKDKGNEFFK+K +D+A+KYY+ AL LKKDPVFYS
Sbjct: 80  DENGEPKLDDIDQLTDEQKEKYAMGLKDKGNEFFKEKKFDDAIKYYNLALELKKDPVFYS 139

Query: 144 NISACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVLSLNG 203
           N SACYVSM QL+KVVE++T AL+LK DYSK LLRRASANESL NY DAMFDLS LSL G
Sbjct: 140 NRSACYVSMGQLEKVVEDTTAALKLKSDYSKCLLRRASANESLGNYADAMFDLSALSLYG 199

Query: 204 DFGGSSIEPMLERNLNKQAMTVLKDKLGQQKNQLLPSDTALASFFGIFTPETEFANYDET 263
           DF G+SIEPMLERN+NKQAM VLK+KL ++K+  LPS+T+LASFFGIF PET F NYDE+
Sbjct: 200 DFNGASIEPMLERNMNKQAMLVLKEKLEEKKDHRLPSNTSLASFFGIFEPETSFENYDES 259

Query: 264 SEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAYAKLREGNSDDAALKEKDAIALEHR 323
            EAD+ L  GL NLYKR+SEGY  ADE F++A  AY  L E + ++  LK+K AIALEH 
Sbjct: 260 VEADRLLLQGLTNLYKRTSEGYDTADESFTKAAAAYKTLLEESPENEILKQKAAIALEHV 319

Query: 324 GIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKAEEYYEFFDKAIKLDPKN 383
           GIF+FLKNDPL AH+D+++A++ HPRVNSYIY+ALIMADKG+A EY+E FDKA++LDP  
Sbjct: 320 GIFKFLKNDPLSAHDDLKQALEYHPRVNSYIYLALIMADKGQATEYFENFDKALELDPNC 379

Query: 384 AAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRENKFDDCETLFSE 443
           AAVYYHRGQMYFIT QYE AG+DFDKAK+ NE NIFPYIQLACLAYRENKF+DCETLFSE
Sbjct: 380 AAVYYHRGQMYFITQQYENAGKDFDKAKECNENNIFPYIQLACLAYRENKFEDCETLFSE 439

Query: 444 AKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKRLEEAVDGIHVGISPLVGKATLLA 503
           A+RKF TAPEVPNF+AEIL+DKGDL  A KQY+IA++LE+A+DGIHVGI+PLVGKATLLA
Sbjct: 440 ARRKFPTAPEVPNFYAEILSDKGDLANAKKQYEIARKLEDALDGIHVGIAPLVGKATLLA 499

Query: 504 RQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQLKLQQEDIDDAIKLFEEAASLARTVD 563
           R+P+VENF+EAT+  EEAC KDPRSEQ K+GLAQLKLQQE++D+AI LFEEAA LAR+ D
Sbjct: 500 REPTVENFVEATQNFEEACEKDPRSEQAKIGLAQLKLQQEEVDEAITLFEEAADLARSFD 559

Query: 564 EKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKAQGVI 604
           EKLQATTFAEA K+QK+IRADP++SAKIEETLAAY+AQG+I
Sbjct: 560 EKLQATTFAEATKIQKKIRADPIISAKIEETLAAYRAQGMI 600

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score =  777 bits (2006), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/521 (71%), Positives = 443/521 (85%)

Query: 84  DEKGEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTLKKDPVFYS 143
           D  GEP L + A  +EEQKE++S ALKDKGN+FFK++ Y++ALKYY+YAL LK+DPVFYS
Sbjct: 77  DSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQDPVFYS 136

Query: 144 NISACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVLSLNG 203
           NISACYVS+  L+KVVE+STKALELKPDYSKALLRRASANE+LEN+ +AMFDLSVLSLNG
Sbjct: 137 NISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVLSLNG 196

Query: 204 DFGGSSIEPMLERNLNKQAMTVLKDKLGQQKNQLLPSDTALASFFGIFTPETEFANYDET 263
           DF  +SIEPMLERNLNKQAM VLKDK+     Q LPS+T LASFFGIFTPET   N+DE+
Sbjct: 197 DFNEASIEPMLERNLNKQAMRVLKDKMSSDAKQQLPSNTFLASFFGIFTPETTLKNFDES 256

Query: 264 SEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAYAKLREGNSDDAALKEKDAIALEHR 323
           +EAD +L   L NLYKR SE Y  ADE FS+A ++Y K  E N DD  LKEK A ALE+ 
Sbjct: 257 NEADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVLKEKTATALEYN 316

Query: 324 GIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKAEEYYEFFDKAIKLDPKN 383
           GIF+FLKNDPLG+HED+Q++I+LHPRVN+YIY ALIMADKG+++ Y++FFDKA+ +DP +
Sbjct: 317 GIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFDFFDKALDVDPNS 376

Query: 384 AAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRENKFDDCETLFSE 443
           A VYYHRGQM+F++ QYEKA  DF+KAK+ +  NIFPYIQLACL Y E KFDDCETLFSE
Sbjct: 377 APVYYHRGQMHFLSQQYEKAAADFEKAKESDSSNIFPYIQLACLTYHEGKFDDCETLFSE 436

Query: 444 AKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKRLEEAVDGIHVGISPLVGKATLLA 503
           AKRKF TAPEVPNF+AE+L DKGD + A KQYDIAKRLEE++D IHVG+SPLVGKATLLA
Sbjct: 437 AKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDAIHVGVSPLVGKATLLA 496

Query: 504 RQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQLKLQQEDIDDAIKLFEEAASLARTVD 563
           RQP+VEN +E+T LLEEAC  D RSEQ K+GLAQLKLQQE+ID+AI LFEEA+ LAR ++
Sbjct: 497 RQPTVENLLESTTLLEEACKMDSRSEQAKIGLAQLKLQQEEIDEAITLFEEASDLARNME 556

Query: 564 EKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKAQGVI 604
           EKLQATTFAEA+KVQK+IRADP+V+AKI+ TLAAY+ QG+I
Sbjct: 557 EKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGLI 597

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score =  776 bits (2003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/604 (64%), Positives = 466/604 (77%), Gaps = 10/604 (1%)

Query: 1   MSSDNSVAGFISRNKXXXXXXXXXXXXXXXXYLYYRQLQDAAGSDDKKGESPDGTXXXXX 60
           MSS+NS+  F++RNK                Y YY+QLQ     D K+            
Sbjct: 1   MSSENSLGQFVARNKTAIVASVAAGATAVGAYYYYQQLQKKPFEDGKE----------VG 50

Query: 61  XXXXXXXXXXXXXXXXXXXXXXXDEKGEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQK 120
                                  DEKGEP L  V E+S E+K+ ++  LKDKGNEFFK K
Sbjct: 51  DEPKPSKKKKKGKKKTQGPSFPVDEKGEPDLGKVDELSAEEKDKFAMGLKDKGNEFFKNK 110

Query: 121 DYDNALKYYDYALTLKKDPVFYSNISACYVSMNQLDKVVENSTKALELKPDYSKALLRRA 180
            +++ALKYY  A+ +K+DPVFYSN SACYVS+ Q +KVVE++T AL+LKPDYSK LLRRA
Sbjct: 111 QFEDALKYYSLAIEVKEDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRA 170

Query: 181 SANESLENYPDAMFDLSVLSLNGDFGGSSIEPMLERNLNKQAMTVLKDKLGQQKNQLLPS 240
           SANESL  + DAMFDLS +SL GDF GSSIEP+LERN+NKQAM VLK+KL +Q+   LPS
Sbjct: 171 SANESLGKFADAMFDLSAVSLYGDFNGSSIEPLLERNMNKQAMLVLKEKLEKQQEYKLPS 230

Query: 241 DTALASFFGIFTPETEFANYDETSEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAYA 300
           +T+LASFFGIF PET F NYDE SEAD+ L  GL NLYKR+S GY+ AD  FS+A D Y 
Sbjct: 231 NTSLASFFGIFQPETSFENYDENSEADKALLDGLTNLYKRTSGGYEAADAAFSKARDEYK 290

Query: 301 KLREGNSDDAALKEKDAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIM 360
            L E NS+DA+LK+K AIALEH GIF+FLKNDP+ AHED++KA++  PR N+YIYMALIM
Sbjct: 291 TLLEHNSEDASLKQKAAIALEHVGIFKFLKNDPISAHEDLKKAVEYFPRPNTYIYMALIM 350

Query: 361 ADKGKAEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFP 420
           ADKG+A EY++ F+KA++LDP  AAVYYHRGQM+FIT Q+E+AG+DF+KAK+LNE NIFP
Sbjct: 351 ADKGQATEYFDNFEKALELDPNCAAVYYHRGQMHFITQQFEQAGKDFEKAKELNESNIFP 410

Query: 421 YIQLACLAYRENKFDDCETLFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKR 480
           YIQLACL YRE KF D ETLFSEA+RKF T+PEVPNF+AE L+DKGD+  A K+YDIA +
Sbjct: 411 YIQLACLTYREGKFSDSETLFSEARRKFPTSPEVPNFYAETLSDKGDIAGAKKEYDIAAK 470

Query: 481 LEEAVDGIHVGISPLVGKATLLARQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQLKL 540
           LE A+DGIHVG+SPL+GKATLL+R+PSVENFIEAT+L E+AC  DPRSEQ K+GLAQLKL
Sbjct: 471 LESALDGIHVGVSPLIGKATLLSREPSVENFIEATRLFEQACENDPRSEQAKIGLAQLKL 530

Query: 541 QQEDIDDAIKLFEEAASLARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKA 600
           QQEDID+AI LFEEAA LAR+ DEKLQATTFAEA K+QK+IRADP+VSAKIEETLAAY+A
Sbjct: 531 QQEDIDEAIALFEEAADLARSFDEKLQATTFAEATKIQKKIRADPIVSAKIEETLAAYRA 590

Query: 601 QGVI 604
           QG+I
Sbjct: 591 QGMI 594

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/521 (71%), Positives = 448/521 (85%)

Query: 84  DEKGEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTLKKDPVFYS 143
           +EKGEP L N+AE+S+EQK+ ++  LKDKGNEFFK K YD A++YY +A+ +K+DPVFYS
Sbjct: 73  NEKGEPDLSNLAELSDEQKDKYAMGLKDKGNEFFKNKKYDEAIQYYSWAIEVKEDPVFYS 132

Query: 144 NISACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVLSLNG 203
           N SACYVS+ Q +KVVE++T AL+LKPDYSK LLRRASANESL N+ DAMFDLS +SL G
Sbjct: 133 NRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGNFADAMFDLSAVSLYG 192

Query: 204 DFGGSSIEPMLERNLNKQAMTVLKDKLGQQKNQLLPSDTALASFFGIFTPETEFANYDET 263
           DF G+SIEP+LERN+NKQ+M VLK+KL +Q+   LPS+T+LASFFGIF PET F NYD+ 
Sbjct: 193 DFSGASIEPLLERNMNKQSMLVLKEKLEKQQEYKLPSNTSLASFFGIFQPETTFENYDDN 252

Query: 264 SEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAYAKLREGNSDDAALKEKDAIALEHR 323
           SEAD+ L  GL NLYKR+++GY+ AD  F++A DA+  L E N +DA LK K AIALEH 
Sbjct: 253 SEADKYLLEGLTNLYKRTADGYETADLSFAKARDAFKVLLEQNPEDADLKRKAAIALEHV 312

Query: 324 GIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKAEEYYEFFDKAIKLDPKN 383
           GIF+FLKNDP+ AHED++KA++  PR N+YIYMALIMADKG+A EY++ F+KA+KLDP  
Sbjct: 313 GIFKFLKNDPISAHEDLKKAVEYFPRPNTYIYMALIMADKGQATEYFDNFEKALKLDPSC 372

Query: 384 AAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRENKFDDCETLFSE 443
           AAVYYHRGQMYFIT Q+E+AG+DF+KAK+L+E NIFPYIQLACL YRE KFDD ETLFSE
Sbjct: 373 AAVYYHRGQMYFITQQFEQAGKDFEKAKELSESNIFPYIQLACLTYREGKFDDSETLFSE 432

Query: 444 AKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKRLEEAVDGIHVGISPLVGKATLLA 503
           A+RKF TAPEVPNF+AE L+DKGDL  A KQYDIA +LE+A+DGIHVG+SPL+GKATLL+
Sbjct: 433 ARRKFPTAPEVPNFYAETLSDKGDLAGARKQYDIAAKLEDALDGIHVGVSPLIGKATLLS 492

Query: 504 RQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQLKLQQEDIDDAIKLFEEAASLARTVD 563
           R+PSVENF+EAT+L E+AC  DPRSEQ K+GLAQLKLQQEDID+AI LFEEAA LAR+ D
Sbjct: 493 REPSVENFVEATQLFEKACQNDPRSEQAKIGLAQLKLQQEDIDEAIALFEEAADLARSFD 552

Query: 564 EKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKAQGVI 604
           EKLQATTFAEA K+QK+IRADP+VSAKIEETLAAY+AQG+I
Sbjct: 553 EKLQATTFAEATKIQKKIRADPVVSAKIEETLAAYRAQGMI 593

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  743 bits (1918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/538 (68%), Positives = 433/538 (80%), Gaps = 20/538 (3%)

Query: 87  GEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTLKKDPVFYSNIS 146
           G+P   N A  + E+K+ ++ ALKDKGN+FF+ K YD+A+KYY++AL LK DPVFYSN+S
Sbjct: 80  GDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALELKDDPVFYSNLS 139

Query: 147 ACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVLSLNGDFG 206
           ACYVS+  L KVVE STKALELKPDYSK LLRRASANE L N+ DAMFDLSVLSLNGDF 
Sbjct: 140 ACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFN 199

Query: 207 GSSIEPMLERNLNKQAMTVLKDKLG--------------------QQKNQLLPSDTALAS 246
            +SIEPMLERNLNKQAM+ LK+K G                    + K + LPS T++AS
Sbjct: 200 DASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQAPKELKDKTENLPSITSMAS 259

Query: 247 FFGIFTPETEFANYDETSEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAYAKLREGN 306
           FFGIF PE  FANYDE++EAD+ L  GL NLYKRS E Y KADE F++AV  + +  + N
Sbjct: 260 FFGIFKPELTFANYDESNEADKDLMNGLTNLYKRSPESYDKADESFTKAVKLFDEQLDKN 319

Query: 307 SDDAALKEKDAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKA 366
           ++D   KEK AI+LEH GIF+FLKNDPLGAHED++KAI+L PRVNSYIYMALIMAD+  +
Sbjct: 320 NEDEKSKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIMADRNDS 379

Query: 367 EEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLAC 426
            EYY +FDKA+KLD  N++VYYHRGQM FI   Y++AG+DFDKAK+L+ ENIFPYIQLAC
Sbjct: 380 TEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLAC 439

Query: 427 LAYRENKFDDCETLFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKRLEEAVD 486
           LAYRENKFDDCETLFSEAKRKF  APEVPNFFAEIL DK D EKALKQYD+A  LE  +D
Sbjct: 440 LAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKALKQYDLAIELENKLD 499

Query: 487 GIHVGISPLVGKATLLARQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQLKLQQEDID 546
           GI+VGI+PLVGKATLL R P+VENFIEAT LLEEA   DPRSEQ K+GLAQ+KLQQEDID
Sbjct: 500 GIYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLDPRSEQAKIGLAQMKLQQEDID 559

Query: 547 DAIKLFEEAASLARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKAQGVI 604
           +AI LFEE+A LART++EKLQA TFAEAAKVQKRIR+DP+++AKI+ETLA  + QG++
Sbjct: 560 EAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDPILAAKIQETLAKLREQGLM 617

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score =  738 bits (1905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/603 (61%), Positives = 456/603 (75%), Gaps = 2/603 (0%)

Query: 2   SSDNSVAGFISRNKXXXXXXXXXXXXXXXXYLYYRQLQDAAGSDDKKGESPDGTXXXXXX 61
           +SD SV GFI+RNK                Y YY QLQ     DD               
Sbjct: 3   ASDGSVGGFIARNKTAIIATVAAGSAALGAYYYYTQLQRQI--DDSSSSKKKKKKHSKKK 60

Query: 62  XXXXXXXXXXXXXXXXXXXXXXDEKGEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQKD 121
                                    GEP L      S+E KE ++ ALKDKGN++FK++D
Sbjct: 61  KSTSTDEKSNSKNETAKVIYPVASNGEPDLSGKDSFSDELKEKYAMALKDKGNDYFKKQD 120

Query: 122 YDNALKYYDYALTLKKDPVFYSNISACYVSMNQLDKVVENSTKALELKPDYSKALLRRAS 181
           ++NALKYY+YALTLK+DPVFYSNISACYVS+ QL+KVVE+ST+AL+LK DYSKALLRRAS
Sbjct: 121 FENALKYYNYALTLKQDPVFYSNISACYVSLGQLEKVVESSTEALKLKHDYSKALLRRAS 180

Query: 182 ANESLENYPDAMFDLSVLSLNGDFGGSSIEPMLERNLNKQAMTVLKDKLGQQKNQLLPSD 241
           A ESL NY DAM DLSVLSLNGDF G+SIEPMLERNLNKQAM VLK+K+ + K QLLPS+
Sbjct: 181 AYESLANYVDAMVDLSVLSLNGDFNGASIEPMLERNLNKQAMQVLKEKIAENKPQLLPSN 240

Query: 242 TALASFFGIFTPETEFANYDETSEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAYAK 301
           T+LASFFG+F PE    N++E SE++++L  GL NLY R+++GY  ADE F +AV    K
Sbjct: 241 TSLASFFGVFKPEVSLNNFNENSESEKELLNGLTNLYSRTNDGYLVADESFQKAVKLLEK 300

Query: 302 LREGNSDDAALKEKDAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMA 361
             E N ++  +KEK AIALE+ GI +FLKNDPL AH D+QKAI + PRVNSYIY +LI+A
Sbjct: 301 EYEENKENNDIKEKYAIALEYNGILKFLKNDPLDAHNDIQKAIFIFPRVNSYIYNSLILA 360

Query: 362 DKGKAEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPY 421
           DKG+ EE  + FD AI LD  NAA YYHRGQ+YF+T QYEKAG DFDKAK+L+E NI PY
Sbjct: 361 DKGETEESIKNFDAAINLDATNAATYYHRGQLYFLTQQYEKAGIDFDKAKELDESNILPY 420

Query: 422 IQLACLAYRENKFDDCETLFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKRL 481
           IQLACLAY+ENKF+DCETLFSEA+RKF TAPEVPNF+A++L ++ + +KALKQYDI+K+L
Sbjct: 421 IQLACLAYKENKFNDCETLFSEARRKFPTAPEVPNFYADVLLERNEFDKALKQYDISKKL 480

Query: 482 EEAVDGIHVGISPLVGKATLLARQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQLKLQ 541
           EEAV+GIHVGI+P++GKATLLAR P VEN +E+T+L EEAC  DPRSEQ K+GLAQLKLQ
Sbjct: 481 EEAVEGIHVGIAPMIGKATLLARNPIVENLLESTELFEEACKLDPRSEQAKIGLAQLKLQ 540

Query: 542 QEDIDDAIKLFEEAASLARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKAQ 601
           QE++D+AI LFEEAA LAR +DEKLQATTFAEA+KVQK++R+DP+++ KI+ETLAAY+ Q
Sbjct: 541 QEEVDEAIALFEEAAFLARNMDEKLQATTFAEASKVQKKVRSDPVINQKIQETLAAYQQQ 600

Query: 602 GVI 604
           G++
Sbjct: 601 GLM 603

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/538 (67%), Positives = 433/538 (80%), Gaps = 20/538 (3%)

Query: 87  GEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTLKKDPVFYSNIS 146
           GEP   N A  + E+K+ ++ ALKDKGN+FF+ K YD+A+KYY++AL LK+DPVFYSN+S
Sbjct: 80  GEPDFSNKANFTAEEKDKYALALKDKGNQFFRNKKYDDAIKYYNWALELKEDPVFYSNLS 139

Query: 147 ACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVLSLNGDFG 206
           ACYVS+  L KVVE STKALELKPDYSK LLRRASANE L  + DAMFDLSVLSLNGDF 
Sbjct: 140 ACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFDLSVLSLNGDFN 199

Query: 207 GSSIEPMLERNLNKQAMTVLKDKLG--------------------QQKNQLLPSDTALAS 246
            +SIEPMLERNLNKQAM+ LK+K G                    + K + LPS T++AS
Sbjct: 200 DASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQPAKERKDKQENLPSVTSMAS 259

Query: 247 FFGIFTPETEFANYDETSEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAYAKLREGN 306
           FFGIF PE  FANYDE++EAD++L  GL NLYKRS E Y KADE F++A   + +  + N
Sbjct: 260 FFGIFKPELTFANYDESNEADKELMNGLSNLYKRSPESYDKADESFTKAARLFEEQLDKN 319

Query: 307 SDDAALKEKDAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKA 366
           ++D  LKEK AI+LEH GIF+FLKNDPLGAHED++KAI+L PRVNSYIYMALIMAD+  +
Sbjct: 320 NEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIMADRNDS 379

Query: 367 EEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLAC 426
            EYY +FDKA+KLD  N++VYYHRGQM FI   Y++AG+DFDKAK+L+ ENIFPYIQLAC
Sbjct: 380 TEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLAC 439

Query: 427 LAYRENKFDDCETLFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKRLEEAVD 486
           LAYRENKFDDCETLFSEAKRKF  APEVPNFFAEIL DK D +KALKQYD+A  LE  +D
Sbjct: 440 LAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELENKLD 499

Query: 487 GIHVGISPLVGKATLLARQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQLKLQQEDID 546
           GI+VGI+PLVGKATLL R P+VENFIEAT LLE+A   DPRSEQ K+GLAQ+KLQQEDID
Sbjct: 500 GIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDID 559

Query: 547 DAIKLFEEAASLARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKAQGVI 604
           +AI LFEE+A LART++EKLQA TFAEAAKVQ+RIR+DP+++ KI+ETLA  + QG++
Sbjct: 560 EAITLFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLAKKIQETLAKLREQGLM 617

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score =  731 bits (1888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/606 (62%), Positives = 454/606 (74%), Gaps = 12/606 (1%)

Query: 1   MSSDNSVAGFISRNKXXXXXXXXXXXXXXXXYLYYRQLQDAAGSDDKKG--ESPDGTXXX 58
           MSSDNS AGFISRNK                Y YY+QLQ    S  K G   SP G    
Sbjct: 1   MSSDNSFAGFISRNKTAIIATAAAGASAVGAYYYYQQLQQQVESQGKVGGVNSPSG---- 56

Query: 59  XXXXXXXXXXXXXXXXXXXXXXXXXDEKGEPKLDNVAEMSEEQKESWSTALKDKGNEFFK 118
                                    D  GEP L  V   +EEQKE +S A+KDKGNE FK
Sbjct: 57  ------ETRYGKKKKKRANKKKYPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFK 110

Query: 119 QKDYDNALKYYDYALTLKKDPVFYSNISACYVSMNQLDKVVENSTKALELKPDYSKALLR 178
           +K Y+ A+KYY  AL LKKDPVFYSN SAC+V +N+L+KVVE++T ALELKPDYSK LLR
Sbjct: 111 EKKYEEAIKYYSCALRLKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLR 170

Query: 179 RASANESLENYPDAMFDLSVLSLNGDFGGSSIEPMLERNLNKQAMTVLKDKLGQQKNQLL 238
           RA+ANESL N+ DAM DLS +SL G +   SIEP+LERN+NKQAM VLK KL       L
Sbjct: 171 RATANESLGNFADAMLDLSAVSLYGGYNSQSIEPVLERNMNKQAMQVLKRKLADGSKHQL 230

Query: 239 PSDTALASFFGIFTPETEFANYDETSEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDA 298
           PS+T+LASFFGIF  ET FANYDE SEAD  L  GL  L +R +  Y+ +DE+F++A D 
Sbjct: 231 PSNTSLASFFGIFPSETSFANYDEQSEADNFLLKGLRCLSERKTGSYEMSDEYFNKAADL 290

Query: 299 YAKLREGNSDDAALKEKDAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMAL 358
            +   + +S+D AL+ K AIALEH GIF+FLKN+PL A++ +QKA+DLHPR NSYIYMAL
Sbjct: 291 LSLSHQADSEDPALRMKLAIALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMAL 350

Query: 359 IMADKGKAEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENI 418
           IMADKG+ +EY ++FDKA++L P ++AVYYHRGQMYF+T Q+EK+G+DFDKAK+ N +NI
Sbjct: 351 IMADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNI 410

Query: 419 FPYIQLACLAYRENKFDDCETLFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIA 478
           FPYIQLACLAYRENKF+DCETLFSEA+RKF TAPEVPNF+AEIL+DKGDLE ALK+Y+ A
Sbjct: 411 FPYIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFA 470

Query: 479 KRLEEAVDGIHVGISPLVGKATLLARQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQL 538
           ++LE+A +GIHVG++PLVGKAT+LARQ    +F EAT L EEAC KDPRSEQ K+GLAQL
Sbjct: 471 RKLEDAQEGIHVGVAPLVGKATVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQL 530

Query: 539 KLQQEDIDDAIKLFEEAASLARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAY 598
           KLQQE +D+AI+LFEEA  LAR  +EKLQATTFAEAAK+QKRIRADP++SAKI+ETL AY
Sbjct: 531 KLQQEQVDEAIQLFEEATDLARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAY 590

Query: 599 KAQGVI 604
           + QGV+
Sbjct: 591 RVQGVV 596

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  726 bits (1874), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/538 (66%), Positives = 432/538 (80%), Gaps = 20/538 (3%)

Query: 87  GEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTLKKDPVFYSNIS 146
           GEP     A+ + E+K+ ++ ALKDKGN++F+ K YD+A+KYY++AL LK+DPVFYSN+S
Sbjct: 80  GEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLS 139

Query: 147 ACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVLSLNGDFG 206
           ACYVS+  L KVVE STKALELKPDYSK LLRRASANE L N+ DAMFDLSVLSLNGDF 
Sbjct: 140 ACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFN 199

Query: 207 GSSIEPMLERNLNKQAMTVLKDKLG--------------------QQKNQLLPSDTALAS 246
            +SIEPMLERNLNKQAM+ LK+K G                    + K + LPS T++AS
Sbjct: 200 DASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQESLPSVTSMAS 259

Query: 247 FFGIFTPETEFANYDETSEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAYAKLREGN 306
           FFGIF PE  FAN DE++EAD++L  GL NLYKRS + Y +ADE F++AV  +    + +
Sbjct: 260 FFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDRADESFTKAVKLFEDQLDKD 319

Query: 307 SDDAALKEKDAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKA 366
           ++D  +KEK AI+LEH GIF+FLKNDPLGAHED+ KAIDL PRVNSYIYMALIMAD+  +
Sbjct: 320 NEDEKVKEKLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIYMALIMADRNDS 379

Query: 367 EEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLAC 426
            EYY +FDKA+KLD  N++VYYHRGQM FI   Y++AG+DFDKAK+L+ ENIFPYIQLAC
Sbjct: 380 TEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLAC 439

Query: 427 LAYRENKFDDCETLFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKRLEEAVD 486
           LAYRENKFDDCETLFSEAKRKF  APEVPNFFAEIL DK D +KALKQYD+A  LE  ++
Sbjct: 440 LAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELENKLE 499

Query: 487 GIHVGISPLVGKATLLARQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQLKLQQEDID 546
           GI+VGI+PLVGKATLL R P+VENFIEAT LLE+A   DPRSEQ K+GLAQ+KLQQEDID
Sbjct: 500 GIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDID 559

Query: 547 DAIKLFEEAASLARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKAQGVI 604
           +AI LFEE+A LART++EKLQA TFAEAAKVQ+RIR+DP+++ KI+ETLA  + QG++
Sbjct: 560 EAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLATKIQETLAKLREQGLM 617

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  726 bits (1873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/538 (65%), Positives = 433/538 (80%), Gaps = 20/538 (3%)

Query: 87  GEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTLKKDPVFYSNIS 146
           GEP     A  + E+K+ ++ ALKDKGN++F+ K YD+A+KYY++AL LK+DPVFYSN+S
Sbjct: 80  GEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLS 139

Query: 147 ACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVLSLNGDFG 206
           ACYVS+  L KVVE STKALE+KPDYSK LLRRASANE L N+ DAMFDLSVLSLNGDF 
Sbjct: 140 ACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFN 199

Query: 207 GSSIEPMLERNLNKQAMTVLKDKLG--------------------QQKNQLLPSDTALAS 246
            +SIEPMLERNLNKQAM+ LK+K G                    + K + LPS T++AS
Sbjct: 200 DASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKERKDKQENLPSITSMAS 259

Query: 247 FFGIFTPETEFANYDETSEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAYAKLREGN 306
           FFGIF PE  FANYDE ++AD++L  GL NLYKRS E Y +ADE F++A   + +  + +
Sbjct: 260 FFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDRADESFTKAAKLFEEQLDKS 319

Query: 307 SDDAALKEKDAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKA 366
           ++D  LKEK AI+LEH GIF+FLKNDPLGAHED++KAI+L PRVNSYIYMALIMAD+  +
Sbjct: 320 NEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIMADRNDS 379

Query: 367 EEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLAC 426
            EYY +FDKA+KL+P N++VYYHRGQM FI   Y++AG+DFDKAK+L+ ENIFPYIQLAC
Sbjct: 380 TEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLAC 439

Query: 427 LAYRENKFDDCETLFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKRLEEAVD 486
           LAYRENKFDDCETLFSEAKRKF  APEVPNFFAEIL DK D +KALKQYD+A  LE  +D
Sbjct: 440 LAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELENKLD 499

Query: 487 GIHVGISPLVGKATLLARQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQLKLQQEDID 546
            I+VGI+PLVGKATLL R P+VENF+EAT LLE+A   DPRSEQ K+GLAQ+KLQQEDID
Sbjct: 500 RIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDID 559

Query: 547 DAIKLFEEAASLARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKAQGVI 604
           +AI LFEE+A LART++EKLQA TFAEAAKVQ++IR+DP+++AKI+ETLA  + QG++
Sbjct: 560 EAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPILAAKIQETLAKLREQGLM 617

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/601 (60%), Positives = 446/601 (74%), Gaps = 12/601 (1%)

Query: 1   MSSDNSVAGFISRNKXXXXXXXXXXXXXXXXYLYYRQLQDAAGSDDKKGESPDGTXXXXX 60
           MSS+NS+  FISRNK                Y+YY QLQ        K            
Sbjct: 1   MSSNNSMRDFISRNKTAIIATVAAGTAAVGAYMYYAQLQQQHEKKPAKKTK--------- 51

Query: 61  XXXXXXXXXXXXXXXXXXXXXXXDEKGEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQK 120
                                  D  GEP L +V  ++++ KE W+ ALK+KGN  FK+K
Sbjct: 52  --KSKKSVTEEEKKKEEPPIYPIDANGEPVLGDVDLLNDKTKEEWAGALKEKGNALFKKK 109

Query: 121 DYDNALKYYDYALTLKKDPVFYSNISACYVSMNQLDKVVENSTKALELKPDYSKALLRRA 180
           D++NA+KYY +AL+LK+DPV+YSNISACY S+   +KV+E +TKAL L+PDYSK L+RRA
Sbjct: 110 DFENAIKYYTFALSLKEDPVYYSNISACYSSLLNYEKVIEMATKALALRPDYSKVLVRRA 169

Query: 181 SANESLENYPDAMFDLSVLSLNGDFGGSSIEPMLERNLNKQAMTVLKDKLG-QQKNQLLP 239
           +A E L N+ DAMFDLSV SLN D   +SIEP+LERNLN+QAM VL  KLG   K   LP
Sbjct: 170 NAYEKLGNFGDAMFDLSVCSLNTDMSDASIEPILERNLNQQAMFVLNTKLGVTDKKSQLP 229

Query: 240 SDTALASFFGIFTPETEFANYDETSEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAY 299
           S+TAL SFFGIF PE  FANYD+T E D++L  GL+NLY+ ++EGY+ AD  F++A + +
Sbjct: 230 SNTALTSFFGIFKPELSFANYDDTCEGDKELLNGLKNLYRCTAEGYETADLSFTKATEYF 289

Query: 300 AKLREGNSDDAALKEKDAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALI 359
            K      DD  +KEK AIALEH+GIF+FLKN+PL AHED++KA++LHPR+NSYIYMALI
Sbjct: 290 LKQLSETPDDETVKEKTAIALEHQGIFKFLKNNPLEAHEDIKKALELHPRINSYIYMALI 349

Query: 360 MADKGKAEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIF 419
           +ADKG  + Y+  ++KA+KLD KNAA+YYHRGQMYFIT QYEKAG+DFDKAK+L+ ENIF
Sbjct: 350 LADKGDTDNYFANYEKAMKLDDKNAALYYHRGQMYFITQQYEKAGEDFDKAKELDPENIF 409

Query: 420 PYIQLACLAYRENKFDDCETLFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAK 479
           PYIQLACL+YRENKFDDCETLFSEA+RKF  + EVPNF+AEILADKGD + ALK+Y+ A 
Sbjct: 410 PYIQLACLSYRENKFDDCETLFSEARRKFPNSSEVPNFYAEILADKGDFDAALKEYERAI 469

Query: 480 RLEEAVDGIHVGISPLVGKATLLARQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQLK 539
            LE+  D +HVGI+PLVGKATLL R P+VENF+EAT LLEEA  +DPRSEQ K+ L QLK
Sbjct: 470 ELEKKQDAVHVGIAPLVGKATLLVRTPTVENFVEATSLLEEAVKEDPRSEQAKISLGQLK 529

Query: 540 LQQEDIDDAIKLFEEAASLARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYK 599
           LQQEDID+AI+LFE AA+LART +EKLQATTFAEAAK+QKRIRADP +SAKI+ET+AA +
Sbjct: 530 LQQEDIDEAIELFESAATLARTFEEKLQATTFAEAAKIQKRIRADPKMSAKIQETIAALR 589

Query: 600 A 600
           A
Sbjct: 590 A 590

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score =  708 bits (1828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/521 (66%), Positives = 422/521 (80%)

Query: 84  DEKGEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTLKKDPVFYS 143
           D+ GEP L  +A  +EEQKE ++ ALKDKGNE FK + Y+ A+K+YD AL LK+DPVFYS
Sbjct: 73  DQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPVFYS 132

Query: 144 NISACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVLSLNG 203
           N SACYV +N+L+KVVE++T AL+LKPDYSK LLRRA+ANESL NY DAM DLS +SL G
Sbjct: 133 NRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVSLYG 192

Query: 204 DFGGSSIEPMLERNLNKQAMTVLKDKLGQQKNQLLPSDTALASFFGIFTPETEFANYDET 263
            +   +IEP+LERN+NKQAM VLK KL   +   LPS+T+LASFF IF  ET   NYDET
Sbjct: 193 GYSSQTIEPVLERNMNKQAMQVLKQKLSGGEKHELPSNTSLASFFRIFPSETSLENYDET 252

Query: 264 SEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAYAKLREGNSDDAALKEKDAIALEHR 323
           SEAD+ L  GL  L+ R +  Y+ ADE F+ AV+ +    E N D+AALK+K AIALEH 
Sbjct: 253 SEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAALKQKLAIALEHV 312

Query: 324 GIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKAEEYYEFFDKAIKLDPKN 383
           GI +FLKN+PL AH  +QKAIDL PR NSYIYM LIMADKG+A+EY + F+KA++LDPK+
Sbjct: 313 GILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQNFEKALELDPKS 372

Query: 384 AAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRENKFDDCETLFSE 443
           +A YYHR QM F+  Q+++AG+DFDKAK+ +   ++PYIQLACLAYRE KFDDCETLFSE
Sbjct: 373 SAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCETLFSE 432

Query: 444 AKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKRLEEAVDGIHVGISPLVGKATLLA 503
           A+R+F TAPEVPNF+AEIL+DKGD E ALK+YD A++LE+A +GIHVG++PLVGKA LLA
Sbjct: 433 ARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGVAPLVGKAALLA 492

Query: 504 RQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQLKLQQEDIDDAIKLFEEAASLARTVD 563
           RQPS  NF EATKL E AC KDPRSEQ K+GLAQLKLQQE++D+AIKLFE AA L+R  +
Sbjct: 493 RQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAAADLSRAFE 552

Query: 564 EKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKAQGVI 604
           EKLQATTFAEAAK+QKRIRADP++SAKI+ETL AY+AQG++
Sbjct: 553 EKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGMV 593

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score =  698 bits (1802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/519 (65%), Positives = 424/519 (81%), Gaps = 1/519 (0%)

Query: 85  EKGEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTLKKDPVFYSN 144
           + GEP LDN  + +EE+KE +S ALKDKGN  FK   ++ A+KYY++A+ LK++P+FYSN
Sbjct: 90  DNGEPNLDNKDQFTEEEKEKYSIALKDKGNSLFKADKFEEAIKYYNWAIELKENPIFYSN 149

Query: 145 ISACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVLSLNGD 204
           +SACYVS+N+L+++++   KALELKPDYSK LLRRA+ANE LENY DAMFDLSVLSLNGD
Sbjct: 150 LSACYVSLNKLEEIIKYCNKALELKPDYSKVLLRRANANEKLENYADAMFDLSVLSLNGD 209

Query: 205 FGGSSIEPMLERNLNKQAMTVLKDKLGQQKNQLLPSDTALASFFGIFTPETEFANYDETS 264
           + G+SIEP+LERNLNKQAM+VLKDKL   K+  LPSDT+L++FFGIF PE  F NYDET+
Sbjct: 210 YNGASIEPILERNLNKQAMSVLKDKLKNSKDDQLPSDTSLSAFFGIFKPELSFENYDETN 269

Query: 265 EADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAYAKLREGNSDDAALKEKDAIALEHRG 324
           +AD++L  GL +L+KR SE Y  AD+ F  A++ Y K  E   DD  LK K +IA E+ G
Sbjct: 270 DADKELLNGLTHLFKRQSESYLIADKSFMNALELYIKQLEETPDDTDLKVKASIAYEYAG 329

Query: 325 IFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKAEEYYEFFDKAIKLDPKNA 384
           IF FLKND  GA E++ K+I L+PR+NSYIY ALI+ADKG++++Y ++FDKA+KLD K+ 
Sbjct: 330 IFNFLKNDLSGATENIDKSIKLNPRINSYIYRALIIADKGESQDYLDYFDKALKLDDKSC 389

Query: 385 AVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRENKFDDCETLFSEA 444
           AVYYHR Q+ F+T  + KA  DF+KAK+ +  NIFPYIQLACL YRENKFDDCETLFSEA
Sbjct: 390 AVYYHRAQLNFVTQDFAKAAVDFEKAKECDPTNIFPYIQLACLTYRENKFDDCETLFSEA 449

Query: 445 KRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKRLEEAV-DGIHVGISPLVGKATLLA 503
           KRKF T PEVPNF+AE+L DKGD + A+K Y+ A+RLEEA  DGIHVG++PL+GKATLLA
Sbjct: 450 KRKFPTLPEVPNFYAEVLTDKGDFDNAMKNYETARRLEEASKDGIHVGVAPLIGKATLLA 509

Query: 504 RQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQLKLQQEDIDDAIKLFEEAASLARTVD 563
           R+P++EN   A KLLEEA   DPRSEQ K+GLAQLKLQ+E+ID++I+LFEE+A LART++
Sbjct: 510 REPTLENLAAADKLLEEANRIDPRSEQAKIGLAQLKLQKEEIDESIRLFEESADLARTME 569

Query: 564 EKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKAQG 602
           EKLQATTFAEAAKVQK IRADP++S KIEETLAAY+AQ 
Sbjct: 570 EKLQATTFAEAAKVQKMIRADPIISKKIEETLAAYRAQN 608

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/526 (64%), Positives = 427/526 (81%), Gaps = 11/526 (2%)

Query: 89  PKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTLKKDPVFYSNISAC 148
           P +  +   SE+QK+ ++TALKDKGN  FK+K +++A+++Y++A+ L +DPVF+SNISAC
Sbjct: 76  PDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISAC 135

Query: 149 YVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVLSLNGDFGGS 208
           YVS+  LDKVVE+ST+ALELKPDYSKALLRRASA E++  Y DAMFD+SVLSLNGDF GS
Sbjct: 136 YVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFNGS 195

Query: 209 SIEPMLERNLNKQAMTVLKDKLG----------QQKNQLLPSDTALASFFGIFTPETEFA 258
           SIEPMLERNLNKQA+ VLK+ +G           ++ Q LPS+T+L+SFFGIF PETE  
Sbjct: 196 SIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSNTSLSSFFGIFKPETEIP 255

Query: 259 NYDETSEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAYAKLREGNSDDAALKEKDAI 318
            YDE++EAD  L  GL+ LY  +S+GYQ ADE F++A   Y + +  N++DAA KEK A 
Sbjct: 256 AYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKLY-REQLANNNDAAFKEKAAT 314

Query: 319 ALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKAEEYYEFFDKAIK 378
           ALE+ GIF FLKND   + +++++A+ LHPRVN+YIY+AL MAD+G++E+Y+ +F+KAI 
Sbjct: 315 ALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSEDYFSYFEKAIA 374

Query: 379 LDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRENKFDDCE 438
           LDP NAAVYYHRGQMYFIT  YEKAG+DF K+K+ + +NIFPYIQLACLAYRENK  +CE
Sbjct: 375 LDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAECE 434

Query: 439 TLFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKRLEEAVDGIHVGISPLVGK 498
            LF EA++ F TAPEVPNF+AEILADKGD+++A+KQY+IA RLE     IHVGI+PLVGK
Sbjct: 435 KLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIAPLVGK 494

Query: 499 ATLLARQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQLKLQQEDIDDAIKLFEEAASL 558
           AT+LARQP+ ENF   ++LLE+AC  DPRSEQ KVGLAQL+LQQE +D+AI+LFEEAA +
Sbjct: 495 ATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELFEEAAKM 554

Query: 559 ARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKAQGVI 604
           ARTVDEKLQA TFAEA KVQKRIRADP+VS K+EETLAAY+AQ + 
Sbjct: 555 ARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQNMF 600

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/623 (55%), Positives = 441/623 (70%), Gaps = 20/623 (3%)

Query: 2   SSDNSVAGFISRNKXXXXXXXXXXXXXXXXYLYYRQLQDAAGS---------------DD 46
           S+D+ V GF++RN+                + YY  LQ    S               +D
Sbjct: 3   SNDHPVGGFLTRNRTAIVATVAAGSAAIGAFYYYHHLQQTHTSLEGEEDGNSTGRNPVND 62

Query: 47  KKGESPDGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEKGEPKLDNVAEMSEEQKESWS 106
           +   S +                              ++  +P +  +  +  E+++  S
Sbjct: 63  EAHLSKNQKKKQRKKHKKKATPDQTTATADVLTSYPTNDSNDPDMIQITSLPLEEQKKIS 122

Query: 107 TALKDKGNEFFKQKDYDNALKYYDYALTLKKDPVFYSNISACYVSMNQLDKVVENSTKAL 166
             LKDKGN++FK KDY NA+KYY+ AL L KDP+FYSNISACYVS+ QLDKV+E+STKAL
Sbjct: 123 MQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPIFYSNISACYVSLGQLDKVIESSTKAL 182

Query: 167 ELKPDYSKALLRRASANESLENYPDAMFDLSVLSLNGDFGGSSIEPMLERNLNKQAMTVL 226
           EL P+YSKALLRRASANESLENY DA+FDLSVLSLNGD+ G+SIEP+LERNLNKQA+ VL
Sbjct: 183 ELNPNYSKALLRRASANESLENYSDALFDLSVLSLNGDYSGASIEPILERNLNKQAIKVL 242

Query: 227 KDKLGQ-----QKNQLLPSDTALASFFGIFTPETEFANYDETSEADQKLKAGLENLYKRS 281
            +++ +     ++ QLLPS T+L SFFGIF PE  F NY+E  +AD +L  GL NL+KR+
Sbjct: 243 NERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPELTFQNYNENDQADVELLTGLTNLFKRT 302

Query: 282 SEGYQKADEFFSQAVDAYAKLREGNSDDAALKEKDAIALEHRGIFRFLKNDPLGAHEDVQ 341
            +GY  AD+ F +A   + +    N  D  L EK AIALE+ GIFRFLKND LGA  D++
Sbjct: 303 DQGYLDADKNFVKASSLFMEELAKNPKDKHLLEKTAIALEYNGIFRFLKNDLLGAQTDIE 362

Query: 342 KAIDLHPRVNSYIYMALIMADKGKAEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYE 401
           KAI   PRVNSY+Y+ALI ADK  ++EY ++FDKA++L+P + +VYYHRGQ+YFIT  Y 
Sbjct: 363 KAIGFFPRVNSYLYLALISADKSTSQEYSKYFDKALELNPDSLSVYYHRGQLYFITQDYP 422

Query: 402 KAGQDFDKAKQLNEENIFPYIQLACLAYRENKFDDCETLFSEAKRKFATAPEVPNFFAEI 461
           KA  +F+KAK+L+E NIFPYIQLACLAYREN FD C+ LF E ++KF T PEVP F+AEI
Sbjct: 423 KAKVEFEKAKELDETNIFPYIQLACLAYRENDFDRCQKLFDETRQKFPTYPEVPTFYAEI 482

Query: 462 LADKGDLEKALKQYDIAKRLEEAVDGIHVGISPLVGKATLLARQPSVENFIEATKLLEEA 521
           LADKGD   A+KQYDIA RLE+A   IHVGI+PLVGKAT+LARQP++ N  EAT+L+E+A
Sbjct: 483 LADKGDFALAIKQYDIATRLEKAQKNIHVGIAPLVGKATVLARQPNLLNLKEATQLMEKA 542

Query: 522 CAKDPRSEQGKVGLAQLKLQQEDIDDAIKLFEEAASLARTVDEKLQATTFAEAAKVQKRI 581
           C  DPRSEQ  VGLAQLKLQ E++D AI+LFE+AA L+RT+DEK+QA TFAEAAK+QKRI
Sbjct: 543 CEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKAADLSRTMDEKIQAMTFAEAAKIQKRI 602

Query: 582 RADPLVSAKIEETLAAYKAQGVI 604
           RADP++SAK++E LA+Y++QGVI
Sbjct: 603 RADPVISAKVDEALASYRSQGVI 625

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score =  681 bits (1756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/606 (55%), Positives = 433/606 (71%), Gaps = 5/606 (0%)

Query: 1   MSSDNSVAGFISRNKXXXXXXXXXXXXXXXXYLYYRQLQDAAGSDDKKGESPDGTXXXXX 60
           MSSDNS+ GF+SRN+                Y YY QLQ     + +  E  D +     
Sbjct: 1   MSSDNSIKGFVSRNRTAIIATIAAGTTAVGAYYYYTQLQAQQQENVRPKEDTDKSTATKK 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXX----XDEKGEPKLDNVAEMSEEQKESWSTALKDKGNEF 116
                                      D  GEP L ++  ++EE K  W+ ALKDKGNE 
Sbjct: 61  EKKKSKGKESKKPQEDTPTTKKPIYLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNEL 120

Query: 117 FKQKDYDNALKYYDYALTLKKDPVFYSNISACYVSMNQLDKVVENSTKALELKPDYSKAL 176
           FK   +++A+KYY YAL LK DP++YSNISACY S+ Q +KV+E +TKAL+L+P +SK L
Sbjct: 121 FKTSKFEDAIKYYHYALKLKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVL 180

Query: 177 LRRASANESLENYPDAMFDLSVLSLNGDFGGSSIEPMLERNLNKQAMTVLKDKLGQQKNQ 236
           +RRA A E++ N+ DAMFD+S  SLNGD   +SIEP+LER LNKQA  VLK+K+   K Q
Sbjct: 181 MRRALAYEAMGNFGDAMFDISACSLNGDMNDASIEPILERILNKQAEFVLKEKISANKEQ 240

Query: 237 LLPSDTALASFFGIFTPETEFANYDETSEADQKLKAGLENLYKRSSEGYQKADEFFSQAV 296
            LPS T LASFF +F PET FANY+E++EAD++L  GL NLYK S EG+Q AD+ F +A 
Sbjct: 241 NLPSSTPLASFFRVFKPETSFANYEESNEADRELMNGLTNLYKNSEEGFQIADKSFLKAA 300

Query: 297 DAYAKLREGNSDDAALKEKDAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYM 356
           + +      N D+ A+KEK AIALE+ GI  ++KN+ L AH+ ++ AI+LHPRVNSYIY 
Sbjct: 301 ELFKDQLSQNKDNEAIKEKTAIALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQ 360

Query: 357 ALIMADKGKAEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEE 416
           +LI +D     EY + FDKA++L+P N A+YYHRGQ YFI  QYEKAG+DFDK K+L+E 
Sbjct: 361 SLIGSDSTTTSEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDEN 420

Query: 417 NIFPYIQLACLAYRENKFDDCETLFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYD 476
           NIF YIQLACLAYRE+KFDDCETLFSEA+RKF TAPEVPNFFAE+LAD+G+ EKA+K++D
Sbjct: 421 NIFAYIQLACLAYRESKFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFD 480

Query: 477 IAKRLE-EAVDGIHVGISPLVGKATLLARQPSVENFIEATKLLEEACAKDPRSEQGKVGL 535
            A  LE +  + IHVGI+PL+GKATLL  +P+VENF+E  +LL+EAC KDPRSEQ ++GL
Sbjct: 481 KAIELEAKTPEEIHVGIAPLIGKATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGL 540

Query: 536 AQLKLQQEDIDDAIKLFEEAASLARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETL 595
           AQLKLQQEDID+AI+LFEEAA LA++ +EKLQATTFAEAAK+QKRIRADP + AKI +T+
Sbjct: 541 AQLKLQQEDIDEAIQLFEEAAELAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTI 600

Query: 596 AAYKAQ 601
              ++Q
Sbjct: 601 EQMRSQ 606

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score =  677 bits (1748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/528 (64%), Positives = 409/528 (77%), Gaps = 10/528 (1%)

Query: 87  GEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTLKKDPVFYSNIS 146
           GEP L  +   + EQ+E+++ ALKDKGNE FK+K  + A+KYY +AL  KKDPVFY+NIS
Sbjct: 87  GEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEFKKDPVFYANIS 146

Query: 147 ACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVLSLNGDFG 206
           ACYVS+N  +KV+EN  KALELKPDYSK LLRRA+  E++EN+ DAMFDLSVLSLN DF 
Sbjct: 147 ACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSVLSLNNDFS 206

Query: 207 GSSIEPMLERNLNKQAMTVLKDKLGQQKN---QLLPSDTALASFFGIFTPETEFANYDET 263
           G+SIEPMLERNLNKQAM +LK++L   ++   Q LPSDT++ASFFGIF PETEF  YDET
Sbjct: 207 GASIEPMLERNLNKQAMKMLKERLENTQDKFEQPLPSDTSMASFFGIFKPETEFKGYDET 266

Query: 264 SEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAYAKLREGNSDDAAL----KEKDAIA 319
            EAD+ L+ GL  L+  +  G+ KAD  F++AV+ Y +L    SD+  L     EK AIA
Sbjct: 267 CEADRTLQTGLLELFAATHVGFVKADTCFNEAVNQYRELFSKASDEEKLAQNLNEKFAIA 326

Query: 320 LEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKAEEYYEFFDKAIKL 379
           LE+ GIF+FLKND +GA   V +AI L PRVNSYIY+AL  AD G++ EY   FDKA++L
Sbjct: 327 LEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESSEYVTNFDKALEL 386

Query: 380 DPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRENKFDDCET 439
           +P ++A YYHRGQ+YFIT  Y+KA  DF KAK+L+ +NIF YIQLACL YRE   D+C+ 
Sbjct: 387 NPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDMDECKK 446

Query: 440 LFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKRLEEAVD---GIHVGISPLV 496
           LF EA+ KF  APEVP F+AEILADKGD   A KQYD+AKRLEEA+    GI VG++PLV
Sbjct: 447 LFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIRVGVAPLV 506

Query: 497 GKATLLARQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQLKLQQEDIDDAIKLFEEAA 556
           GKAT+LARQPS ENF EAT L EEAC +DPRSEQ KVGLAQL LQQED+D AIK+FEEAA
Sbjct: 507 GKATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIKMFEEAA 566

Query: 557 SLARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKAQGVI 604
            LART DEKLQA TFAEAAKVQK+IRADP++ AK+EE LA Y+AQG+I
Sbjct: 567 DLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAEYRAQGMI 614

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/522 (62%), Positives = 419/522 (80%), Gaps = 2/522 (0%)

Query: 84  DEKGEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTLKKDPVFYS 143
           D  G+P L    E + EQ + ++ ALKDKGNEFFK KD++ A++YY  A++LK+DPVFYS
Sbjct: 82  DANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDPVFYS 141

Query: 144 NISACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVLSLNG 203
           N SA YVS+N  +KVVE++T AL+LKPDYSK  LRRASA E+L  + DAMFDLS +SL G
Sbjct: 142 NRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAVSLLG 201

Query: 204 DFGGSSIEPMLERNLNKQAMTVLKDKL--GQQKNQLLPSDTALASFFGIFTPETEFANYD 261
           ++ G S+E +LERN+NKQA  VL +KL   Q K   LPS+T+LASFFGIF PET F +YD
Sbjct: 202 EYSGQSVEQLLERNMNKQATKVLGEKLKENQGKESPLPSNTSLASFFGIFNPETSFDDYD 261

Query: 262 ETSEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAYAKLREGNSDDAALKEKDAIALE 321
             +EAD +LK GLENLYK  +  Y+ ADE F++A + Y K  E + D+ +LK+K AIA E
Sbjct: 262 GENEADVELKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNESLKKKAAIAFE 321

Query: 322 HRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKAEEYYEFFDKAIKLDP 381
           H GIF+F KNDP+ AH ++++++ L+PR ++YIYMALIMADKG+A +Y E+FDKA++LDP
Sbjct: 322 HVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQYKEYFDKALELDP 381

Query: 382 KNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRENKFDDCETLF 441
             +AVYYHRGQM+F+   +++AG DFDKAK+LN ENIF YIQ ACLA+R+++FDDCETLF
Sbjct: 382 NCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDCETLF 441

Query: 442 SEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKRLEEAVDGIHVGISPLVGKATL 501
           SEA+RKF TAPEVPNF+AEILA K  L+ A+KQYDIA +LE+A+ GIHVGI+P++GKAT 
Sbjct: 442 SEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIAPMIGKATA 501

Query: 502 LARQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQLKLQQEDIDDAIKLFEEAASLART 561
           L R P+VENF+EA++L EEAC  DPRSEQ K+GLAQLKLQQE+IDDAI+LFE+AA L+R+
Sbjct: 502 LIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAADLSRS 561

Query: 562 VDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKAQGV 603
            DEKLQATTFAEA KVQK+IRADP +  KI+E +AAY+AQG+
Sbjct: 562 FDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQGL 603

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/522 (61%), Positives = 403/522 (77%), Gaps = 2/522 (0%)

Query: 85  EKGEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTLKKDPVFYSN 144
           E GEP    V  ++ +QK+ W+  LKDKGNE+FK+KDY+NALK+YD+AL LKKDPVFYSN
Sbjct: 87  ENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPVFYSN 146

Query: 145 ISACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVLSLNGD 204
           +SACYVS+N+LDKV+E STKALELKPDYSKALLRRA+ANE LENY DAMFDLSVLSLN D
Sbjct: 147 MSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLSLNND 206

Query: 205 FGGSSIEPMLERNLNKQAMTVL--KDKLGQQKNQLLPSDTALASFFGIFTPETEFANYDE 262
           F G++IEPMLERNLNKQA+ VL  K K   +    LPS+T++ASFF IFTPE  F +YDE
Sbjct: 207 FNGATIEPMLERNLNKQAIKVLDQKSKNPSKNESELPSNTSMASFFSIFTPEISFDSYDE 266

Query: 263 TSEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAYAKLREGNSDDAALKEKDAIALEH 322
            S+AD++L  GL+ LY   +  Y+ A+  F+++++ Y  L E   D   + +K AIALE+
Sbjct: 267 ESDADKELLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETISKKFAIALEY 326

Query: 323 RGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKAEEYYEFFDKAIKLDPK 382
            GIF FL+ND + A +   ++I   PRVNSYIY+ALI ADK + +E  ++FD+A+KLDP 
Sbjct: 327 VGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYFDEALKLDPN 386

Query: 383 NAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRENKFDDCETLFS 442
            + +YYHRGQ+ F+T  Y  A  DF KAK+L+E NIFPYIQLACL+YRE  F+DC+  F 
Sbjct: 387 CSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDCQNQFE 446

Query: 443 EAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKRLEEAVDGIHVGISPLVGKATLL 502
            A++KF  APE+P F  EILADKGDL+ A KQY+   RLE     IHVGI+PL+GKAT L
Sbjct: 447 LARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVGIAPLIGKATAL 506

Query: 503 ARQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQLKLQQEDIDDAIKLFEEAASLARTV 562
           ARQP+ ENF EA+KLL++A  KDPRSEQ  VGLAQLKLQ+ED+D AI+LFE+A+  +R++
Sbjct: 507 ARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIELFEKASDYSRSM 566

Query: 563 DEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKAQGVI 604
           DEKLQATTFAEAAKVQKRIRADP++ AK+EETLA Y AQG +
Sbjct: 567 DEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGFM 608

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/533 (59%), Positives = 395/533 (74%), Gaps = 15/533 (2%)

Query: 87  GEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTL-KKDPVFYSNI 145
           GEP +D +  +S  Q+++++  LKDKGN FF  K + +A+KYY YA+ L   DPVFYSNI
Sbjct: 112 GEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNI 171

Query: 146 SACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVLSLNGDF 205
           SACY+S   LDKVVE +TKALE+KPD+SKALLRRASANESL N+ DAMFDLSVLSLNGDF
Sbjct: 172 SACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDF 231

Query: 206 GGSSIEPMLERNLNKQAMTVLKDKL---GQQKN-QLLPSDTALASFFGIFTPETEFANYD 261
            G+SIEPMLERNLNKQAM VL + L   G  K+ Q+LPS+T+LASFFGIF P+ E +  +
Sbjct: 232 DGTSIEPMLERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFDPDLETSRVN 291

Query: 262 ETS---EADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAYAKLREGNSDDAALKEKDAI 318
             S    A   L   L++LY  +SEGY  AD+  ++A D Y  L   N +D  ++E  A+
Sbjct: 292 TGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKEDRVIRENAAL 351

Query: 319 ALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKAEEYYEFFDKAIK 378
           A  + GIF+FLKND L A   +Q++I+LHP  NSY++MAL +ADK  ++E+++FF  AI 
Sbjct: 352 AFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFKFFQNAID 411

Query: 379 LDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRENKFDDCE 438
           LDP+    YYHRGQMYFI   Y  A  DF KA+ LN  N++PYIQLACL Y+++KF + E
Sbjct: 412 LDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKFSEAE 471

Query: 439 TLFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKRLEEAVDGIHVGISPLVGK 498
           +LF+EAK KF   PEVP F+AEIL DKGD   A+KQYDIAKRLEE    IHVGI PL+GK
Sbjct: 472 SLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVGIGPLIGK 531

Query: 499 ATLLARQPSV-------ENFIEATKLLEEACAKDPRSEQGKVGLAQLKLQQEDIDDAIKL 551
           AT+LARQ S        E F  A +LL +AC  DPRSEQ K+GLAQL+LQ E ID AIKL
Sbjct: 532 ATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKIDVAIKL 591

Query: 552 FEEAASLARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKAQGVI 604
           F+E+A+LART+DEKLQATTFAEAAK+QKR+RADP++SAK+E+TLA Y+AQG+I
Sbjct: 592 FQESATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQGMI 644

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/533 (58%), Positives = 392/533 (73%), Gaps = 15/533 (2%)

Query: 87  GEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTL-KKDPVFYSNI 145
           GEP +  +  +   Q++ ++  LKDKGN FF  K++D+A+KYY +A+ L   DPVFYSN+
Sbjct: 106 GEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNM 165

Query: 146 SACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVLSLNGDF 205
           SACY+S   L+KVVE +TKALE+KPD+SKALLRRASANESL N+ DAMFDLSVLSLNGDF
Sbjct: 166 SACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDF 225

Query: 206 GGSSIEPMLERNLNKQAMTVLKDKL----GQQKNQLLPSDTALASFFGIFTPETEFANYD 261
            G+SIEPMLERNLNKQAM VL   L    G + +++LPS+T+LASFFGIF P+ E +   
Sbjct: 226 DGASIEPMLERNLNKQAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFDPDLEISRVS 285

Query: 262 ETSEADQK---LKAGLENLYKRSSEGYQKADEFFSQAVDAYAKLREGNSDDAALKEKDAI 318
             S  D     L   L+ LY  +SEGY  A+  F++A DAY  L   +  D A++   A+
Sbjct: 286 SISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAIRGNAAL 345

Query: 319 ALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKAEEYYEFFDKAIK 378
           A  ++GIF+FLKND L A   +Q++I+LHP  NSYI+MAL +ADK  ++E++ FF KAI 
Sbjct: 346 AFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFSFFQKAID 405

Query: 379 LDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRENKFDDCE 438
           LDP+ +  YYHRGQMYFI   Y  A  DF KA+ LN  NI+PYIQLACL Y++ KF + E
Sbjct: 406 LDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQGKFSESE 465

Query: 439 TLFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKRLEEAVDGIHVGISPLVGK 498
            LF+E K KF T PEVP FFAEIL DKGD   A+KQYDIAKRL+E    IHVGI PL+GK
Sbjct: 466 KLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGIGPLIGK 525

Query: 499 ATLLARQPSV-------ENFIEATKLLEEACAKDPRSEQGKVGLAQLKLQQEDIDDAIKL 551
           AT+LARQ +        E F  A +LL EAC  DPRSEQ K+GLAQLKLQ E IDDAI+L
Sbjct: 526 ATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKIDDAIEL 585

Query: 552 FEEAASLARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKAQGVI 604
           F+++A+LART+DEKLQATTFAEAAK+QKR+RADP++SAK+E+TLA+Y+A G+I
Sbjct: 586 FQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLASYRANGMI 638

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/532 (58%), Positives = 390/532 (73%), Gaps = 15/532 (2%)

Query: 87  GEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTL-KKDPVFYSNI 145
           GEP +  +  ++  QK++++  LK+KGN FF  K++  A+KYY  A+ L   DPVFYSNI
Sbjct: 105 GEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNI 164

Query: 146 SACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVLSLNGDF 205
           SACY+S   L+KV+E +TKALE+KPD+SKALLRRASANESL N+ DAMFDLSVLSLNGDF
Sbjct: 165 SACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDF 224

Query: 206 GGSSIEPMLERNLNKQAMTVLKDKLGQ---QKNQLLPSDTALASFFGIFTPETEFANYDE 262
            G+SIEPMLERNLNKQAM VL + L +   + +QLLPS+T+L SFFGIF P+ E +  + 
Sbjct: 225 DGASIEPMLERNLNKQAMKVLNENLSKGDGRGSQLLPSNTSLTSFFGIFDPDLEISRVNN 284

Query: 263 TSEADQK---LKAGLENLYKRSSEGYQKADEFFSQAVDAYAKLREGNSDDAALKEKDAIA 319
           +S  D     L   L+ LY  ++EGY  AD+ F+ A DAY  L   +  D  LKE  A+A
Sbjct: 285 SSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYHSLL-ASQVDGPLKENAALA 343

Query: 320 LEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKAEEYYEFFDKAIKL 379
             + GIF FLKN+ LGA   +Q++I+LHP  NSYI++AL +ADK  ++E++++F KAI L
Sbjct: 344 FCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQKAIDL 403

Query: 380 DPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRENKFDDCET 439
           D +    YYHRGQMYFI   Y  A  DF KA+ L  ENI+PYIQLACL Y++ KF + E 
Sbjct: 404 DSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESEA 463

Query: 440 LFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKRLEEAVDGIHVGISPLVGKA 499
           LF+E K KF T PEVP FFAEIL DKGD   A+KQYDIAKRLEE  + IHVGI PL+GKA
Sbjct: 464 LFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPLIGKA 523

Query: 500 TLLARQPSV-------ENFIEATKLLEEACAKDPRSEQGKVGLAQLKLQQEDIDDAIKLF 552
           T+LARQ S        E F  A  LL +AC  DPRSEQ K+GLAQLKLQ E IDDAI+LF
Sbjct: 524 TILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIELF 583

Query: 553 EEAASLARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKAQGVI 604
           +++A LART+DEKLQATTFAEAAK+QKR+RADP++SAK+E TLA+Y+A+G+I
Sbjct: 584 QDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKGMI 635

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score =  608 bits (1568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/532 (56%), Positives = 395/532 (74%), Gaps = 14/532 (2%)

Query: 87  GEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTL-KKDPVFYSNI 145
           GEP +  +  +S  Q+++++  LK++GN FF  K+++ A+KYY YA+ L   +PVFYSNI
Sbjct: 108 GEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNI 167

Query: 146 SACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVLSLNGDF 205
           SACY+S   L+KV+E +TKALE+KPD+SKALLRRASANESL N+ DAMFDLSVLSLNGDF
Sbjct: 168 SACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDF 227

Query: 206 GGSSIEPMLERNLNKQAMTVLKDKLGQ---QKNQLLPSDTALASFFGIFTPETEFANYDE 262
            G+SIEPMLERNLNKQAM VL + L +   + +Q+LPS+T+LASFFGIF    E ++ + 
Sbjct: 228 DGASIEPMLERNLNKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLEVSSVNT 287

Query: 263 TSEADQK---LKAGLENLYKRSSEGYQKADEFFSQAVDAYAKLREGNSDDAALKEKDAIA 319
           +S  D     L   L+ LY  + EGY  A++  +++ D Y  L   N+ D  L+E  A+A
Sbjct: 288 SSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLRENAALA 347

Query: 320 LEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKAEEYYEFFDKAIKL 379
           L + GIF FLKN+ L A   +Q++I+LHP  NSYI++AL +ADK  ++E+++FF KA+ L
Sbjct: 348 LCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFFQKAVDL 407

Query: 380 DPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRENKFDDCET 439
           +P+    YYHRGQMYFI   Y+ A +DF KA+ LN EN++PYIQLACL Y++ KF + E 
Sbjct: 408 NPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEA 467

Query: 440 LFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKRLEEAVDGIHVGISPLVGKA 499
            F+E K KF T PEVP FFAEIL D+GD + A+KQYDIAKRLEE  + IHVGI PL+GKA
Sbjct: 468 FFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLIGKA 527

Query: 500 TLLARQPSV-------ENFIEATKLLEEACAKDPRSEQGKVGLAQLKLQQEDIDDAIKLF 552
           T+LARQ S        E F  A KLL +AC  DPRSEQ K+GLAQLKLQ E ID+AI+LF
Sbjct: 528 TILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIELF 587

Query: 553 EEAASLARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKAQGVI 604
           E++A LART+DEKLQATTFAEAAK+QKR+RADP++SAK+E TLA Y+A+G++
Sbjct: 588 EDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML 639

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score =  600 bits (1548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/603 (51%), Positives = 405/603 (67%), Gaps = 21/603 (3%)

Query: 1   MSSDNSVAGFISRNKXXXXXXXXXXXXXXXXYLYYRQLQDAAGSDDKKGESPDGTXXXXX 60
           MSSD++  GF  +NK                Y YY+Q+Q+   S D   +   GT     
Sbjct: 1   MSSDSNTVGFWVKNKKAVVASVATVSAVVAAYFYYKQVQELKKSLDDGNDV--GTASSKV 58

Query: 61  XXXXXXXXXXXXXXXXXXXXXXXDEKGEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQK 120
                                  +++ + +L  +AE +E  K  +++ LK +GN +FK K
Sbjct: 59  EYKYLMI----------------NDEPDIELMKLAETAE--KNEYASELKKRGNAYFKVK 100

Query: 121 DYDNALKYYDYALTLKKDPVFYSNISACYVSMNQLDKVVENSTKALELKPDYSKALLRRA 180
           DY+NA+ YY +AL LK DPVFYSN++ACY+S+    + +E  +KALEL PDYSK LL+RA
Sbjct: 101 DYENAINYYKFALQLKNDPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRA 160

Query: 181 SANESLENYPDAMFDLSVLSLNGDFGGSSIEPMLERNLNKQAMTVLKDKL-GQQKNQLLP 239
           +  E++  + DA+ DL+ +SLNGD+  ++I+P++ER LNKQAM  LKD L   +KN++LP
Sbjct: 161 AVYENIGKFADALLDLTAVSLNGDYNDATIQPIVERVLNKQAMMALKDHLEASEKNKVLP 220

Query: 240 SDTALASFFGIFTPETEFANYDETSEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAY 299
           S T++A+FFG+F  ET+   +D T E+D+ L   L +LY ++ EGY + D  F++A + Y
Sbjct: 221 SYTSMAAFFGVFDAETDIPGHDATEESDKILSDALTHLYSQTKEGYDRCDSEFTKATELY 280

Query: 300 AKLREGNSDDAALKEKDAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALI 359
               E +  ++   EK AIA EH  I  FLKNDPL A E V +AI LHPR  SYIY+ L+
Sbjct: 281 KAKLENDRTNSVTNEKAAIAFEHTAILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLL 340

Query: 360 MADKGKAEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIF 419
           MADKG  EEYY  F KAI LDP  AA+YYHRGQM FI  +YEKAG+DFDKAK+ +  NIF
Sbjct: 341 MADKGLDEEYYSNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIF 400

Query: 420 PYIQLACLAYRENKFDDCETLFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAK 479
           PYIQLAC++YRE  FDDCETLFSEA+RKF  APEVPNFFAEIL+DKG++EKA  +YD A 
Sbjct: 401 PYIQLACMSYREGHFDDCETLFSEARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAI 460

Query: 480 RLEEAVDGIHVGISPLVGKATLLARQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQLK 539
            LE   + IHVGI+PLVGKAT L + P+VENFIEA  L E+A  +DPRSE+ K+GLAQ K
Sbjct: 461 ELESKSENIHVGIAPLVGKATTLLKYPTVENFIEADDLFEQANNEDPRSEKAKMGLAQCK 520

Query: 540 LQQEDIDDAIKLFEEAASLARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYK 599
           LQQED+DDAI+LFEEAA L RT+DEKLQATTFAEA KVQ R+RAD  + AK  + L   +
Sbjct: 521 LQQEDLDDAIRLFEEAAILCRTLDEKLQATTFAEATKVQMRVRADERLQAKTMKALDEIR 580

Query: 600 AQG 602
             G
Sbjct: 581 RNG 583

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/532 (56%), Positives = 396/532 (74%), Gaps = 11/532 (2%)

Query: 84  DEKGEPKLDNVAEM---SEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTLKKDPV 140
           D + +P  + + ++   +E  K  ++  LK+KGN++FK KD +NA+KYY+YAL L +DPV
Sbjct: 133 DSQNDPDFNEINKLIANNENLKSKFAKELKNKGNQYFKSKDNENAIKYYEYALRLDQDPV 192

Query: 141 FYSNISACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVLS 200
           FYSNISACY +MNQLDKV+E+S KALELKPDYSKALLRRA+A E+L N  +A++D S+LS
Sbjct: 193 FYSNISACYFAMNQLDKVIESSNKALELKPDYSKALLRRANAYEALGNNKEALYDFSILS 252

Query: 201 LNGDFGGSSIEPMLERNLNKQAMTVLKDKLGQQK--NQLLPSDTALASFFGIFTPETEFA 258
           L G++ G  +EP+L R L+K +  VL+ KL  +K  N +L SD+AL SFFGIF PET   
Sbjct: 253 LFGEYSGQYLEPLLNRILDKVSTDVLRAKLDNKKTDNFILLSDSALVSFFGIFPPETTIT 312

Query: 259 NYDETSEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAYA-KL--REGNSDDAALKEK 315
           NY+   EAD++L  GLE L K++SEG+  AD+ F +A + +  KL   E N +++ L EK
Sbjct: 313 NYNPDDEADKELVQGLEALAKKTSEGFLDADKHFIKANELFMEKLLSSEDNDENSGLLEK 372

Query: 316 DAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKAE---EYYEF 372
            AIALE+ G+F+FLK D LG+  D+QKAIDL+PR NSYIYMA+++ADK   +   +Y+++
Sbjct: 373 VAIALEYSGVFKFLKFDLLGSETDLQKAIDLYPRPNSYIYMAMLVADKNNDKNDLDYFKY 432

Query: 373 FDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYREN 432
           FDKA  L+P  A  YYHRGQ+  +  ++++A   F KAK+L++ N++PYIQLAC+AY  +
Sbjct: 433 FDKATTLNPNFAPTYYHRGQLLLVNQKFDEAETFFLKAKELDDSNVYPYIQLACVAYYNS 492

Query: 433 KFDDCETLFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKRLEEAVDGIHVGI 492
            F  C+ LF EA+ KF T PEVP F+AEILADKG+LE A+KQYDIA RLE A   IHVGI
Sbjct: 493 TFKKCQELFDEARTKFPTLPEVPTFYAEILADKGELEAAMKQYDIAYRLETAYKYIHVGI 552

Query: 493 SPLVGKATLLARQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQLKLQQEDIDDAIKLF 552
           +PL+GKA  LAR P+ ENF   T+LLE+AC  DPRSEQ K+ LAQLKLQ EDID AI LF
Sbjct: 553 APLIGKAAALARIPTQENFDTMTELLEKACELDPRSEQAKISLAQLKLQTEDIDTAIALF 612

Query: 553 EEAASLARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKAQGVI 604
           EE A LART  +KLQATTFAEAAK+QKRI+ +P+ +AKIEETLA Y+A G+I
Sbjct: 613 EETADLARTYQDKLQATTFAEAAKIQKRIKENPIYAAKIEETLATYRADGII 664

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 60.8 bits (146), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 52/91 (57%), Gaps = 4/91 (4%)

Query: 106 STA--LKDKGNEFFKQKDYDNALKYYDYALTLKKDP--VFYSNISACYVSMNQLDKVVEN 161
           STA  LK KGN  F  KD+  A++Y+  A+     P  V YSN SACY S+ Q  + + +
Sbjct: 2   STADELKQKGNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALND 61

Query: 162 STKALELKPDYSKALLRRASANESLENYPDA 192
           + + +++ PD+SK   R  +A+  L +  DA
Sbjct: 62  AQQCVKINPDWSKGYNRMGAAHLGLGDLDDA 92

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 113 GNEFFKQKDYDNALKYYDYALT-LKKDPVFYSNISACYVSMNQLDKVVENSTKALELKPD 171
           G E+F + D+ NA+K Y   +    +D   YSN +A    +    + +++  KA+E  P+
Sbjct: 397 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDCEKAIEKDPN 456

Query: 172 YSKALLRRASANESLENYPDAMFDL 196
           + +A LR+A+A  +++++  A+  L
Sbjct: 457 FVRAYLRKATAQIAIKDFVKALETL 481

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 65/120 (54%), Gaps = 8/120 (6%)

Query: 87  GEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYAL-TLKKDPVFYSNI 145
           GEPK+      + E+ +  + ALK +GN     KDY+ A++ Y  A+  L  D V+Y+N 
Sbjct: 77  GEPKV------AAEELKKEAEALKLEGNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANR 130

Query: 146 SACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLS-VLSLNGD 204
           +A Y S+ Q +K VE++ KA ++   YSK   R   A  +L  + +A+     VL + GD
Sbjct: 131 AAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGD 190

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 65/120 (54%), Gaps = 15/120 (12%)

Query: 93  NVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYAL-TLKKDPVFYSNISACYVS 151
           NV E   E  E+ + ALK +GN+    KDY+ A+K Y  A+ TL  + V+++N +A Y S
Sbjct: 88  NVTEDDTEASEA-AEALKLEGNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSS 146

Query: 152 MNQLDKVVENSTKALELKPDYSKALLR-------RASANESLENYPDAMFDLSVLSLNGD 204
           + + D+ VE++  A+++ P YSK   R       +  A ++LE Y        VL + GD
Sbjct: 147 LKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEAYK------KVLDIEGD 200

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 47/79 (59%), Gaps = 2/79 (2%)

Query: 110 KDKGNEFFKQKDYDNALKYYDYALTLKKDP--VFYSNISACYVSMNQLDKVVENSTKALE 167
           K +GN  F  KD++ A++ +  A+ + + P  V YSN SACY SM +  + + ++ + + 
Sbjct: 8   KKEGNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADAQECVR 67

Query: 168 LKPDYSKALLRRASANESL 186
           +KPD+SK   R  +A+  L
Sbjct: 68  IKPDWSKGHNRLGAAHYGL 86

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 45/86 (52%), Gaps = 1/86 (1%)

Query: 112 KGNEFFKQKDYDNALKYYDYAL-TLKKDPVFYSNISACYVSMNQLDKVVENSTKALELKP 170
           +G E+F   D+ NA+K Y   +    +D   YSN +A    +      +++   A++  P
Sbjct: 394 QGKEYFTNADWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCDMAIQKDP 453

Query: 171 DYSKALLRRASANESLENYPDAMFDL 196
           ++ +A +R+A+A  +++ Y  A+  L
Sbjct: 454 NFVRAYIRKATAQIAVQEYAAAIETL 479

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 46/76 (60%), Gaps = 2/76 (2%)

Query: 110 KDKGNEFFKQKDYDNALKYYDYALTLKKDP--VFYSNISACYVSMNQLDKVVENSTKALE 167
           KD+GN  F  K+YD A++ +  A+ + + P  V YSN SACY S  Q  K +E++ + ++
Sbjct: 9   KDQGNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDANECVK 68

Query: 168 LKPDYSKALLRRASAN 183
           + P +SK   R  +A+
Sbjct: 69  INPTWSKGYNRVGAAH 84

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 47/87 (54%), Gaps = 5/87 (5%)

Query: 113 GNEFFKQKDYDNALKYYDYALTLKKDPV---FYSNISACYVSMNQLDKVVENSTKALELK 169
           G E+F + D+ NA+K Y   +   +DP     YSN +A    +    + + +   A+E  
Sbjct: 396 GKEYFTKGDWPNAVKAYTEMIA--RDPSDARGYSNRAAALSKLMSFPEAITDCNTAIEKD 453

Query: 170 PDYSKALLRRASANESLENYPDAMFDL 196
           P++ +A +R+A+A  +++++  A+  L
Sbjct: 454 PNFIRAYIRKATAQIAIKDFVPAIETL 480

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 45/76 (59%), Gaps = 2/76 (2%)

Query: 110 KDKGNEFFKQKDYDNALKYYDYALTLKKDP--VFYSNISACYVSMNQLDKVVENSTKALE 167
           K +GN  F  KD++ A++ +  A+ + + P  V YSN SACY S  Q +K +E++ + + 
Sbjct: 7   KQQGNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAKQCVN 66

Query: 168 LKPDYSKALLRRASAN 183
           + P +SK   R  +A+
Sbjct: 67  INPAWSKGYNRVGAAH 82

 Score = 38.1 bits (87), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 43/78 (55%), Gaps = 7/78 (8%)

Query: 108 ALKDKGNEFFKQKDYDNALKYYDYALTLKKDPVFYSNISACYVSMNQLDKVVENSTKAL- 166
           A K +GN+F+K + +D A+++Y  A  L KD  + +N +A      + +  ++  T+A+ 
Sbjct: 261 AEKAEGNKFYKARKFDEAIEHYSKAWELHKDITYLNNRAAAEYEKGEYETAIKTLTEAVE 320

Query: 167 ---ELKPDY---SKALLR 178
              EL+ DY   SK+  R
Sbjct: 321 QGRELRADYKVISKSFAR 338

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 112 KGNEFFKQKDYDNALKYYDYALT-LKKDPVFYSNISACYVSMNQLDKVVENSTKALELKP 170
           +G E+F + D+ NA+K Y   +    +D   YSN +A    +    + +++   A+   P
Sbjct: 399 QGKEYFTKGDWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCNVAISKDP 458

Query: 171 DYSKALLRRASA 182
           ++ +A +R+A+A
Sbjct: 459 NFIRAYIRKATA 470

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 44/79 (55%), Gaps = 2/79 (2%)

Query: 110 KDKGNEFFKQKDYDNALKYYDYALTLKKDP--VFYSNISACYVSMNQLDKVVENSTKALE 167
           K +GN  F  KDYD A++ +  A+ + K P  V YSN SACY S+ +    + ++ + + 
Sbjct: 9   KQQGNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAKECIN 68

Query: 168 LKPDYSKALLRRASANESL 186
           + P +SK   R  +A+  L
Sbjct: 69  INPSWSKGYNRLGAAHLGL 87

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 46/85 (54%), Gaps = 1/85 (1%)

Query: 113 GNEFFKQKDYDNALKYYDYALT-LKKDPVFYSNISACYVSMNQLDKVVENSTKALELKPD 171
           G ++F + D+ NA+K Y   +    +D   YSN +A    +    + + +  KA+E  P+
Sbjct: 403 GKDYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 172 YSKALLRRASANESLENYPDAMFDL 196
           + +A +R+A+A  +++ Y  A+  L
Sbjct: 463 FVRAYIRKATAQIAVQEYAAALETL 487

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 38/64 (59%)

Query: 85  EKGEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTLKKDPVFYSN 144
           ++ E K  +  E+ E+  ++ +   K +GN+F+K + +D A+++Y+ A  L +D  + +N
Sbjct: 241 QREENKESDPMEVDEDDSKAEADKEKAEGNKFYKARQFDEAIEHYNKAWELHRDITYLNN 300

Query: 145 ISAC 148
            +A 
Sbjct: 301 RAAA 304

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 69/148 (46%), Gaps = 29/148 (19%)

Query: 110 KDKGNEFFKQKDYDNALKYYDYALTLKKDP--VFYSNISACYVSMNQLDKVVENSTKALE 167
           K +GN  F  KD++ A++ +  A+ +   P  V YSN SA Y S  Q  + + ++T+ ++
Sbjct: 9   KQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDATECVK 68

Query: 168 LKPDYSKALLRRASA-------NESLENYPDAMFDLSVLSLNGDFGGSSIEPMLERNLNK 220
           + P +SK   R  +A        E+ +NY +A+                    L+ N NK
Sbjct: 69  INPTWSKGYNRLGAAEFGLGNLEEAEKNYKEAL-------------------KLDNNNNK 109

Query: 221 QAMTVLKDKLGQQKNQLLPSDTALASFF 248
            A   L D++ + KN   P+D  L S F
Sbjct: 110 AAQDGL-DQIERAKNAPPPNDFGLTSMF 136

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 113 GNEFFKQKDYDNALKYYDYALT-LKKDPVFYSNISACYVSMNQLDKVVENSTKALELKPD 171
           G E+F + D+ NA+K Y   +    +D   YSN +A    +    + +++   A++  P+
Sbjct: 396 GKEYFTKGDWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCDNAIKKDPN 455

Query: 172 YSKALLRRASANESLENYPDAM 193
           + +A +R+A+A  +++ Y +A+
Sbjct: 456 FVRAYIRKATAQIAIKEYANAL 477

 Score = 31.6 bits (70), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 4/67 (5%)

Query: 110 KDKGNEFFKQKDYDNALKYYDYALTLKKDPVFYSNISACYVSMNQLDKVVENSTKAL--- 166
           K +GN+ +K   +D A++ Y+ A  L KD  + +N SA        +  +    +A+   
Sbjct: 259 KVEGNKLYKAHKFDEAIEQYNKAWALNKDITYLNNRSAAEFEKGDFETAIATLNEAVDQG 318

Query: 167 -ELKPDY 172
            EL+ DY
Sbjct: 319 RELRADY 325

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 45/79 (56%), Gaps = 2/79 (2%)

Query: 110 KDKGNEFFKQKDYDNALKYYDYALTLKKDP--VFYSNISACYVSMNQLDKVVENSTKALE 167
           K +GN  F  KDYD A++ +  A+ + + P  V YSN SACY S+ +    + ++ + ++
Sbjct: 9   KQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDANECVK 68

Query: 168 LKPDYSKALLRRASANESL 186
           + P +SK   R  +A+  L
Sbjct: 69  INPSWSKGYNRLGAAHLGL 87

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 46/85 (54%), Gaps = 1/85 (1%)

Query: 113 GNEFFKQKDYDNALKYYDYALT-LKKDPVFYSNISACYVSMNQLDKVVENSTKALELKPD 171
           G E+F + D+ NA+K Y   +    +D   YSN +A    +    + + +  KA+E  P+
Sbjct: 403 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 172 YSKALLRRASANESLENYPDAMFDL 196
           + +A +R+A+A  +++ Y  A+  L
Sbjct: 463 FVRAYIRKATAQIAVKEYASALETL 487

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 43/84 (51%), Gaps = 7/84 (8%)

Query: 110 KDKGNEFFKQKDYDNALKYYDYALTLKKDPVFYSNISACYVSMNQLDKVVENSTKAL--- 166
           K +GN+F+K + +D A+++Y+ A  L KD  + +N +A      + +  +     A+   
Sbjct: 266 KAEGNKFYKARQFDEAIEHYNKAWELHKDITYLNNRAAAEYEKGEYETAISTLNDAVEQG 325

Query: 167 -ELKPDY---SKALLRRASANESL 186
            E++ DY   SK+  R  +A   L
Sbjct: 326 REMRADYKVISKSFARIGNAYHKL 349

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 47/85 (55%), Gaps = 2/85 (2%)

Query: 110 KDKGNEFFKQKDYDNALKYYDYALTLKKDP--VFYSNISACYVSMNQLDKVVENSTKALE 167
           K +GN  F  KDY  A+  +  A+ + + P  V YSN SACY S+ +    + ++T+ ++
Sbjct: 9   KQQGNAAFTAKDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLKKFTDALNDATECVK 68

Query: 168 LKPDYSKALLRRASANESLENYPDA 192
           + P +SK   R  +A+  L +  DA
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDDA 93

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 46/85 (54%), Gaps = 1/85 (1%)

Query: 113 GNEFFKQKDYDNALKYYDYALTLK-KDPVFYSNISACYVSMNQLDKVVENSTKALELKPD 171
           G E+F + D+ NA+K Y   +    +D   YSN +A    +    + + +  KA+E  P+
Sbjct: 400 GKEYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 459

Query: 172 YSKALLRRASANESLENYPDAMFDL 196
           + +A +R+A+A  +++ +  A+  L
Sbjct: 460 FVRAYIRKATAQIAVQEFAGALETL 484

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 7/84 (8%)

Query: 110 KDKGNEFFKQKDYDNALKYYDYALTLKKDPVFYSNISACYVSMNQLDKVVENSTKAL--- 166
           K +GN+F+K + ++ A+++Y+ A  L +D  + +N +A        +  +   T A+   
Sbjct: 263 KAEGNKFYKARQFEEAIEHYNKAWELHRDITYLNNRAAAEYEKGDYETAIATLTDAVEQG 322

Query: 167 -ELKPDY---SKALLRRASANESL 186
            E++ DY   SK+  R  +A   L
Sbjct: 323 REMRADYKVISKSFARIGNAYHKL 346

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 55/88 (62%), Gaps = 2/88 (2%)

Query: 93  NVAE-MSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYAL-TLKKDPVFYSNISACYV 150
           N+A+  ++E++++ +  LK +GN+    KDY++A+K Y  A+  L  + V+Y+N +A Y 
Sbjct: 79  NIADDAADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTNAVYYANRAAAYS 138

Query: 151 SMNQLDKVVENSTKALELKPDYSKALLR 178
           S+ + D  V ++  A+++ P YSK   R
Sbjct: 139 SLKKYDDAVNDAESAIKVNPTYSKGYSR 166

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 58/106 (54%), Gaps = 3/106 (2%)

Query: 97  MSEEQKESWSTAL--KDKGNEFFKQKDYDNALKYYDYALTL-KKDPVFYSNISACYVSMN 153
           MS   +E  +TAL  K+KGNE+ K+ DYD+A+++Y  A+ L     +++SN +  ++  +
Sbjct: 1   MSSPSQEDIATALDFKNKGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQD 60

Query: 154 QLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVL 199
                V +   AL+L P   KA  RR  +   +  +  A  DL+V+
Sbjct: 61  NFYSAVVDCDNALKLDPKNIKAYHRRGLSYVGILEFRKAKNDLNVV 106

 Score = 34.7 bits (78), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 20/35 (57%)

Query: 374 DKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFD 408
           D A+KLDPKN   Y+ RG  Y    ++ KA  D +
Sbjct: 70  DNALKLDPKNIKAYHRRGLSYVGILEFRKAKNDLN 104

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 46/105 (43%), Gaps = 12/105 (11%)

Query: 336 AHEDVQKAIDLHPRVNSYIYMALIMADKGKAEEYYEFFDKAIKLDPKNAAVYYHRGQMYF 395
           + ED+  A+D   + N YI        K   +   EF+ KAI LD   +  + +R   + 
Sbjct: 5   SQEDIATALDFKNKGNEYI-------KKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHL 57

Query: 396 ITAQYEKAGQDFDKAKQLNEENIFPYIQ-----LACLAYRENKFD 435
               +  A  D D A +L+ +NI  Y +     +  L +R+ K D
Sbjct: 58  KQDNFYSAVVDCDNALKLDPKNIKAYHRRGLSYVGILEFRKAKND 102

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 46/79 (58%), Gaps = 2/79 (2%)

Query: 110 KDKGNEFFKQKDYDNALKYYDYALTLKKDP--VFYSNISACYVSMNQLDKVVENSTKALE 167
           K +GN  F  KDY+ A+  +  A+ + + P  VFYSN SACY S+ +  + + ++ + ++
Sbjct: 8   KQQGNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDAEECVK 67

Query: 168 LKPDYSKALLRRASANESL 186
           + P +SK   R  +A+  L
Sbjct: 68  INPTWSKGYNRLGAAHLGL 86

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 44/91 (48%), Gaps = 13/91 (14%)

Query: 113 GNEFFKQKDYDNALKYYDYALTLKKDPVFYSNISA-------CYVSMNQLDKVVENSTKA 165
           GN+ +K + +D A+ +YD A  L +D  + +N SA          ++  LD+ VE   K 
Sbjct: 263 GNKAYKARQFDEAIAHYDAAWNLHQDITYLNNRSAAEFEKGDAETALKTLDEAVE---KG 319

Query: 166 LELKPDY---SKALLRRASANESLENYPDAM 193
            E++ DY   +K+  R  + +    N   A+
Sbjct: 320 REMRTDYKLIAKSFARMGNVHHKTNNLKKAI 350

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 78/161 (48%), Gaps = 9/161 (5%)

Query: 106 STAL--KDKGNEFFKQKDYDNALKYYDYALTL-KKDPVFYSNISACYVSMNQLDKVVENS 162
           +TAL  K++GNE+ K KDY  A++ Y  A+       +F+SN +   + +++    +E+S
Sbjct: 36  ATALDYKNEGNEWVKAKDYARAVEAYTRAIEADGTQSIFFSNRALANLKLDRFQSALEDS 95

Query: 163 TKALELKPDYSKALLRRASANESLENYPDAMFDLSVL--SLNGDFGGSSIEPMLERNLNK 220
            +A+EL     KA  RR  A+  L  +  A  DL V+  +  GD        + ER L +
Sbjct: 96  ARAIELDAGNVKAYHRRGLAHCGLLEWGPAKRDLEVVVRAKPGDEAVRRALEVCERMLRR 155

Query: 221 QAMTVLKDKLGQQKNQLLPSDTALASFFGIFTPETEFANYD 261
           +         G ++ + L    +LASF G      + A+YD
Sbjct: 156 ERFERAIRADGDEEQRRLCKTLSLASFAG----NADLASYD 192

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 50/91 (54%), Gaps = 1/91 (1%)

Query: 110 KDKGNEFFKQKDYDNALKYYDYALTLKK-DPVFYSNISACYVSMNQLDKVVENSTKALEL 168
           KD+GN+F   KDY  A++ Y  A+ L     +F+SN +   + +++    +E+S+KA+EL
Sbjct: 13  KDQGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSKAIEL 72

Query: 169 KPDYSKALLRRASANESLENYPDAMFDLSVL 199
                K   RR  A   L+++  A  DL V+
Sbjct: 73  DSSNVKGYHRRGMAYAGLQDFISAKRDLEVV 103

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 47/86 (54%), Gaps = 2/86 (2%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALTLKKDP--VFYSNISACYVSMNQLDKVVENSTKAL 166
            K +GN  F  KD++ A + +  A+   + P  V YSN SACY S+ +  + +E++ + +
Sbjct: 6   FKKQGNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAEECV 65

Query: 167 ELKPDYSKALLRRASANESLENYPDA 192
           ++ P +SK   R  +A   L N  DA
Sbjct: 66  KINPTWSKGYNRVGAAQYGLGNLDDA 91

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 51/91 (56%), Gaps = 7/91 (7%)

Query: 99  EEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTLKKDPVFYSNISACYVSMNQLDKV 158
           E+  ++ + A K +GN+++K + +D A+++Y+ A  L +D  + +N SA        ++ 
Sbjct: 260 EQDSKAKADAEKAEGNKYYKARKFDEAIEHYNKAWDLHRDVTYLNNRSAAEYEKGDYEQA 319

Query: 159 VENSTKAL----ELKPDY---SKALLRRASA 182
           ++  T+A+    E++ DY   SK+  R  +A
Sbjct: 320 IKTLTEAVDQGREMRADYKLISKSFARIGNA 350

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 48/106 (45%), Gaps = 6/106 (5%)

Query: 112 KGNEFFKQKDYDNALKYYDYALT-LKKDPVFYSNISACYVSMNQLDKVVENSTKALELKP 170
           +G EFF + D+ +A+  Y   +    +D   YSN +A    +      +++   A+   P
Sbjct: 407 QGKEFFTKGDWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCDVAISKDP 466

Query: 171 DYSKALLRRASANESLENYPDAMFDLSV-----LSLNGDFGGSSIE 211
           ++ +A +R+ASA  ++  +  AM  L       L +N       IE
Sbjct: 467 NFVRAYIRKASAQIAVREFAPAMETLDAARAKDLEINKGANAREIE 512

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 110 KDKGNEFFKQKDYDNALKYYDYALTLKKDP--VFYSNISACYVSMNQLDKVVENSTKALE 167
           K +GN  F  KDY+ A + +  A+ + + P  V YSN SACY S+ +  + ++++ + ++
Sbjct: 8   KQQGNAAFVAKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKDAEECVK 67

Query: 168 LKPDYSKALLRRASANESLENYPDA 192
           + P +SK   R  +A   L N  DA
Sbjct: 68  INPGWSKGYNRVGAAQFGLNNLEDA 92

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 47/88 (53%), Gaps = 1/88 (1%)

Query: 113 GNEFFKQKDYDNALKYYDYALTLK-KDPVFYSNISACYVSMNQLDKVVENSTKALELKPD 171
           G E+F + D+ NA+K Y   +    +D   YSN +A    +    + + +  +A+E  P+
Sbjct: 389 GKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCDRAIEKDPN 448

Query: 172 YSKALLRRASANESLENYPDAMFDLSVL 199
           + +A +R+ASA  +++ +  A+  L  +
Sbjct: 449 FIRAYIRKASAQIAVKEFAAAVETLDTV 476

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 36/67 (53%), Gaps = 4/67 (5%)

Query: 110 KDKGNEFFKQKDYDNALKYYDYALTLKKDPVFYSNISACYVSMNQLDKVVENSTKAL--- 166
           K +GN+F+K + +D A+++Y+ A  L KD  + +N +A        +  +   T A+   
Sbjct: 252 KAEGNKFYKARKFDEAIEHYNKAWELHKDITYLNNRAAAEYEKGDYETAIATLTNAVDEG 311

Query: 167 -ELKPDY 172
            E++ DY
Sbjct: 312 REMRADY 318

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 53/97 (54%), Gaps = 5/97 (5%)

Query: 106 STALKDKGNEFFKQKDYDNALKYYDYALTLKKDP---VFYSNISACYVSMNQLDKVVENS 162
           +T+ KD+GN+F KQ+D+  A + Y  A+  + DP   +FYSN +   + ++     + + 
Sbjct: 9   ATSYKDEGNKFLKQQDFQRANELYTKAI--ETDPTQSIFYSNRALANLKLDNFMNALNDC 66

Query: 163 TKALELKPDYSKALLRRASANESLENYPDAMFDLSVL 199
           T A+EL     KA  RR  AN  L N+  A  D +++
Sbjct: 67  TNAIELNSSNLKAYHRRGLANIGLLNFKSARNDFNIV 103

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 44/76 (57%), Gaps = 2/76 (2%)

Query: 110 KDKGNEFFKQKDYDNALKYYDYALTLKKDP--VFYSNISACYVSMNQLDKVVENSTKALE 167
           K +GN  F  KDYD A+  +  A+ + + P  V YSN SACY S+ +    ++++ + ++
Sbjct: 9   KQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDAEECVK 68

Query: 168 LKPDYSKALLRRASAN 183
           + P +SK   R  +A+
Sbjct: 69  INPSWSKGYNRVGAAH 84

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 46/85 (54%), Gaps = 1/85 (1%)

Query: 113 GNEFFKQKDYDNALKYYDYAL-TLKKDPVFYSNISACYVSMNQLDKVVENSTKALELKPD 171
           G ++F + D+ NA+K Y   +    +D   YSN +A    +    + +++  KA+E  P+
Sbjct: 404 GKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSFPEAIDDCNKAIEKDPN 463

Query: 172 YSKALLRRASANESLENYPDAMFDL 196
           + +A +R+A+A  ++  +  A+  L
Sbjct: 464 FVRAYIRKATAQIAVREFSSALETL 488

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 51/92 (55%), Gaps = 1/92 (1%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALTL-KKDPVFYSNISACYVSMNQLDKVVENSTKALE 167
           LK++GN++ K+K Y  A++YY  A+ L     +F+SN +   + ++     +++   ALE
Sbjct: 16  LKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNSALE 75

Query: 168 LKPDYSKALLRRASANESLENYPDAMFDLSVL 199
           L P   KA  RR  +   L ++  A  DLS++
Sbjct: 76  LDPKNIKAYHRRGLSQLGLLHFKKAKNDLSIV 107

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 52/98 (53%), Gaps = 2/98 (2%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALTL-KKDPVFYSNISACYVSMNQLDKVVENSTKALE 167
           LK +GN+ F  KD++ A+K Y  A+ L   + VFY N +A Y S  + ++ V ++  A+ 
Sbjct: 99  LKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVR 158

Query: 168 LKPDYSKALLRRASANESLENYPDAMFDL-SVLSLNGD 204
           + P YS+   R   A  +L    +AM     VL + GD
Sbjct: 159 INPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGD 196

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 47/85 (55%), Gaps = 2/85 (2%)

Query: 110 KDKGNEFFKQKDYDNALKYYDYALTLKKDP--VFYSNISACYVSMNQLDKVVENSTKALE 167
           K +GN  F  KDY  A+  +  A+ + + P  V YSN SA Y S  Q ++ + ++ + ++
Sbjct: 9   KQEGNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSDADECIK 68

Query: 168 LKPDYSKALLRRASANESLENYPDA 192
           + P ++K   R+ +A + L  Y +A
Sbjct: 69  INPSWAKGYTRKGAALQGLHKYEEA 93

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 43/87 (49%), Gaps = 1/87 (1%)

Query: 113 GNEFFKQKDYDNALKYYDYALTLKKDPVF-YSNISACYVSMNQLDKVVENSTKALELKPD 171
           G E+F + D+ NA+K Y   +    D    YSN +A    +      + +  KA+E  P 
Sbjct: 392 GKEYFTKADWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDCNKAIEKDPS 451

Query: 172 YSKALLRRASANESLENYPDAMFDLSV 198
           + +A LR+A+   +++ +  A+  L +
Sbjct: 452 FIRAYLRKATCQIAVKEFAGAIETLDL 478

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 57/99 (57%), Gaps = 2/99 (2%)

Query: 108 ALKDKGNEFFKQKDYDNALKYYDYAL-TLKKDPVFYSNISACYVSMNQLDKVVENSTKAL 166
           ALK +GN+    KDYD A++ Y  A+  L  + V+++N +A Y +    D+ V+++ +A+
Sbjct: 103 ALKLEGNKAVASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAI 162

Query: 167 ELKPDYSKALLRRASANESLENYPDAMFDL-SVLSLNGD 204
           +L P YSK   R A A    EN+ +++     VL + GD
Sbjct: 163 KLDPAYSKGYSRLAYAKYVQENFEESLEAYKKVLEIEGD 201

 Score = 31.2 bits (69), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 36/67 (53%)

Query: 371 EFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYR 430
           E + +AIK+ P NA  + +R   Y  +  Y++A +D ++A +L+      Y +LA   Y 
Sbjct: 122 EKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYV 181

Query: 431 ENKFDDC 437
           +  F++ 
Sbjct: 182 QENFEES 188

 Score = 30.8 bits (68), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 48/94 (51%), Gaps = 2/94 (2%)

Query: 459 AEILADKGDLEKALKQYDIAKRLEEAVDGIHVGISPLVGKATLLARQPSVENFIEATKLL 518
           AE L  +G+   A K YD+A  +E+  + I +  +  V  A   A   + +N+ EA K  
Sbjct: 101 AEALKLEGNKAVASKDYDLA--VEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDA 158

Query: 519 EEACAKDPRSEQGKVGLAQLKLQQEDIDDAIKLF 552
           EEA   DP   +G   LA  K  QE+ +++++ +
Sbjct: 159 EEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAY 192

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 49/88 (55%), Gaps = 2/88 (2%)

Query: 110 KDKGNEFFKQKDYDNALKYYDYALTLKKDP--VFYSNISACYVSMNQLDKVVENSTKALE 167
           K +GN  F  K+YD A++ +  A+ + + P  V +SN SACY S+ +    + ++ + ++
Sbjct: 9   KQQGNAAFTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALNDANECVK 68

Query: 168 LKPDYSKALLRRASANESLENYPDAMFD 195
           + P +SK   R  +A+  L +  +A  D
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEAESD 96

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 46/87 (52%), Gaps = 1/87 (1%)

Query: 113 GNEFFKQKDYDNALKYYDYALT-LKKDPVFYSNISACYVSMNQLDKVVENSTKALELKPD 171
           G E+F + D+ NA+K Y   +    +D   YSN +A    +    + + +  KA+E  P+
Sbjct: 403 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 172 YSKALLRRASANESLENYPDAMFDLSV 198
           + +A +R A+A  +++ +  A+  L V
Sbjct: 463 FVRAYIRMAAAQIAVKEFAAALETLDV 489

 Score = 35.4 bits (80), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 49/98 (50%), Gaps = 7/98 (7%)

Query: 96  EMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTLKKDPVFYSNISACYVSMNQL 155
           E+ E+  ++ +   K +GN+F+K   +D A+++Y+ A  L KD  + +N +A        
Sbjct: 252 EVDEDNSKAEADNEKAEGNKFYKAHQFDEAIEHYNRAWELHKDITYLNNRAAAEYEKGDY 311

Query: 156 DKVVENSTKALE----LKPDY---SKALLRRASANESL 186
           + V+     A+E    ++ DY   SK+  R  +A   L
Sbjct: 312 ETVIATLNDAVEKGRDMRADYKVISKSFARIGNAYHKL 349

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 57/100 (57%), Gaps = 4/100 (4%)

Query: 108 ALKDKGNEFFKQKDYDNALKYYDYAL-TLKKDPVFYSNISACYVSMNQLDKVVENSTKAL 166
           + K +GN+    KDY  A++ Y  A+ TL  + ++Y+N +A Y S+ + D  ++++ KA+
Sbjct: 101 SFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAI 160

Query: 167 ELKPDYSKALLRRASANESLENYPDAMFDL--SVLSLNGD 204
           E+ P YSK   R A A  +L N P+   +    VL + GD
Sbjct: 161 EIDPAYSKGYSRLAFAKYAL-NKPEEALEYYKKVLDMEGD 199

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 56/100 (56%), Gaps = 4/100 (4%)

Query: 108 ALKDKGNEFFKQKDYDNALKYYDYAL-TLKKDPVFYSNISACYVSMNQLDKVVENSTKAL 166
           ALK +GN+    KD++ A+  Y  A+  L  + ++Y+N +A + S+ Q D+ V ++ KA+
Sbjct: 95  ALKLEGNKAMAGKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAI 154

Query: 167 ELKPDYSKALLRRASANESLENYPDAMFDL--SVLSLNGD 204
           E+ P YSK   R   A  + +N P+   +    V+ L GD
Sbjct: 155 EIDPAYSKGYSRLGFAKYA-QNKPEEALEAYKKVMDLEGD 193

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 50/101 (49%)

Query: 93  NVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTLKKDPVFYSNISACYVSM 152
           N  E +++     + ALK +GNE   +  Y+ A+K Y  A+   K+  +YSN S  Y  +
Sbjct: 69  NTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKL 128

Query: 153 NQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAM 193
            + +  V ++T A+ + P +SKA  R   A    +   D M
Sbjct: 129 GRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGM 169

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 61/111 (54%), Gaps = 3/111 (2%)

Query: 96  EMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTL-KKDPVFYSNISACYVSMNQ 154
           E+SE++K+  + ALK +GN+    K+Y +A+  Y  A+ +   +P +YSN +A Y  +  
Sbjct: 89  EISEDKKKE-AEALKLEGNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIED 147

Query: 155 LDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDL-SVLSLNGD 204
               V ++  A++L P YSKA  R  +A  +  N  DA+     VL L GD
Sbjct: 148 FTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 54/96 (56%), Gaps = 4/96 (4%)

Query: 112 KGNEFFKQKDYDNALKYYDYALTLK-KDPVFYSNISACYVSMNQLDKVVENSTKALELKP 170
           +GN+    K +D A++ Y  A+ +   + V+YSN +A Y S+ Q ++ V+++ +A+E+ P
Sbjct: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160

Query: 171 DYSKALLRRASANESLENYPDAMFDL--SVLSLNGD 204
            YSK   R   A  +L N P+   D    VL + G+
Sbjct: 161 TYSKGFSRLGFAKYAL-NKPEEALDAYKKVLDIEGE 195

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 35/69 (50%)

Query: 365 KAEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQL 424
           K +E  E +  AI++ P NA  Y +R   Y    QYE+A +D ++A +++      + +L
Sbjct: 110 KFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRL 169

Query: 425 ACLAYRENK 433
               Y  NK
Sbjct: 170 GFAKYALNK 178

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 56/104 (53%), Gaps = 14/104 (13%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYAL-TLKKDPVFYSNISACYVSMNQLDKVVENSTKALE 167
           LK +GN+    KD++ A+K Y  A+  L  + V+Y+N +A Y S+ + ++ V+++  A++
Sbjct: 100 LKLQGNKAMASKDFETAIKKYTEAIEVLPSNAVYYANRAAAYSSLKKYEESVQDAESAIK 159

Query: 168 LKPDYSKALLRRASAN-------ESLENYPDAMFDLSVLSLNGD 204
           + P YSK   R   A        E+LE Y       +VL + GD
Sbjct: 160 VNPSYSKGYSRLGFAKYALGKPEEALEAYK------TVLDIEGD 197

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 43/79 (54%), Gaps = 2/79 (2%)

Query: 110 KDKGNEFFKQKDYDNALKYYDYALTLKKDP--VFYSNISACYVSMNQLDKVVENSTKALE 167
           K +GN  F  K+Y+ A+  +  A+ +  +P  V YSN SACY S+ +    + ++ +  +
Sbjct: 9   KQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDANECTK 68

Query: 168 LKPDYSKALLRRASANESL 186
           + P +SK   R  +A+  L
Sbjct: 69  INPTWSKGYNRVGAAHYGL 87

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 46/88 (52%), Gaps = 1/88 (1%)

Query: 112 KGNEFFKQKDYDNALKYYDYALTLKKDPV-FYSNISACYVSMNQLDKVVENSTKALELKP 170
           +G +FF +  + +A+K Y   +    D    YSN +A    +    + + +  KALE  P
Sbjct: 398 QGKDFFNKGQWPDAVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCEKALEKDP 457

Query: 171 DYSKALLRRASANESLENYPDAMFDLSV 198
           ++ KA +R+A+A  +++ Y  A+  L +
Sbjct: 458 NFVKAYIRKATAQIAIKEYSSALETLDI 485

 Score = 38.9 bits (89), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 45/89 (50%), Gaps = 13/89 (14%)

Query: 108 ALKDKGNEFFKQKDYDNALKYYDYALTLKKDPVFYSNISACY-------VSMNQLDKVVE 160
           A KD+GN+ +K   +D A+++YD A  L  D  + +N +A          ++  L+  +E
Sbjct: 260 AEKDEGNKLYKAHKFDEAIEHYDKAWELHNDITYLNNKAAAQYEKGDYETTIKTLEDAIE 319

Query: 161 NSTKALELKPDY---SKALLRRASANESL 186
              K  EL+ DY   +KA  R  +A E L
Sbjct: 320 ---KGRELRADYKIIAKAFTRMGNAYEKL 345

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 54/99 (54%), Gaps = 4/99 (4%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALTLK-KDPVFYSNISACYVSMNQLDKVVENSTKALE 167
           LK +GN+    KD+D A+  Y  A+++   + ++Y+N +A Y S+   +K  E++  A+ 
Sbjct: 102 LKLEGNKAMAMKDFDLAIAKYSEAISISPNNAIYYANRAAAYSSLKDFEKATEDAESAIR 161

Query: 168 LKPDYSKALLRRASANESLENYPDAMFDL--SVLSLNGD 204
           + P+YSK   R   A  +L N P+   +    VL L GD
Sbjct: 162 VDPNYSKGYSRLGFAKYAL-NKPEEALEAYKKVLDLEGD 199

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 45/80 (56%), Gaps = 2/80 (2%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALTLKKDP--VFYSNISACYVSMNQLDKVVENSTKAL 166
            K +GN+ F  KDY  A++ +  A+ + + P  V +SN SACY S     K ++++ + +
Sbjct: 6   FKQEGNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDANECV 65

Query: 167 ELKPDYSKALLRRASANESL 186
           ++ P ++K   R  +A+  L
Sbjct: 66  KINPSWAKGYNRLGAAHYGL 85

 Score = 37.7 bits (86), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 54/112 (48%), Gaps = 11/112 (9%)

Query: 86  KGEPKLDN----VAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTLKKDPVF 141
           K EPK++        M  +  +S + A K +GN+ +KQ+ +D A++ Y+ A     D  +
Sbjct: 231 KAEPKVETKKPEPEPMEVDDDKSKAEAAKAEGNKLYKQRKFDEAIEKYNEAWETHNDITY 290

Query: 142 YSNISACYVSMNQLDKVVENSTKAL----ELKPDY---SKALLRRASANESL 186
            +N +A        +  +E  TKA+    EL+ DY   SK+  R  ++   L
Sbjct: 291 LNNRAAAEYEKGDYEAAIETLTKAVEQGRELRADYKVISKSFARMGNSYHKL 342

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 47/88 (53%), Gaps = 5/88 (5%)

Query: 112 KGNEFFKQKDYDNALKYYDYALTLKKDP---VFYSNISACYVSMNQLDKVVENSTKALEL 168
           +G E+F + D+  A++ Y     +K++P     YSN +A    +      + +  KA+E 
Sbjct: 395 QGKEYFTKADWPKAVEAY--TEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCDKAIEK 452

Query: 169 KPDYSKALLRRASANESLENYPDAMFDL 196
            P++ +A +R+A+   ++++Y  A+  L
Sbjct: 453 DPNFVRAYIRKATGQIAIKDYAGAIETL 480

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 49/85 (57%), Gaps = 2/85 (2%)

Query: 110 KDKGNEFFKQKDYDNALKYYDYALTLKKDP--VFYSNISACYVSMNQLDKVVENSTKALE 167
           K +GN  F  KD+  A++ +  A+   ++P  V YSN S  Y S+ + D+ + ++T+ ++
Sbjct: 8   KKEGNAAFVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDATECVK 67

Query: 168 LKPDYSKALLRRASANESLENYPDA 192
           +K D+SK   R  +A+  L N  +A
Sbjct: 68  IKADWSKGHNRLGAAHFGLGNLDEA 92

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 47/87 (54%), Gaps = 1/87 (1%)

Query: 113 GNEFFKQKDYDNALK-YYDYALTLKKDPVFYSNISACYVSMNQLDKVVENSTKALELKPD 171
           G E+F + D+ +A+K Y +  +    D   YSN +A    +      +++  KA+E+ P 
Sbjct: 399 GKEYFTKGDWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDCDKAIEIDPS 458

Query: 172 YSKALLRRASANESLENYPDAMFDLSV 198
           + +A +R+A+A  +++ Y  A+  L V
Sbjct: 459 FVRAYIRKATAQIAVQEYSAAIETLDV 485

 Score = 35.0 bits (79), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 36/67 (53%), Gaps = 4/67 (5%)

Query: 110 KDKGNEFFKQKDYDNALKYYDYALTLKKDPVFYSNISACYVSMNQLDKVVENSTKAL--- 166
           K +GN+ +KQ+ +D A+  Y+ A  L+KD  + +N +A        +  ++   +A+   
Sbjct: 262 KAEGNQLYKQRKFDEAIAKYEEAWNLQKDITYLNNRAAAEYEKGDYNSAIKTLNEAVEQG 321

Query: 167 -ELKPDY 172
            EL+ DY
Sbjct: 322 RELRADY 328

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 55/106 (51%), Gaps = 3/106 (2%)

Query: 97  MSEEQKESWSTAL--KDKGNEFFKQKDYDNALKYYDYALTL-KKDPVFYSNISACYVSMN 153
           MS   +E+   AL  K++GN F K+K Y  A++YY  A+ L     +F+SN +   + ++
Sbjct: 1   MSIVSEEAAQKALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLD 60

Query: 154 QLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVL 199
                +E+  K++EL P   KA+ RR  +   L  +  A  DL  +
Sbjct: 61  NFLTALEDCNKSIELDPKNIKAIHRRGLSYVGLLEFSKARKDLKTI 106

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 2/63 (3%)

Query: 374 DKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQL--NEENIFPYIQLACLAYRE 431
           +K+I+LDPKN    + RG  Y    ++ KA +D     Q+  NE++    +++     RE
Sbjct: 70  NKSIELDPKNIKAIHRRGLSYVGLLEFSKARKDLKTILQVKPNEQSALKALEVCERFIRE 129

Query: 432 NKF 434
            +F
Sbjct: 130 ERF 132

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 61/105 (58%), Gaps = 10/105 (9%)

Query: 99  EEQKE--SWSTALKDKGNEFFKQKDYDNALKYYDYALTL-KKDPVFYSNISACYVSMNQL 155
           EE KE  + + ALK +GN+    KDY+ A++ Y+ A+ L     V+Y+N +A Y S  + 
Sbjct: 94  EEDKELAAKAEALKLEGNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKY 153

Query: 156 DKVVENSTKALELKPDYSKALLR-------RASANESLENYPDAM 193
           D+ ++++  A++++P++SK   R       +  + E+LE Y  A+
Sbjct: 154 DEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKAL 198

>TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa]
           {ON} Anc_3.367 YBR112C
          Length = 1043

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 57/124 (45%), Gaps = 17/124 (13%)

Query: 375 KAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRENKF 434
           K++++DP +AA +YH G+++ I A Y  A   F +A   +  N   +  +  L Y+ +++
Sbjct: 296 KSLEIDPSDAATWYHLGRVHMIRADYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQY 355

Query: 435 DDCETLFSEAKRKFATAPEVPNFFAEILADKG--------DLEKALKQYDIAKRLEEAVD 486
            D    ++ A R          + +E+  D G         L  AL  Y  A RL+   D
Sbjct: 356 RDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNKQLNDALDAYKQAARLDP--D 406

Query: 487 GIHV 490
            +H+
Sbjct: 407 NVHI 410

 Score = 34.7 bits (78), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 52/117 (44%), Gaps = 16/117 (13%)

Query: 314 EKDAIALEHRGIFRFLKN----DPLGAHEDVQKAIDLHPRVNSYIY----MALIMADKGK 365
           E  A  L+  G    + N    DP  A   + K++++ P   +  Y    + +I AD   
Sbjct: 264 EHHAKVLQQLGCLYGMNNTQFYDPQKALNLLLKSLEIDPSDAATWYHLGRVHMIRADYTA 323

Query: 366 AEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYI 422
           A   Y+ F +A+  D +N   +   G +Y+  +QY  A   + +A +LN     PYI
Sbjct: 324 A---YDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLN-----PYI 372

 Score = 31.6 bits (70), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 54/117 (46%), Gaps = 6/117 (5%)

Query: 316 DAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKAEEYYEFFD- 374
           DA    H G    ++ D   A++  Q+A++   R  + I+   I     +  +Y +  D 
Sbjct: 304 DAATWYHLGRVHMIRADYTAAYDAFQQAVNRDSR--NPIFWCSIGVLYYQISQYRDALDA 361

Query: 375 --KAIKLDPKNAAVYYHRGQMY-FITAQYEKAGQDFDKAKQLNEENIFPYIQLACLA 428
             +AI+L+P  + V+Y  G +Y     Q   A   + +A +L+ +N+    +L  LA
Sbjct: 362 YTRAIRLNPYISEVWYDLGTLYETCNKQLNDALDAYKQAARLDPDNVHIRERLESLA 418

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 48/91 (52%), Gaps = 1/91 (1%)

Query: 110 KDKGNEFFKQKDYDNALKYYDYALTLK-KDPVFYSNISACYVSMNQLDKVVENSTKALEL 168
           K++GN   K +DY  A++ YD A+ L     V++SN + C++ ++      ++  KAL L
Sbjct: 13  KNEGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDKALAL 72

Query: 169 KPDYSKALLRRASANESLENYPDAMFDLSVL 199
            P   KA  RR  A   L  +  A  DL+V+
Sbjct: 73  DPKNVKAYHRRGLACVGLLEFKKARADLTVV 103

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 371 EFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQ--LACLA 428
           E +DKAI+LD   +  + +R   +     ++ A QD DKA  L+ +N+  Y +  LAC+ 
Sbjct: 30  EKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDKALALDPKNVKAYHRRGLACVG 89

Query: 429 YRENK 433
             E K
Sbjct: 90  LLEFK 94

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 2/76 (2%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALTLKKDP--VFYSNISACYVSMNQLDKVVENSTKAL 166
            K +GN  F  KDY  A+  +  A+ + + P  V YSN SACY S  + ++ ++++ + +
Sbjct: 6   FKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAEECV 65

Query: 167 ELKPDYSKALLRRASA 182
           ++ P +SK   R  +A
Sbjct: 66  KISPSWSKGYNRVGAA 81

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 50/88 (56%), Gaps = 1/88 (1%)

Query: 112 KGNEFFKQKDYDNALK-YYDYALTLKKDPVFYSNISACYVSMNQLDKVVENSTKALELKP 170
           +G EFF + D+ NA+K Y +      +D   +SN +A    +    + +E+  KA+ + P
Sbjct: 386 QGKEFFTKGDWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCNKAVSIDP 445

Query: 171 DYSKALLRRASANESLENYPDAMFDLSV 198
           ++ +A +R+A+A  +++ +  A+  L++
Sbjct: 446 NFVRAYIRKATAQIAVKEFAAAIETLNI 473

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 46/85 (54%), Gaps = 2/85 (2%)

Query: 110 KDKGNEFFKQKDYDNALKYYDYALTLKKDP--VFYSNISACYVSMNQLDKVVENSTKALE 167
           K +GN  F  K YD A+  +  A+ + + P  V YSN SA Y S  + ++ ++++ +  +
Sbjct: 9   KQQGNSAFAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQKFNEALKDALECTK 68

Query: 168 LKPDYSKALLRRASANESLENYPDA 192
           + P ++K   R  +A+  + N  DA
Sbjct: 69  INPSWAKGYTREGAAHFGMGNLDDA 93

 Score = 38.1 bits (87), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 43/78 (55%), Gaps = 1/78 (1%)

Query: 113 GNEFFKQKDYDNALKYYDYAL-TLKKDPVFYSNISACYVSMNQLDKVVENSTKALELKPD 171
           G E+F + D+ +A+K Y   +    +D   YSN +A    +      + +  KA+E  P+
Sbjct: 392 GKEYFTKGDWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDCNKAIEKDPN 451

Query: 172 YSKALLRRASANESLENY 189
           + +A +R+A+A  +++++
Sbjct: 452 FVRAYIRKATAQIAVKDF 469

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 46/87 (52%), Gaps = 1/87 (1%)

Query: 108 ALKDKGNEFFKQKDYDNALKYYDYALT-LKKDPVFYSNISACYVSMNQLDKVVENSTKAL 166
             KD+GN     +DY  A++ Y  A++    DP++YSN S  Y+ +N  +  + ++   +
Sbjct: 139 TFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCI 198

Query: 167 ELKPDYSKALLRRASANESLENYPDAM 193
            +  ++SKA +R A+       Y DA+
Sbjct: 199 SIDANFSKAYIRLANIKVQQHQYIDAL 225

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 43/76 (56%), Gaps = 2/76 (2%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALTLKKDP--VFYSNISACYVSMNQLDKVVENSTKAL 166
            K +GN  F  KDY+ A + +  A+   + P  V YSN SAC+ S+ + ++ + ++ + +
Sbjct: 6   FKKQGNAAFVAKDYEKASELFTKAIEASEAPNHVLYSNRSACFTSLKKFNEALNDANECV 65

Query: 167 ELKPDYSKALLRRASA 182
           ++ P +SK   R  +A
Sbjct: 66  KINPAWSKGYNRVGAA 81

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 52/93 (55%), Gaps = 7/93 (7%)

Query: 108 ALKDKGNEFFKQKDYDNALKYYDYALTLKKDPVFYSNISACYVSMNQLDKVVENSTKAL- 166
           A K +GN+F+K + +D A+++Y+ A  L KD  + +N SA        ++ ++  T+A+ 
Sbjct: 269 AEKAEGNKFYKARKFDEAIEHYNKAWDLHKDVTYLNNRSAAEYEKGDYEQAIKTLTEAVE 328

Query: 167 ---ELKPDY---SKALLRRASANESLENYPDAM 193
              E++ DY   SK+  R  +A   LE++  A+
Sbjct: 329 QGREMRADYKLISKSFARIGNAYLKLEDFKKAI 361

 Score = 37.7 bits (86), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 45/86 (52%), Gaps = 1/86 (1%)

Query: 112 KGNEFFKQKDYDNALK-YYDYALTLKKDPVFYSNISACYVSMNQLDKVVENSTKALELKP 170
           +G E+F + D+ NA+K Y +      +D   YSN +A    +    + +++   A+   P
Sbjct: 407 QGKEYFTKGDWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDCDMAISKDP 466

Query: 171 DYSKALLRRASANESLENYPDAMFDL 196
           ++ +A +R+A+A  ++  +  A+  L
Sbjct: 467 NFIRAYIRKATAQIAVREFASAIETL 492

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 1/59 (1%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALTL-KKDPVFYSNISACYVSMNQLDKVVENSTKAL 166
           LK KGN FFK  DY+ A+ YY+ A  L   +P+++SN++   + + +  + V    K L
Sbjct: 44  LKVKGNTFFKNGDYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEAVNACDKGL 102

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 52/106 (49%), Gaps = 3/106 (2%)

Query: 97  MSEEQKESWSTALK--DKGNEFFKQKDYDNALKYYDYALTL-KKDPVFYSNISACYVSMN 153
           MS   K     ALK  D+GN + K +DY  A++ Y  A+ L     +FYSN +  ++ ++
Sbjct: 1   MSNPSKPDAEAALKFKDEGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLD 60

Query: 154 QLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVL 199
                + +   A++L  +  KA  RR  A   L  +  A  DL++L
Sbjct: 61  NFQSALHDCNDAIKLDNNNIKAYHRRGLAYVGLLEFRKAKNDLTIL 106

>ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]
           {ON} highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 974

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 58/127 (45%), Gaps = 17/127 (13%)

Query: 372 FFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRE 431
           F  K++++DP +A  +YH G+++ I + Y  A   F +A   +  N   +  +  L Y+ 
Sbjct: 292 FLSKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQI 351

Query: 432 NKFDDCETLFSEAKRKFATAPEVPNFFAEILADKG--------DLEKALKQYDIAKRLEE 483
           +++ D    ++ A R       +  + +E+  D G         L  AL  Y  A RL+ 
Sbjct: 352 SQYRDALDAYTRAIR-------LNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLDP 404

Query: 484 AVDGIHV 490
             + +H+
Sbjct: 405 --ENMHI 409

 Score = 34.7 bits (78), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 50/114 (43%), Gaps = 10/114 (8%)

Query: 314 EKDAIALEHRGIFRFLKN----DPLGAHEDVQKAIDLHPR-VNSYIYMALIMADKGKAEE 368
           E  A  L+  G    + N    DP  A   + K++++ P    ++ ++  +   +     
Sbjct: 263 EHHAKVLQQLGCLYGMNNVQFYDPQKALSFLSKSLEVDPSDATTWYHLGRVHMIRSDYTA 322

Query: 369 YYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYI 422
            Y+ F +A+  D +N   +   G +Y+  +QY  A   + +A +LN     PYI
Sbjct: 323 AYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLN-----PYI 371

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 53/98 (54%), Gaps = 2/98 (2%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYAL-TLKKDPVFYSNISACYVSMNQLDKVVENSTKALE 167
           LK +GN+    KD+D A+K Y  A+  L  + V+Y+N +A + SM   ++ ++++  A++
Sbjct: 100 LKLEGNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIK 159

Query: 168 LKPDYSKALLRRASANESLENYPDAMFDL-SVLSLNGD 204
             P YSK   R   A  +L    DA+     VL + GD
Sbjct: 160 TDPTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGD 197

>Suva_4.361 Chr4
           complement(631697..632812,632933..633154,633188..634741)
           [2892 bp, 963 aa] {ON} YBR112C (REAL)
          Length = 963

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 58/128 (45%), Gaps = 17/128 (13%)

Query: 371 EFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYR 430
           ++  K+++ DP +A  +YH G+++ I   Y  A   F +A   +  N   +  +  L Y+
Sbjct: 287 DYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQ 346

Query: 431 ENKFDDCETLFSEAKRKFATAPEVPNFFAEILADKG--------DLEKALKQYDIAKRLE 482
            +++ D    ++ A R       +  + +E+  D G         L  AL  Y  A RL+
Sbjct: 347 ISQYRDALDAYTRAIR-------LNPYISEVWYDLGTLYETCNNQLSDALDAYKQAARLD 399

Query: 483 EAVDGIHV 490
             V+ IH+
Sbjct: 400 --VNNIHI 405

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 26/117 (22%), Positives = 51/117 (43%), Gaps = 10/117 (8%)

Query: 311 ALKEKDAIALEHRGIFRFLKN----DPLGAHEDVQKAIDLHPR-VNSYIYMALIMADKGK 365
           A  +  A  L+  G    + N    DP  A + + K+++  P    ++ ++  +   +  
Sbjct: 256 AQNQHHAKVLQQLGCLYGMSNVQFYDPQKALDYLLKSLEADPSDATTWYHLGRVHMIRTD 315

Query: 366 AEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYI 422
               Y+ F +A+  D +N   +   G +Y+  +QY  A   + +A +LN     PYI
Sbjct: 316 YTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLN-----PYI 367

>KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.367
           YBR112C
          Length = 887

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 57/127 (44%), Gaps = 17/127 (13%)

Query: 372 FFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRE 431
           +  K++++DP +A  +YH G+++ I + Y  A   F +A   +  N   +  +  L Y+ 
Sbjct: 292 YLLKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQI 351

Query: 432 NKFDDCETLFSEAKRKFATAPEVPNFFAEILADKG--------DLEKALKQYDIAKRLEE 483
           +++ D    ++ A R          + +E+  D G         L  AL  Y  A RL+ 
Sbjct: 352 SQYRDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLTDALDAYRQASRLDP 404

Query: 484 AVDGIHV 490
             D +H+
Sbjct: 405 --DNVHI 409

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 49/111 (44%), Gaps = 10/111 (9%)

Query: 317 AIALEHRGIFRFLKN----DPLGAHEDVQKAIDLHPR-VNSYIYMALIMADKGKAEEYYE 371
           A  L+  G    + N    DP  A   + K++++ P    ++ ++  +   +      Y+
Sbjct: 266 AKVLQQLGCLYGMNNVQFYDPQKALNYLLKSLEVDPSDATTWYHLGRVHMIRSDYTAAYD 325

Query: 372 FFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYI 422
            F +A+  D +N   +   G +Y+  +QY  A   + +A +LN     PYI
Sbjct: 326 AFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLN-----PYI 371

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 48/92 (52%), Gaps = 1/92 (1%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALTLKKD-PVFYSNISACYVSMNQLDKVVENSTKALE 167
            K++GN+  K +DY  A++ Y  A+ L     +++SN +  ++ M+     + +  KALE
Sbjct: 15  FKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCDKALE 74

Query: 168 LKPDYSKALLRRASANESLENYPDAMFDLSVL 199
           + P   KA  RR  +   L  + +A  DL ++
Sbjct: 75  IDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIV 106

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (61%)

Query: 374 DKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDF 407
           DKA+++DPKN   Y+ RG  Y    +++ A +D 
Sbjct: 70  DKALEIDPKNIKAYHRRGMSYIGLLEFKNAQKDL 103

>Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {ON}
           YBR112C (REAL)
          Length = 1020

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 58/128 (45%), Gaps = 17/128 (13%)

Query: 371 EFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYR 430
           ++  K+++ DP +A  +YH G+++ I   Y  A   F +A   +  N   +  +  L Y+
Sbjct: 285 DYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQ 344

Query: 431 ENKFDDCETLFSEAKRKFATAPEVPNFFAEILADKG--------DLEKALKQYDIAKRLE 482
            +++ D    ++ A R       +  + +E+  D G         L  AL  Y  A RL+
Sbjct: 345 ISQYRDALDAYTRAIR-------LNPYISEVWYDLGTLYETCNNQLSDALDAYKQAARLD 397

Query: 483 EAVDGIHV 490
             V+ +H+
Sbjct: 398 --VNNVHI 403

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 26/117 (22%), Positives = 51/117 (43%), Gaps = 10/117 (8%)

Query: 311 ALKEKDAIALEHRGIFRFLKN----DPLGAHEDVQKAIDLHPR-VNSYIYMALIMADKGK 365
           A  +  A  L+  G    + N    DP  A + + K+++  P    ++ ++  +   +  
Sbjct: 254 AQNQHHAKVLQQLGCLYGMSNVQFYDPQKALDYLLKSLEADPSDATTWYHLGRVHMIRTD 313

Query: 366 AEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYI 422
               Y+ F +A+  D +N   +   G +Y+  +QY  A   + +A +LN     PYI
Sbjct: 314 YTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLN-----PYI 365

>YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}
           CYC8General transcriptional co-repressor, acts together
           with Tup1p; also acts as part of a transcriptional
           co-activator complex that recruits the SWI/SNF and SAGA
           complexes to promoters; can form the prion [OCT+]
          Length = 966

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 58/128 (45%), Gaps = 17/128 (13%)

Query: 371 EFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYR 430
           ++  K+++ DP +A  +YH G+++ I   Y  A   F +A   +  N   +  +  L Y+
Sbjct: 283 DYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQ 342

Query: 431 ENKFDDCETLFSEAKRKFATAPEVPNFFAEILADKG--------DLEKALKQYDIAKRLE 482
            +++ D    ++ A R       +  + +E+  D G         L  AL  Y  A RL+
Sbjct: 343 ISQYRDALDAYTRAIR-------LNPYISEVWYDLGTLYETCNNQLSDALDAYKQAARLD 395

Query: 483 EAVDGIHV 490
             V+ +H+
Sbjct: 396 --VNNVHI 401

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 26/117 (22%), Positives = 51/117 (43%), Gaps = 10/117 (8%)

Query: 311 ALKEKDAIALEHRGIFRFLKN----DPLGAHEDVQKAIDLHPR-VNSYIYMALIMADKGK 365
           A  +  A  L+  G    + N    DP  A + + K+++  P    ++ ++  +   +  
Sbjct: 252 AQNQHHAKVLQQLGCLYGMSNVQFYDPQKALDYLLKSLEADPSDATTWYHLGRVHMIRTD 311

Query: 366 AEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYI 422
               Y+ F +A+  D +N   +   G +Y+  +QY  A   + +A +LN     PYI
Sbjct: 312 YTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLN-----PYI 363

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 49/97 (50%), Gaps = 5/97 (5%)

Query: 106 STALKDKGNEFFKQKDYDNALKYYDYALTLKKDP---VFYSNISACYVSMNQLDKVVENS 162
           +   K++GN F K+++Y  A++ Y  A+ L  DP   +FYSN +   + ++       + 
Sbjct: 12  AVEFKNEGNVFIKEQNYSKAIELYTKAIEL--DPNQSIFYSNRALAQLKLDNFQSAYNDC 69

Query: 163 TKALELKPDYSKALLRRASANESLENYPDAMFDLSVL 199
            +AL L     KA  RR  AN  L  +  A  DL+V+
Sbjct: 70  NEALTLDSKNVKAYHRRGLANVGLLEFKRARNDLNVV 106

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 50/97 (51%), Gaps = 9/97 (9%)

Query: 106 STALKDKGNEFFKQKDYDNALKYYDYALTL--KKDPVFYSNISACYVSMNQLDKVVENST 163
           S  LK+ GN+ +K+K Y+ A+ Y+  AL+       + YSN +A ++ +    + +E+  
Sbjct: 8   SQELKELGNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGK 67

Query: 164 KALELKPDYSKALLRRASA-------NESLENYPDAM 193
             +EL P++ K   R   A       +E+ EN+  A+
Sbjct: 68  NCVELAPNWDKGYSRVGVAYLGLQKLDEAEENFKKAL 104

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 43/85 (50%), Gaps = 8/85 (9%)

Query: 113 GNEFFKQKDYDNALKYYDYAL-TLKKDPVFYSNISACYVSMNQLDKVVENSTKALELKPD 171
           G + F  ++Y  A+K Y   + T    PV + N +A +  +    +V+++  KA+ + P 
Sbjct: 436 GKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKAISVDPS 495

Query: 172 YSKALLRRASA-------NESLENY 189
           Y KA +R+  A       +E+LE +
Sbjct: 496 YIKAYVRKGFAQITERDLDEALETW 520

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 36/62 (58%), Gaps = 1/62 (1%)

Query: 108 ALKDKGNEFFKQKDYDNALKYYDYALTL-KKDPVFYSNISACYVSMNQLDKVVENSTKAL 166
            LK KGN FFK+ DY+ A+ YY  A+T    +P+ YSN +   + + +  + V+   K L
Sbjct: 6   TLKAKGNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDACNKGL 65

Query: 167 EL 168
           ++
Sbjct: 66  KM 67

>Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON}
           YBR112C (REAL)
          Length = 984

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 58/128 (45%), Gaps = 17/128 (13%)

Query: 371 EFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYR 430
           ++  K+++ DP +A  +YH G+++ I   Y  A   F +A   +  N   +  +  L Y+
Sbjct: 277 DYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQ 336

Query: 431 ENKFDDCETLFSEAKRKFATAPEVPNFFAEILADKG--------DLEKALKQYDIAKRLE 482
            +++ D    ++ A R       +  + +E+  D G         L  AL  Y  A RL+
Sbjct: 337 ISQYRDALDAYTRAIR-------LNPYISEVWYDLGTLYETCNNQLSDALDAYKQAARLD 389

Query: 483 EAVDGIHV 490
             V+ +H+
Sbjct: 390 --VNNVHI 395

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 26/117 (22%), Positives = 51/117 (43%), Gaps = 10/117 (8%)

Query: 311 ALKEKDAIALEHRGIFRFLKN----DPLGAHEDVQKAIDLHPR-VNSYIYMALIMADKGK 365
           A  +  A  L+  G    + N    DP  A + + K+++  P    ++ ++  +   +  
Sbjct: 246 AQNQHHAKVLQQLGCLYGMSNVQFYDPQKALDYLLKSLEADPSDATTWYHLGRVHMIRTD 305

Query: 366 AEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYI 422
               Y+ F +A+  D +N   +   G +Y+  +QY  A   + +A +LN     PYI
Sbjct: 306 YTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLN-----PYI 357

>KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.367
           YBR112C
          Length = 973

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 58/127 (45%), Gaps = 17/127 (13%)

Query: 372 FFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRE 431
           +  K++++DP +A  +YH G+++ + + Y  A   F +A   +  N   +  +  L Y+ 
Sbjct: 303 YLLKSLEVDPSDATTWYHLGRVHMVRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQI 362

Query: 432 NKFDDCETLFSEAKRKFATAPEVPNFFAEILADKG--------DLEKALKQYDIAKRLEE 483
           +++ D    ++ A R       +  + +E+  D G         L  AL  Y  A RL+ 
Sbjct: 363 SQYRDALDAYTRAIR-------LNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLDP 415

Query: 484 AVDGIHV 490
             + IH+
Sbjct: 416 --ENIHI 420

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 55/129 (42%), Gaps = 10/129 (7%)

Query: 299 YAKLREGNSDDAALKEKDAIALEHRGIFRFLKN----DPLGAHEDVQKAIDLHPR-VNSY 353
           +A  R+   +     E  A  L+  G    + N    DP  A   + K++++ P    ++
Sbjct: 259 WANARDAYENVLVQNEHHAKVLQQLGCLYGMNNVQFYDPQKALNYLLKSLEVDPSDATTW 318

Query: 354 IYMALIMADKGKAEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQL 413
            ++  +   +      Y+ F +A+  D +N   +   G +Y+  +QY  A   + +A +L
Sbjct: 319 YHLGRVHMVRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRL 378

Query: 414 NEENIFPYI 422
           N     PYI
Sbjct: 379 N-----PYI 382

 Score = 34.7 bits (78), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 51/108 (47%), Gaps = 6/108 (5%)

Query: 316 DAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKAEEYYEFFD- 374
           DA    H G    +++D   A++  Q+A++   R  + I+   I     +  +Y +  D 
Sbjct: 314 DATTWYHLGRVHMVRSDYTAAYDAFQQAVNRDSR--NPIFWCSIGVLYYQISQYRDALDA 371

Query: 375 --KAIKLDPKNAAVYYHRGQMY-FITAQYEKAGQDFDKAKQLNEENIF 419
             +AI+L+P  + V+Y  G +Y     Q   A   + +A +L+ ENI 
Sbjct: 372 YTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLDPENIH 419

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 44/72 (61%), Gaps = 1/72 (1%)

Query: 108 ALKDKGNEFFKQKDYDNA-LKYYDYALTLKKDPVFYSNISACYVSMNQLDKVVENSTKAL 166
           +LK +GN+    KD++ A LKY +    L  + V+Y+N +A + S+ + ++ V+++  A+
Sbjct: 99  SLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAI 158

Query: 167 ELKPDYSKALLR 178
           ++ P YSK   R
Sbjct: 159 KVNPSYSKGYSR 170

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 58/109 (53%), Gaps = 14/109 (12%)

Query: 104 SWSTALKDKGNEFFKQKDYDNALKYYDYALTL-KKDPVFYSNISACYVSMNQLDKVVENS 162
           S + +LK +GN+    KDY+ A+K Y  A+++   + V+Y+N +A + S+   D+ ++++
Sbjct: 91  SKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDA 150

Query: 163 TKALELKPDYSKALLR-------RASANESLENYPDAMFDLSVLSLNGD 204
             A+++   YSK   R       +  + E+LE Y        VL + GD
Sbjct: 151 ESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYK------KVLDIEGD 193

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 55/99 (55%), Gaps = 2/99 (2%)

Query: 108 ALKDKGNEFFKQKDYDNALKYYDYAL-TLKKDPVFYSNISACYVSMNQLDKVVENSTKAL 166
           A K +GN+    KD+  A++ Y  A+  L  + ++Y+N +A + S+ + ++ ++++  A+
Sbjct: 103 AFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAI 162

Query: 167 ELKPDYSKALLRRASANESLENYPDAMFDL-SVLSLNGD 204
           ++ P YSK   R A A   L  + +A+     VL + GD
Sbjct: 163 KIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGD 201

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 56/123 (45%), Gaps = 26/123 (21%)

Query: 110 KDKGNEFFKQKDYDNALKYYDYAL-TLKKDP----VFYSNISACYVSMNQLDKVVENSTK 164
           KD+G EFFK  DY +A + Y+ +L +L ++     V YSN++A    + +  + + +   
Sbjct: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIES 336

Query: 165 ALELKPD---------------------YSKALLRRASANESLENYPDAMFDLSVLSLNG 203
           ALE+ P                      + K + RRA A E +ENY  A+ D   L    
Sbjct: 337 ALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIEKN 396

Query: 204 DFG 206
           +F 
Sbjct: 397 NFN 399

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 49/92 (53%), Gaps = 1/92 (1%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALTL-KKDPVFYSNISACYVSMNQLDKVVENSTKALE 167
           LK++GN F K++D+  A+  Y  A+ L     +++SN +  ++ ++     + +  +AL+
Sbjct: 15  LKNEGNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSSLNDCDEALK 74

Query: 168 LKPDYSKALLRRASANESLENYPDAMFDLSVL 199
           L P  +KA  RR  +   L  +  A  DL ++
Sbjct: 75  LDPKNAKAYHRRGLSYIGLLEFKKAKNDLQIV 106

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (64%)

Query: 374 DKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDF 407
           D+A+KLDPKNA  Y+ RG  Y    +++KA  D 
Sbjct: 70  DEALKLDPKNAKAYHRRGLSYIGLLEFKKAKNDL 103

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 52/104 (50%), Gaps = 14/104 (13%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYAL-TLKKDPVFYSNISACYVSMNQLDKVVENSTKALE 167
           LK +GN+    KDY+ A+  Y  A+  L  + ++Y+N +A + S+ + D+ V+++  A+ 
Sbjct: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164

Query: 168 LKPDYSKALLR-------RASANESLENYPDAMFDLSVLSLNGD 204
           + P Y +   R       +    E+LE Y        VL + GD
Sbjct: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYK------KVLDIEGD 202

>CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} similar
           to uniprot|P14922 Saccharomyces cerevisiae YBR112c CYC8
           general repressor of transcription
          Length = 1148

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 57/127 (44%), Gaps = 17/127 (13%)

Query: 372 FFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRE 431
           +  K++++DP +A  +YH G+++ I + Y  A   F +A   +  N   +  +  L Y+ 
Sbjct: 286 YLLKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQI 345

Query: 432 NKFDDCETLFSEAKRKFATAPEVPNFFAEILADKG--------DLEKALKQYDIAKRLEE 483
           +++ D    ++ A R          + +E+  D G         L  AL  Y  A RL+ 
Sbjct: 346 SQYRDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLSDALDAYKQAARLD- 397

Query: 484 AVDGIHV 490
             + IH+
Sbjct: 398 -PENIHI 403

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 51/108 (47%), Gaps = 6/108 (5%)

Query: 316 DAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKAEEYYEFFD- 374
           DA    H G    +++D   A++  Q+A++   R  + I+   I     +  +Y +  D 
Sbjct: 297 DATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSR--NPIFWCSIGVLYYQISQYRDALDA 354

Query: 375 --KAIKLDPKNAAVYYHRGQMY-FITAQYEKAGQDFDKAKQLNEENIF 419
             +AI+L+P  + V+Y  G +Y     Q   A   + +A +L+ ENI 
Sbjct: 355 YTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAYKQAARLDPENIH 402

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYAL-TLKKDPVFYSNISACYVSMNQLDKVVENSTKALE 167
           LK +GN+    KDY+ A+  Y  A+  L  + ++Y+N +A + S+   D+ VE++  A+ 
Sbjct: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164

Query: 168 LKPDYSKALLR 178
           + P Y +   R
Sbjct: 165 IDPTYFRGYSR 175

>Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W
           (REAL)
          Length = 111

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 110 KDKGNEFFKQKDYDNALKYYDYALTLK-KDPVFYSNISACYVSMNQLDKVVENSTKALEL 168
           K++GNE +KQ  Y +A+  YD  +  + ++PV +SN +   + + +  + +E   + L+L
Sbjct: 8   KEEGNELYKQGLYRDAIGCYDRLIAAQPQNPVGHSNKAMALIKLGEHAQAIEACQQGLQL 67

Query: 169 KPDYSKALLR 178
                 A LR
Sbjct: 68  AASPQHAALR 77

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 62/137 (45%), Gaps = 8/137 (5%)

Query: 97  MSEEQKESWSTAL--KDKGNEFFKQKDYDNALKYYDYALTL-KKDPVFYSNISACYVSMN 153
           MS    E  + AL  K++GN F K K++  A + Y  A+ L     +++SN +  ++ ++
Sbjct: 1   MSSASDEDVNKALEFKNQGNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLD 60

Query: 154 QLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVLSLNGDFGGSSIEPM 213
                + +  KA+EL P   KA  RR  +   L  +  A  DL ++           EP+
Sbjct: 61  NFQTALNDCNKAIELDPKNVKAYHRRGLSYIGLLEFNKARKDLKIV-----LRAKPNEPV 115

Query: 214 LERNLNKQAMTVLKDKL 230
             R L+     + K+K 
Sbjct: 116 ATRALDVCERVIRKEKF 132

 Score = 34.3 bits (77), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 21/34 (61%)

Query: 374 DKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDF 407
           +KAI+LDPKN   Y+ RG  Y    ++ KA +D 
Sbjct: 70  NKAIELDPKNVKAYHRRGLSYIGLLEFNKARKDL 103

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 60/118 (50%), Gaps = 16/118 (13%)

Query: 97  MSEEQKESWSTA--LKDKGNEFFKQKDYDNALKYYDYAL-TLKKDPVFYSNISACYVSMN 153
           + EE  E+ + A  LK +GN+    K+Y+ A+K Y  A+  L  + ++Y+N +A + S+ 
Sbjct: 91  IPEEDAETKAKAEELKIQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLK 150

Query: 154 QLDKVVENSTKALELKPDYSKALLR-------RASANESLENYPDAMFDLSVLSLNGD 204
           + D+ ++++  A+ + P Y +   R       +    E+LE Y        VL + GD
Sbjct: 151 EYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEAYK------KVLDIEGD 202

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 45/72 (62%), Gaps = 1/72 (1%)

Query: 108 ALKDKGNEFFKQKDYDNALKYYDYAL-TLKKDPVFYSNISACYVSMNQLDKVVENSTKAL 166
           ALK +GN+    KD+++A+  Y  A+ TL  + V+++N +A Y S+ +  + VE++  A+
Sbjct: 100 ALKLEGNKAMATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAI 159

Query: 167 ELKPDYSKALLR 178
           ++ P YSK   R
Sbjct: 160 KVNPSYSKGYSR 171

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 48/85 (56%), Gaps = 3/85 (3%)

Query: 97  MSEEQKESWSTA--LKDKGNEFFKQKDYDNALKYYDYAL-TLKKDPVFYSNISACYVSMN 153
           + EE  E+ + A  LK +GN+    KDY+ A+  Y  A+  L  + ++Y+N +A + S+ 
Sbjct: 91  IPEEDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLR 150

Query: 154 QLDKVVENSTKALELKPDYSKALLR 178
           + D+ V+++  ++ + P Y +   R
Sbjct: 151 EYDEAVKDAESSISIDPSYFRGYSR 175

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 53/104 (50%), Gaps = 26/104 (25%)

Query: 112 KGNEFFKQKDYDNALKYYDYAL-TLKKDP----VFYSNISACYVSMNQLDKVVENSTKAL 166
           +G+ FFK  DY +AL+ Y+ +L TL +      + YSNI+A  + + +   +V+ + KAL
Sbjct: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422

Query: 167 ELKPD---------------------YSKALLRRASANESLENY 189
           +L P                      +SK +LR+A A E LEN+
Sbjct: 423 KLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENF 466

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 43/89 (48%), Gaps = 5/89 (5%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALTLKKDP-----VFYSNISACYVSMNQLDKVVENST 163
            K++GNE +K K Y +A + Y+  + +K D        +SN +AC + +    + V +  
Sbjct: 81  FKNQGNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELELKNYRRCVNDCR 140

Query: 164 KALELKPDYSKALLRRASANESLENYPDA 192
           +AL+  P   K   R A A   L+   DA
Sbjct: 141 QALQFNPTNIKCFYRIARAFFLLDKCEDA 169

>NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa]
           {ON} Anc_3.367
          Length = 907

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/127 (22%), Positives = 57/127 (44%), Gaps = 17/127 (13%)

Query: 372 FFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRE 431
           +  K++++DP ++  +YH G+++ I   Y  A   F +A   +  N   +  +  L Y+ 
Sbjct: 294 YLLKSLEVDPNDSTTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQI 353

Query: 432 NKFDDCETLFSEAKRKFATAPEVPNFFAEILADKG--------DLEKALKQYDIAKRLEE 483
           +++ D    ++ A R       +  + +E+  D G         L  AL  Y  A RL+ 
Sbjct: 354 SQYRDALDAYTRAIR-------LNPYISEVWYDLGTLYETCNNQLNDALDAYKQAARLDP 406

Query: 484 AVDGIHV 490
             + +H+
Sbjct: 407 --ENVHI 411

 Score = 35.8 bits (81), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 51/108 (47%), Gaps = 6/108 (5%)

Query: 316 DAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKAEEYYEFFD- 374
           D+    H G    ++ND   A++  Q+A++   R  + I+   I     +  +Y +  D 
Sbjct: 305 DSTTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSR--NPIFWCSIGVLYYQISQYRDALDA 362

Query: 375 --KAIKLDPKNAAVYYHRGQMY-FITAQYEKAGQDFDKAKQLNEENIF 419
             +AI+L+P  + V+Y  G +Y     Q   A   + +A +L+ EN+ 
Sbjct: 363 YTRAIRLNPYISEVWYDLGTLYETCNNQLNDALDAYKQAARLDPENVH 410

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 50/114 (43%), Gaps = 10/114 (8%)

Query: 314 EKDAIALEHRGIFRFLKN----DPLGAHEDVQKAIDLHPR-VNSYIYMALIMADKGKAEE 368
           E  A  L+  G    + N    DP  A   + K++++ P    ++ ++  +   +     
Sbjct: 265 ENHAKVLQQLGCLYGMNNVSFYDPQKALNYLLKSLEVDPNDSTTWYHLGRVHMIRNDYTA 324

Query: 369 YYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYI 422
            Y+ F +A+  D +N   +   G +Y+  +QY  A   + +A +LN     PYI
Sbjct: 325 AYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLN-----PYI 373

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 51/104 (49%), Gaps = 1/104 (0%)

Query: 97  MSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTL-KKDPVFYSNISACYVSMNQL 155
           M  ++    +   K++GN + K+K Y  A++YY  A+ L     +++SN +   + ++  
Sbjct: 1   MVTQEAAQQALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNF 60

Query: 156 DKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVL 199
               E+  KA+ L P   KA+ RR  +   L  +  A  DL V+
Sbjct: 61  LTAQEDCDKAIALDPKNIKAIHRRGLSYVGLLEFFKARKDLRVV 104

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 2/63 (3%)

Query: 374 DKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQL--NEENIFPYIQLACLAYRE 431
           DKAI LDPKN    + RG  Y    ++ KA +D     Q+  NE++    +++     RE
Sbjct: 68  DKAIALDPKNIKAIHRRGLSYVGLLEFFKARKDLRVVLQVKPNEQSALKALEVCEKFIRE 127

Query: 432 NKF 434
            KF
Sbjct: 128 EKF 130

>Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {ON}
           YDR320C (REAL)
          Length = 667

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 52/111 (46%), Gaps = 26/111 (23%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALT--LKKDP---VFYSNISACYVSMNQLDKVVENST 163
            K KG+ FFK  DY N+L+ Y+ +L       P   +  SNI A  + + +  K +ENS+
Sbjct: 377 FKAKGSNFFKNGDYVNSLQEYEKSLNSLPSNHPLRIIALSNIIASQLKVGEYSKSIENSS 436

Query: 164 KALELKPD---------------------YSKALLRRASANESLENYPDAM 193
            AL L P                      + K ++RRA + E LE++ +A+
Sbjct: 437 MALALFPPTKANWSNMISDSDPQRSFNDIWPKIMIRRAESFEHLESFSNAL 487

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 55/106 (51%), Gaps = 3/106 (2%)

Query: 97  MSEEQKESWSTAL--KDKGNEFFKQKDYDNALKYYDYALTL-KKDPVFYSNISACYVSMN 153
           MS   +   + AL  K++GN F K+K +  A++ Y  A+ L     +++SN +  +  ++
Sbjct: 1   MSNPTEADRANALERKNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVD 60

Query: 154 QLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVL 199
                + +  +AL+L P   KA  RRA +  +L  +  A  DL+VL
Sbjct: 61  NFQSALNDCDEALKLDPKNIKAYHRRALSCMALLEFKKAKKDLTVL 106

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 41/86 (47%), Gaps = 5/86 (5%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALTLKKD-----PVFYSNISACYVSMNQLDKVVENST 163
            K++GNEF+K K Y +A + Y   + +K D        Y+N +AC + +    K +E+  
Sbjct: 77  FKNRGNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNFRKCIEDCK 136

Query: 164 KALELKPDYSKALLRRASANESLENY 189
           KAL       K   R   A  S++ +
Sbjct: 137 KALSFNVKNIKCYYRMGKAFLSVDRF 162

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 50/109 (45%), Gaps = 26/109 (23%)

Query: 107 TALKDKGNEFFKQKDYDNALKYYDYALTL--KKDP---VFYSNISACYVSMNQLDKVVEN 161
           T  +  G EFFK+ DYD+AL  Y  +L    +K P   + YSNI A  + + +  + V++
Sbjct: 547 TEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKD 606

Query: 162 STKALELKPD---------------------YSKALLRRASANESLENY 189
              ALEL P                      + K +LR+A A E +E Y
Sbjct: 607 CDVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKY 655

>NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {ON}
           Anc_5.352 YDR320C
          Length = 706

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 60/130 (46%), Gaps = 29/130 (22%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYAL-TLKK-DP---VFYSNISACYVSMNQLDKVVENST 163
            K +G+E FK  DY +AL+ Y+ +L TL +  P   + YSNI A  + + +  K +E+  
Sbjct: 417 FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCK 476

Query: 164 KALELKPD-----------------------YSKALLRRASANESLENYPDAMFDLSVLS 200
            AL L P                        +SK ++R+A + E LENY  A+     L 
Sbjct: 477 IALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALDSYQKLI 536

Query: 201 LNGDFGGSSI 210
            NG F  S I
Sbjct: 537 ENG-FTNSKI 545

>YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}
           SWA2Auxilin-like protein involved in vesicular
           transport; clathrin-binding protein required for
           uncoating of clathrin-coated vesicles
          Length = 668

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 52/111 (46%), Gaps = 26/111 (23%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYAL-TLK-KDP---VFYSNISACYVSMNQLDKVVENST 163
            K KG   FK  DY N+L+ Y+ +L TL    P   +  SNI A  + + +  K +ENS+
Sbjct: 377 FKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENSS 436

Query: 164 KALELKPD---------------------YSKALLRRASANESLENYPDAM 193
            ALEL P                      + K ++RRA + E LE++  A+
Sbjct: 437 MALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKAL 487

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 53/118 (44%), Gaps = 6/118 (5%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALTL-----KKDPVFYSNISACYVSMNQLDKVVENST 163
            K +GNE +K K Y NA   Y+  + +     K + + + N +AC + M      + +  
Sbjct: 77  FKKQGNEAYKLKQYRNARVLYERGIEVNCNNDKINELLFVNKAACELEMKNYRSCINDCK 136

Query: 164 KALELKPDYSKALLRRASANESLENYPDAMFDLSVLSLNGDFGGSSIEPMLERNLNKQ 221
           KAL   P   K   R A A  ++E Y ++   +    L  D   SS+  +L+  + KQ
Sbjct: 137 KALSFNPLNVKCYFRMAKAFSAIEKYDESRESIE-FGLKVDSRNSSLLNLLKTIIKKQ 193

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 44/89 (49%), Gaps = 5/89 (5%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALTLKKD-----PVFYSNISACYVSMNQLDKVVENST 163
            K++GN+ +K K + +A + Y+ A+ +K D        Y+N +AC + +    + + +  
Sbjct: 77  FKNQGNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACELELKNYRRCINDCK 136

Query: 164 KALELKPDYSKALLRRASANESLENYPDA 192
            AL L P   K   R A A  ++E + D 
Sbjct: 137 MALSLNPKNIKCYFRMAKAFLAIEKFDDC 165

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 32/71 (45%), Gaps = 4/71 (5%)

Query: 371 EFFDKAIKL----DPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLAC 426
           E ++KAI +    D  N ++Y +R         Y +   D   A  LN +NI  Y ++A 
Sbjct: 95  ELYNKAIDVKCDDDKINESLYANRAACELELKNYRRCINDCKMALSLNPKNIKCYFRMAK 154

Query: 427 LAYRENKFDDC 437
                 KFDDC
Sbjct: 155 AFLAIEKFDDC 165

>KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON}
           Anc_5.352 YDR320C
          Length = 585

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 54/121 (44%), Gaps = 26/121 (21%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALTL--KKDP---VFYSNISACYVSMNQLDKVVENST 163
            + KG E FK+ DY  A+  Y+ +L    +K P   +  SN+   Y+ + +  K ++ + 
Sbjct: 293 FRAKGTELFKKGDYSAAVLEYEKSLNTLPEKHPLRIIAMSNMMLPYLKIGEYTKCLKLAP 352

Query: 164 KALELKPD---------------------YSKALLRRASANESLENYPDAMFDLSVLSLN 202
            ALEL P+                     +SK ++R A A E  ENY  A  +  +L  N
Sbjct: 353 LALELIPEDRSTWRSVIQQSEPKRTYRDIWSKLVMRLAEAQEHAENYTGAFDNYQLLVAN 412

Query: 203 G 203
           G
Sbjct: 413 G 413

>TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6.328
           YCR060W
          Length = 124

 Score = 38.1 bits (87), Expect = 0.012,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 30/47 (63%), Gaps = 1/47 (2%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALTLK-KDPVFYSNISACYVSMNQ 154
           LK +GN  ++Q+DY  AL++YD  L     +P+ +SN + C + +N+
Sbjct: 7   LKAQGNSCYQQQDYAGALRWYDQCLEADATNPIAHSNRAMCLIKLNR 53

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 52/94 (55%), Gaps = 5/94 (5%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALTLKKDP---VFYSNISACYVSMNQLDKVVENSTKA 165
           LK++GN+F K+K Y  A +YY  A  ++ DP   + YSN +   + ++     ++++ +A
Sbjct: 16  LKNEGNKFVKEKLYAKAAEYYTKA--IEHDPENTILYSNRAFTNLKLDNFQSSLDDAKRA 73

Query: 166 LELKPDYSKALLRRASANESLENYPDAMFDLSVL 199
           +EL  +  KA  RRA +   L  +  A  DL ++
Sbjct: 74  IELDNNNLKAYHRRAMSYIGLLEFRKARKDLIIV 107

>Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)
           [1254 nt, 418 aa]
          Length = 418

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 49/112 (43%), Gaps = 15/112 (13%)

Query: 378 KLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRENKFDDC 437
           ++DP +AA +YH G+++ I   Y  A   F +A   +  N   +  +  L Y+ +++ D 
Sbjct: 307 EIDPSDAATWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA 366

Query: 438 ETLFSEAKRKFATAPEVPNFFAEILADKG--------DLEKALKQYDIAKRL 481
              ++ A R       +  + +E+  D G         L  AL  Y  A RL
Sbjct: 367 LDAYTRAIR-------LNPYISEVWYDLGTLYETCNNQLSDALDAYKQAARL 411

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 41/80 (51%), Gaps = 5/80 (6%)

Query: 108 ALKDKGNEFFKQKDYDNALKYYDYALTLKKDPVF-----YSNISACYVSMNQLDKVVENS 162
             K +GNE +K K + +A + Y   L ++ +  F     ++N +AC + +    + +E+ 
Sbjct: 85  GFKKQGNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELKNYRRCIEDC 144

Query: 163 TKALELKPDYSKALLRRASA 182
           +KAL + P  +K   R + A
Sbjct: 145 SKALSINPKNTKCYYRTSKA 164

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 49/91 (53%), Gaps = 1/91 (1%)

Query: 110 KDKGNEFFKQKDYDNALKYYDYALTL-KKDPVFYSNISACYVSMNQLDKVVENSTKALEL 168
           K++GN F K+K +  A++ Y  A+ L     +++SN +  +  ++     + +  +A++L
Sbjct: 16  KNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEAIKL 75

Query: 169 KPDYSKALLRRASANESLENYPDAMFDLSVL 199
            P   KA  RRA +  +L  +  A  DL+VL
Sbjct: 76  DPKNIKAYHRRALSCMALLEFKKARKDLNVL 106

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 37.0 bits (84), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 1/67 (1%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALTLK-KDPVFYSNISACYVSMNQLDKVVENSTKALE 167
           LK +GN FF++ DY  A  YYD  + L+  +P+ YSN +   +        VE   + L+
Sbjct: 6   LKQEGNTFFQKGDYAQANGYYDQCIKLEPTNPIGYSNKAMSLIKQGNHGLAVETCQEGLK 65

Query: 168 LKPDYSK 174
                +K
Sbjct: 66  YTSSSTK 72

>SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]
           {ON} similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 573

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 51/89 (57%), Gaps = 2/89 (2%)

Query: 116 FFKQKDYDNALKYYDYALTLKK-DPVFYSNISACYVSMNQLDKVVENSTKALELKPDYSK 174
           F+  +DYD  +  +  ALT+K  D + ++ + A   + N+ ++ ++   +AL+LKP + +
Sbjct: 432 FYANEDYDKTIDCFKAALTVKPDDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVR 491

Query: 175 ALLRRASANESLENYPDAM-FDLSVLSLN 202
           A    A ++ ++  Y +A  + L+ LS++
Sbjct: 492 ARYNLAVSSMNIGCYKEAAEYLLTALSMH 520

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 39.3 bits (90), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 61/143 (42%), Gaps = 1/143 (0%)

Query: 341 QKAIDLHP-RVNSYIYMALIMADKGKAEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQ 399
           +KAI   P   N+Y  + ++    G+ EE   FF+KA  ++P N  +    G      + 
Sbjct: 586 RKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKARSINPINVVLVCCGGVALEKLSY 645

Query: 400 YEKAGQDFDKAKQLNEENIFPYIQLACLAYRENKFDDCETLFSEAKRKFATAPEVPNFFA 459
            EKA Q ++ A +L   +     + A L Y   ++      F E K        V     
Sbjct: 646 QEKALQYYELACELQPSSSLATFKRAHLLYSMGRYTLALKFFEELKHVAPDEATVHFLLG 705

Query: 460 EILADKGDLEKALKQYDIAKRLE 482
           +I +  G  + A+K+Y IA  L+
Sbjct: 706 QIYSILGRKKDAIKEYTIALNLD 728

>Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON}
           YDR320C (REAL)
          Length = 659

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 50/111 (45%), Gaps = 26/111 (23%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALT--LKKDP---VFYSNISACYVSMNQLDKVVENST 163
            K KG   FK  DY N+L+ Y+ +L     K P   +  SNI A  + + +  K +ENS 
Sbjct: 373 FKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSKSIENSD 432

Query: 164 KALELKPD---------------------YSKALLRRASANESLENYPDAM 193
            AL L P                      + K ++RRA + E LE++ +A+
Sbjct: 433 TALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNAL 483

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 54/106 (50%), Gaps = 3/106 (2%)

Query: 97  MSEEQKESWSTAL--KDKGNEFFKQKDYDNALKYYDYALTL-KKDPVFYSNISACYVSMN 153
           MS       + AL  K++GN F K+K +  A++ Y  A+ L     +++SN +  +  ++
Sbjct: 1   MSTPTASDCAKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVD 60

Query: 154 QLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVL 199
                + +  +A++L P   KA  RRA +  +L  +  A  DL+VL
Sbjct: 61  NFQSALNDCDEAIKLDPKNIKAYHRRALSCMALLEFKKAKKDLNVL 106

 Score = 31.2 bits (69), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 21/35 (60%)

Query: 374 DKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFD 408
           D+AIKLDPKN   Y+ R        +++KA +D +
Sbjct: 70  DEAIKLDPKNIKAYHRRALSCMALLEFKKAKKDLN 104

>TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.412
           YBL084C
          Length = 700

 Score = 38.9 bits (89), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 65/149 (43%), Gaps = 35/149 (23%)

Query: 373 FDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLAC------ 426
           + +A+  DP++   YY  G  Y    QY+KA   F+KA+ +N  N+   I + C      
Sbjct: 539 YRRALACDPQHYNAYYGLGMCYMKLGQYDKALLFFEKARNINPVNV---ILICCCGVALE 595

Query: 427 -LAYREN------------------KFDDCETLFSEAKRKFATAPEVPNF--FAEILADK 465
            L+Y+E                   KF     L+S A  +++ A E  NF   A++  D+
Sbjct: 596 KLSYQEKALQYYEQACELQPSSSLAKFKKAHLLYSMA--RYSAALE--NFEELAKLAPDE 651

Query: 466 GDLEKALKQ-YDIAKRLEEAVDGIHVGIS 493
             +   L Q Y I  R ++AV    V ++
Sbjct: 652 ATVHFLLGQLYQIMGRKKDAVKEFTVAMN 680

>TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {ON}
           Anc_3.367 YBR112C
          Length = 1189

 Score = 38.9 bits (89), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 51/121 (42%), Gaps = 17/121 (14%)

Query: 378 KLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRENKFDDC 437
           + DP +A  +YH G+++ I   Y  A   F +A   +  N   +  +  L Y+ +++ D 
Sbjct: 279 EFDPSDATTWYHLGRIHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA 338

Query: 438 ETLFSEAKRKFATAPEVPNFFAEILADKG--------DLEKALKQYDIAKRLEEAVDGIH 489
              ++ A R          + +E+  D G         L  AL  Y  A RL+   + +H
Sbjct: 339 LDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLTDALDAYKQAARLDP--ENVH 389

Query: 490 V 490
           +
Sbjct: 390 I 390

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 50/109 (45%), Gaps = 6/109 (5%)

Query: 315 KDAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKAEEYYEFFD 374
            DA    H G    ++ D   A++  Q+A++   R  + I+   I     +  +Y +  D
Sbjct: 283 SDATTWYHLGRIHMIRTDYTAAYDAFQQAVNRDSR--NPIFWCSIGVLYYQISQYRDALD 340

Query: 375 ---KAIKLDPKNAAVYYHRGQMY-FITAQYEKAGQDFDKAKQLNEENIF 419
              +AI+L+P  + V+Y  G +Y     Q   A   + +A +L+ EN+ 
Sbjct: 341 AYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLDPENVH 389

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 36.2 bits (82), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALTL-KKDPVFYSNISACYVSMNQLDKVVENSTKALE 167
           LK KGN  FK   Y  A+ +Y+  +++   +P+ YSN +   +  ++ D+ +    K L+
Sbjct: 6   LKAKGNISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKGLQ 65

Query: 168 L 168
           L
Sbjct: 66  L 66

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 36.2 bits (82), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 110 KDKGNEFFKQKDYDNALKYYDYALTLK-KDPVFYSNISACYVSMNQLDKVVENSTKAL 166
           K++GN  FKQ  Y  A+  YD  +T + ++PV YSN +   + + +  + ++   + L
Sbjct: 8   KEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGL 65

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 38.5 bits (88), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 45/91 (49%), Gaps = 1/91 (1%)

Query: 110 KDKGNEFFKQKDYDNALKYYDYALTL-KKDPVFYSNISACYVSMNQLDKVVENSTKALEL 168
           KD+GN+F K++D+  A + Y  A+ L     +F+SN +  ++  +     + +  KALEL
Sbjct: 16  KDQGNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDCDKALEL 75

Query: 169 KPDYSKALLRRASANESLENYPDAMFDLSVL 199
                KA  RR  +   L  +  A  DL  +
Sbjct: 76  DSKNIKAYHRRGLSYVGLLEFKKARTDLKTV 106

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 38.5 bits (88), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 61/136 (44%), Gaps = 15/136 (11%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALTLKK-----DPVFYSNISACYVSMNQLDKVVENST 163
            K +GNE +K K + +A + Y   + ++      +   ++N +AC + +    + +E+ +
Sbjct: 86  FKKQGNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNYRRCIEDCS 145

Query: 164 KALELKPDYSKALLRRASANESLENYPDAMFDLSVLSLNGDFGGSSIEPMLERNLNKQAM 223
           KAL + P   K   R + A  SL    +A            F   SIEP  +  LN  ++
Sbjct: 146 KALTINPKNIKCYYRTSKAFFSLSKLEEA-------KSAAIFANQSIEPENKSILNMLSV 198

Query: 224 TVLKD---KLGQQKNQ 236
              K+   K+ +QK Q
Sbjct: 199 IERKEQELKIKEQKKQ 214

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 38.1 bits (87), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 39/79 (49%), Gaps = 5/79 (6%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALTLKK-----DPVFYSNISACYVSMNQLDKVVENST 163
            K +GNE +K K + +A + Y   L ++      +   Y+N +AC + +    + +E+ +
Sbjct: 86  FKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRRCIEDCS 145

Query: 164 KALELKPDYSKALLRRASA 182
           KAL + P   K   R + A
Sbjct: 146 KALTINPKNVKCYYRTSKA 164

>NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {ON}
           Anc_5.352 YDR320C
          Length = 700

 Score = 38.5 bits (88), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 55/111 (49%), Gaps = 26/111 (23%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYAL-TLKKDP----VFYSNISACYVSMNQLDKVVENST 163
            +++G ++FK  DY ++ + Y+ +L TL  +     + YSNI A  + + +  K ++NS+
Sbjct: 406 FRNRGTQYFKNGDYVSSFQEYEKSLNTLPVNHPLRIIAYSNIIASELKIGEYSKSLKNSS 465

Query: 164 KALELKPD---------------------YSKALLRRASANESLENYPDAM 193
            ALE+ PD                     + K  LR+A A E +E++  A+
Sbjct: 466 SALEMFPDDTAQWTAVIQDSDPQRTYKDIWPKVKLRQAEALEHIESFKAAL 516

>TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.352
           YDR320C
          Length = 693

 Score = 37.7 bits (86), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 53/110 (48%), Gaps = 26/110 (23%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYAL-TLKK-DP---VFYSNISAC------YVSMNQL-- 155
            KD+G E+FK+ DY +A + Y+ +L +L K  P   +  SN+ A       Y SM  +  
Sbjct: 400 FKDRGTEYFKKGDYVSATEQYEKSLNSLSKLHPLRIIASSNLLASLLKTGDYTSMITIST 459

Query: 156 -------------DKVVENSTKALELKPDYSKALLRRASANESLENYPDA 192
                        D V++NS  +   K  +SK + RRA A E +ENY  A
Sbjct: 460 SALDLFPKESKLWDNVIQNSEPSKTYKEIWSKLVARRAEAFEFIENYQQA 509

>CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q06677 Saccharomyces cerevisiae YDR320c SWA2
          Length = 661

 Score = 37.7 bits (86), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 54/107 (50%), Gaps = 26/107 (24%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYAL-TLK-KDP---VFYSNISACYVSMNQLDKVVENST 163
            K +G ++FK  DY +A++ Y+ +L TL  K P   + YSNI A  + + Q  + V ++ 
Sbjct: 365 FKARGTDYFKNGDYASAVEEYEKSLNTLPMKHPLRIIAYSNIIASRIKIGQHSQSVVDAQ 424

Query: 164 KALELKPD---------------------YSKALLRRASANESLENY 189
           +A++L P+                     + K +LR+A + E++E Y
Sbjct: 425 EAMKLLPEEKSLWTAAIQNSDPVRSYNDIWPKIILRQAESYEAIEKY 471

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 35.8 bits (81), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 35/64 (54%), Gaps = 1/64 (1%)

Query: 106 STALKDKGNEFFKQKDYDNALKYYDYA-LTLKKDPVFYSNISACYVSMNQLDKVVENSTK 164
           S  L+ KGN+ + + +Y+ A+ YY  A L    +PV  +N+S   + + + +  +    +
Sbjct: 8   SDHLRSKGNDLYSKGEYETAVLYYKNASLAEPSNPVHLANMSMALLKLERWEDALSACDR 67

Query: 165 ALEL 168
           ALE+
Sbjct: 68  ALEI 71

>NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON}
           Anc_3.367
          Length = 1007

 Score = 37.7 bits (86), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 52/109 (47%), Gaps = 6/109 (5%)

Query: 315 KDAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKAEEYYEFFD 374
           +DA    H G    ++ND   A++  Q+A++   R  + I+   I     +  +Y +  D
Sbjct: 309 QDATTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSR--NPIFWCSIGVLYYQISQYRDALD 366

Query: 375 ---KAIKLDPKNAAVYYHRGQMY-FITAQYEKAGQDFDKAKQLNEENIF 419
              +AI+L+P  + V+Y  G +Y     Q   A   + +A +L+ ENI 
Sbjct: 367 AYTRAIRLNPYISEVWYDLGTLYETCNNQLNDALDAYKQAARLDPENIH 415

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 48/91 (52%), Gaps = 1/91 (1%)

Query: 110 KDKGNEFFKQKDYDNALKYYDYALTL-KKDPVFYSNISACYVSMNQLDKVVENSTKALEL 168
           K++GN   K+K +  A++ Y  A+ L     +++SN +  +  ++     + +  +A++L
Sbjct: 16  KNEGNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSALNDCDEAIKL 75

Query: 169 KPDYSKALLRRASANESLENYPDAMFDLSVL 199
            P   KA  RRA +  +L  +  A  DL+VL
Sbjct: 76  DPKNIKAYHRRALSCMALLEFKKAKRDLNVL 106

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 21/35 (60%)

Query: 374 DKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFD 408
           D+AIKLDPKN   Y+ R        +++KA +D +
Sbjct: 70  DEAIKLDPKNIKAYHRRALSCMALLEFKKAKRDLN 104

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 45/90 (50%), Gaps = 8/90 (8%)

Query: 108 ALKDKGNEFFKQKDYDNALKYYDYALTLK-KDPVFYSNISACYVSMNQLDKVVENSTKAL 166
            +K++GN  F+  ++ +A +YY   + L+ ++P+ YSN +   + + +  + ++   + L
Sbjct: 6   TVKEQGNVAFRNSNFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETIDTCQRGL 65

Query: 167 -------ELKPDYSKALLRRASANESLENY 189
                  + +P   K L R   A ESL  +
Sbjct: 66  GKLEDNEKDEPIRKKLLYRLHLAQESLNKF 95

>SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1408

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 78/185 (42%), Gaps = 16/185 (8%)

Query: 353 YIYMALIMADKGKAEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQ 412
           Y  + +   +K K  E  E+F  A+++D  +   +   GQ Y+   + E + + F+KA +
Sbjct: 681 YRVLGVSYLEKQKEPESIEWFQSALRVDANDVESWVGLGQAYYACGRLEASIKVFEKATE 740

Query: 413 LNEENIFP-YIQLACLAYRENKFDDCETLFSEAKRKFATAPEVPNFFAEILAD------- 464
           L  +++F  Y +   LA    +++ C  + +    K             IL D       
Sbjct: 741 LAPDHLFAGYFKAISLA-GIGEYEQCIEIIAALLEKLPNEESFQVSMVNILIDYSVELFS 799

Query: 465 KGDLEKALKQ-YDIAKRLEEAVDGI-----HVGISPLVGKATLLARQPSVENF-IEATKL 517
           +G L KA+ Q  D  KR+E  +  I     +V IS        +  Q  V+   IE+   
Sbjct: 800 QGYLAKAVAQAVDSIKRIEYIISNISHKVQNVWISLSKALKLFILVQSKVDMLPIESLVN 859

Query: 518 LEEAC 522
           + EAC
Sbjct: 860 IFEAC 864

>YPR189W Chr16 (912664..916962) [4299 bp, 1432 aa] {ON}  SKI3Ski
           complex component and TPR protein, mediates 3'-5' RNA
           degradation by the cytoplasmic exosome; null mutants
           have superkiller phenotype of increased viral dsRNAs and
           are synthetic lethal with mutations in 5'-3' mRNA decay
          Length = 1432

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 2/73 (2%)

Query: 349 RVNSYIYMALIMADKGKAEEY--YEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQD 406
           R N++ +  + +A   K EE    E+F  A+++DP +   +   GQ Y    + E + + 
Sbjct: 699 RSNNWPFRVVGIAHLEKQEESDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKV 758

Query: 407 FDKAKQLNEENIF 419
           FDKA QL   + F
Sbjct: 759 FDKAIQLRPSHTF 771

>KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7.546
           YPR189W
          Length = 1418

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 44/80 (55%), Gaps = 2/80 (2%)

Query: 342 KAIDLHPRVNSYIYMALIMA--DKGKAEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQ 399
           +AI +  R  ++ Y  + +A  ++ +  E  E+F  A+++DP +   +   GQ YF   +
Sbjct: 675 EAIKMELRSTNWPYRVIGIAYLERQQESESVEWFHSALRVDPNDVESWVALGQAYFACGR 734

Query: 400 YEKAGQDFDKAKQLNEENIF 419
            E + + F+KA +++  +++
Sbjct: 735 VEASTKVFEKAIEIDPLHLY 754

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 29/50 (58%)

Query: 364 GKAEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQL 413
           G+ E+  +F+  A +L P ++   + + Q+ F   QY  A Q+F+K +QL
Sbjct: 554 GRREKALDFYQLACELQPNSSLALFKKSQLLFNLGQYSNALQNFEKLEQL 603

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 44/90 (48%), Gaps = 5/90 (5%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALTLKK-----DPVFYSNISACYVSMNQLDKVVENST 163
            K +GN+ +K K + +A + Y   + +K      +   Y+N +AC + +    + + +  
Sbjct: 84  FKKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRRCINDCK 143

Query: 164 KALELKPDYSKALLRRASANESLENYPDAM 193
           +AL+L P   K   R A A  +LE   +A+
Sbjct: 144 QALQLNPKNIKCYYRIAKAFTALERLDEAL 173

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 29/50 (58%)

Query: 364 GKAEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQL 413
           G+ E+  +F+  A +L P ++   + + Q+ F   QY  A Q+F+K +QL
Sbjct: 573 GRREKALDFYQLACELQPNSSLALFKKSQLLFNLGQYSNALQNFEKLEQL 622

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 5/93 (5%)

Query: 106 STALKDKGNEFFKQKDYDNALKYYDYALTLKKDPV-----FYSNISACYVSMNQLDKVVE 160
           +T  K++GN+ +K K + +A   Y  AL +K D +      Y N++AC + +      + 
Sbjct: 70  ATNFKNQGNDLYKGKRFKDARAMYLKALDVKCDVLSINESLYLNLAACELEIKNYRSCIN 129

Query: 161 NSTKALELKPDYSKALLRRASANESLENYPDAM 193
              +AL+L     KA  R   A   L  + D++
Sbjct: 130 YCREALKLNAKNVKAFFRIGKAYLELGRFEDSL 162

>TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.367
           YBR112C
          Length = 689

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 55/115 (47%), Gaps = 6/115 (5%)

Query: 312 LKEKDAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIY--MALIMADKGKAEEY 369
           L   D+    + G     K D   A+E +Q+A++   R N   +  + ++    G+  + 
Sbjct: 409 LDPTDSTTWYYLGRIHMAKKDFTAAYESLQQAVNRDSR-NPIFWCSIGVLYYQIGQNHDA 467

Query: 370 YEFFDKAIKLDPKNAAVYYHRGQMY-FITAQYEKAGQDFDKAKQLNEENIFPYIQ 423
            + + +AI+L+P  + V+Y+ G +Y     Q   A   +++A  L+ EN  P IQ
Sbjct: 468 LDAYTRAIRLNPYISEVWYNLGTLYETCNDQITDALDSYERALSLDPEN--PVIQ 520

>KLLA0C06006g Chr3 complement(530169..531707) [1539 bp, 512 aa] {ON}
           similar to uniprot|P40959 Saccharomyces cerevisiae
           YMR004W MVP1 Protein required for sorting proteins to
           the vacuole overproduction of Mvp1p suppresses several
           dominant VPS1 mutations Mvp1p and Vps1p act in concert
           to promote membrane traffic to the vacuole
          Length = 512

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 41/74 (55%), Gaps = 5/74 (6%)

Query: 234 KNQLLPSDTALASFFGIFTPETEF---ANYDETSE-ADQKLKAGLENLYKRS-SEGYQKA 288
           K+ +L SD  + +F  + T  + +   A+YD T E  D+ + +   NL+++  SE + KA
Sbjct: 228 KHPVLRSDDLVLTFLTVPTDLSGWRKQAHYDTTDEFTDKHISSSFMNLWRKEFSEQWNKA 287

Query: 289 DEFFSQAVDAYAKL 302
           DE    A+D + K+
Sbjct: 288 DERIDIALDTWVKV 301

>Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244W
           (PEX5) - 1:1 [contig 27] FULL
          Length = 575

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 48/89 (53%), Gaps = 2/89 (2%)

Query: 116 FFKQKDYDNALKYYDYALTLKKD-PVFYSNISACYVSMNQLDKVVENSTKALELKPDYSK 174
           F+   DYD  +  +  AL ++ D  + ++ + A   + N+ ++ ++   KAL+LKP + +
Sbjct: 436 FYSNDDYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVR 495

Query: 175 ALLRRASANESLENYPDAM-FDLSVLSLN 202
           A    A +  ++  Y +A  + L+ LS++
Sbjct: 496 ARCNLAVSCMNMGCYKEAAEYLLTALSMH 524

>Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}
           complement(21257..23317) [2061 nt, 687 aa]
          Length = 686

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 50/111 (45%), Gaps = 26/111 (23%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYAL-TLK-KDP---VFYSNISACYVSMNQLDKVVENST 163
            K++G E FK  DY  AL+ Y  +L TL  K P   +  SNI A      +  K +E ST
Sbjct: 397 FKERGTENFKTGDYVTALEAYQKSLNTLPIKHPLRIIASSNILASMSKTGEYRKSIEIST 456

Query: 164 KALELKPD---------------------YSKALLRRASANESLENYPDAM 193
            ALE  P                      + K +L+RA A E +E+Y +A+
Sbjct: 457 SALEQFPGDQKQWNEFIQDSEPQRTYKDIWPKIVLKRAEAFEHIESYENAL 507

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 33.9 bits (76), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 3/67 (4%)

Query: 110 KDKGNEFFKQKDYDNALKYYDYALTLK-KDPVFYSNISACYVSMNQLDKVVENSTKALE- 167
           K+ GN  FKQ  Y  A+  YD  +T + ++PV YSN +   + + +    ++   + L  
Sbjct: 12  KELGNALFKQGLYREAVDSYDQLITAQPQNPVGYSNKAMALIKLAEYTHAIQTCQEGLRY 71

Query: 168 -LKPDYS 173
            L P+++
Sbjct: 72  ALGPEHA 78

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 53/118 (44%), Gaps = 6/118 (5%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALTLKKDPV-----FYSNISACYVSMNQLDKVVENST 163
            K++GN+ +K K + +A + Y+  + +K D        Y+N +AC + +    + + +  
Sbjct: 81  FKNQGNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIKNYRRCLNDCK 140

Query: 164 KALELKPDYSKALLRRASANESLENYPDAMFDLSVLSLNGDFGGSSIEPMLERNLNKQ 221
            AL+  P   K   R   A  +LE   +A   +    L  D     ++ +L+  L KQ
Sbjct: 141 TALQYNPKNLKCYYRMGKAFLALELLEEAQKSVE-FGLQVDSSNKPLQSLLDIVLKKQ 197

>NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 33.9 bits (76), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 31/71 (43%), Gaps = 1/71 (1%)

Query: 110 KDKGNEFFKQKDYDNALKYYDYALTLK-KDPVFYSNISACYVSMNQLDKVVENSTKALEL 168
           K +GN  FK  DY  A K+YD  +  +  +P+ YSN +   +     D+ +      L  
Sbjct: 7   KTEGNRLFKLGDYTAANKFYDLCIMEEPTNPIGYSNKAMSLIKQEHFDQAIRTCNTGLLY 66

Query: 169 KPDYSKALLRR 179
             D     ++R
Sbjct: 67  SSDPEHEAIKR 77

>TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {ON}
           Anc_7.412 YBL084C
          Length = 835

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 53/120 (44%), Gaps = 16/120 (13%)

Query: 316 DAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKAEEYYEFFD- 374
           ++I+    G +  L ND   A + ++KA  ++PR  +Y Y       +G  +   + FD 
Sbjct: 617 NSISWCFIGNYFSLINDHDKAIKYLKKATTINPRF-TYAYTL-----EGHEQASIDAFDT 670

Query: 375 ------KAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLA 428
                 KAI  DP +   YY  G       QY++A   F+KAK +N  N    I L C  
Sbjct: 671 AKNCYRKAIACDPNHYNAYYGLGTCCMRLGQYDQALLYFEKAKMINPSNA---ILLCCCG 727

 Score = 35.0 bits (79), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 45/93 (48%), Gaps = 10/93 (10%)

Query: 329 LKNDPLGAHED-VQKAIDLHPRVNSYIYMALIMADKGKAEEYYEFFDKAIKLDPKNAAVY 387
           L ND   ++++  Q + DLHP+ +        ++D GK+   +EF +   +L P + ++Y
Sbjct: 429 LFNDMTASNQNNFQTSHDLHPQDH--------ISDYGKSN-LFEFHNNHFRLSPTSNSLY 479

Query: 388 YHRGQMYFITAQYEKAGQDFDKAKQLNEENIFP 420
                 YFI + ++      D   Q + +N FP
Sbjct: 480 PKLNSKYFIDSSFKDKNSIIDSQTQASTKNAFP 512

>Kpol_1057.14 s1057 (25908..28082) [2175 bp, 724 aa] {ON}
           (25908..28082) [2175 nt, 725 aa]
          Length = 724

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 93/231 (40%), Gaps = 17/231 (7%)

Query: 365 KAEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQ----LNEENIFP 420
           K  E  ++F K+  LDP  A  +      + +  ++++A   +  A +    ++  N+F 
Sbjct: 449 KISEARKYFSKSSILDPNFAPSWIGFSHTFALEGEHDQAISAYSTASRFFPGMHLPNLFL 508

Query: 421 YIQLACLAYRENKFDDCETLFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKR 480
            +Q   L    N     E  F+ A   +   P + N    +   K DL+K+ K+Y + K 
Sbjct: 509 GMQYMAL----NTLTLAEEYFTLAYDIYPNDPLLLNEMGVLHFKKNDLQKS-KRY-LKKA 562

Query: 481 LEEAVD---GIHVGISPLVGKATLLARQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQ 537
           LE A D        IS  +  A    R   +E  I+  K + E C KDP        L  
Sbjct: 563 LEAAKDMDSTSKTSISIQMNLAHTYRRLGEIEMAIKCFKAILEVCGKDP---DIFCSLGF 619

Query: 538 LKLQQEDIDDAIKLFEEAASLARTVDEKLQATTFAEAAKVQKRIRAD-PLV 587
           L L+ + +  AI     + SL  +     +  T A    V   + +D PL+
Sbjct: 620 LYLKTKQLQKAIDHLHLSLSLKPSNSVAQELLTHALELNVSMSLDSDHPLI 670

>KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 568

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 48/89 (53%), Gaps = 2/89 (2%)

Query: 116 FFKQKDYDNALKYYDYALTLKKD-PVFYSNISACYVSMNQLDKVVENSTKALELKPDYSK 174
           F+   DYD  +  +  AL +K D  + ++ + A   + N+ ++ ++   KAL+LKP + +
Sbjct: 429 FYSNDDYDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVR 488

Query: 175 ALLRRASANESLENYPDAM-FDLSVLSLN 202
           A    A +  ++  + +A  + L+ LS++
Sbjct: 489 ARCNLAVSCMNMGCFKEAAEYLLTALSMH 517

>Smik_16.453 Chr16 (775191..779444) [4254 bp, 1417 aa] {ON} YPR189W
           (REAL)
          Length = 1417

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 37/73 (50%), Gaps = 2/73 (2%)

Query: 349 RVNSYIYMALIMADKGKAEEY--YEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQD 406
           R N++ +  + +A   K EE    E+F  A+++DP +   +   GQ Y    + E + + 
Sbjct: 684 RKNNWPFRVVGIAHLEKQEESDSIEWFQSALRIDPNDVESWVGLGQAYHACGRIEASIKV 743

Query: 407 FDKAKQLNEENIF 419
           FDKA QL   + +
Sbjct: 744 FDKAIQLRPSHTY 756

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 33.9 bits (76), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 37/67 (55%), Gaps = 5/67 (7%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALTLK-KDPVFYSNISACYVSMNQLDKVVENSTKALE 167
            KD GNE FK+ +YD A++ Y   ++L+  + V YSN++  Y+     ++  + +  A E
Sbjct: 38  FKDIGNEHFKKGEYDLAIEQYRKCISLEPTNAVGYSNLAMAYLK----NRCPDEAKTACE 93

Query: 168 LKPDYSK 174
           +   Y K
Sbjct: 94  MGLSYCK 100

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score = 35.0 bits (79), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 80/180 (44%), Gaps = 28/180 (15%)

Query: 88  EPKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTLKKD---PV---F 141
           EPKL   +E   E     +  LK +GN+  ++++Y +A+  Y  A+ L K    PV   +
Sbjct: 69  EPKL---SEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGY 125

Query: 142 YSNISACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDL-SVLS 200
            SN S       + ++  +++   +++ P +SK   R A A      Y DAM     VL 
Sbjct: 126 LSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLD 185

Query: 201 LNGDFGGSSIEPMLERNLNKQAMTVLKD-KLGQQKNQLLPSDTALASFFGIFTPETEFAN 259
           L G               NK   T+ +D ++ +QK + L   T + S  G  TP +E AN
Sbjct: 186 LEG---------------NKATDTMKRDFEITKQKFETLNFSTHIDS--GSATPISEAAN 228

>TDEL0H00250 Chr8 complement(33258..37451) [4194 bp, 1397 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1397

 Score = 35.8 bits (81), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 29/47 (61%)

Query: 371 EFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEEN 417
           E+F  A+++DPK+   +   GQ Y+   + E + + F++A +L+ E+
Sbjct: 687 EWFQSALRIDPKDVESWVGLGQAYYACGRIEASMKVFERALELDSEH 733

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 5/79 (6%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALTLKKDPVFYS-----NISACYVSMNQLDKVVENST 163
            K++GN+ +K K + +A   Y+  + +K D    S     N +AC + +    + + +  
Sbjct: 80  FKNQGNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELELKNYRRCINDCR 139

Query: 164 KALELKPDYSKALLRRASA 182
           +AL+L P   KA  R   A
Sbjct: 140 EALKLNPKNPKAFFRIGKA 158

>Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C
           (CYC8) - 1:1 [contig 253] FULL
          Length = 802

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 30/139 (21%), Positives = 61/139 (43%), Gaps = 2/139 (1%)

Query: 316 DAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNS-YIYMALIMADKGKAEEYYEFFD 374
           DA    H G    ++ND   A++  Q A++   R  + +  + ++     +  +  + + 
Sbjct: 315 DATTWYHLGRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYT 374

Query: 375 KAIKLDPKNAAVYYHRGQMY-FITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRENK 433
           +AI+L+P  + V+Y  G +Y     Q   A   + +A +L+  N+    +L  L  +   
Sbjct: 375 RAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLDTNNVHIRERLEALTEQLAN 434

Query: 434 FDDCETLFSEAKRKFATAP 452
             +  T+  + K   AT P
Sbjct: 435 QSNGNTMPPQLKTPAATNP 453

>ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} similar
           to uniprot|P38042 Saccharomyces cerevisiae YBL084C CDC27
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 727

 Score = 35.4 bits (80), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 58/141 (41%), Gaps = 35/141 (24%)

Query: 373 FDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLAC------ 426
           + KAI  DP++   YY  G       QYE+A   F+KA+ +N  N+   I + C      
Sbjct: 566 YRKAIASDPQHYNAYYGLGMCCMKLGQYEEALLYFEKARSINPVNV---ILICCCGVALE 622

Query: 427 -LAYREN------------------KFDDCETLFSEAKRKFATAPEVPNF--FAEILADK 465
            ++Y+E                   KF     L+  A+   A    + NF   AE+  D+
Sbjct: 623 KMSYQEKALQYYELASELQPSSSLAKFKKAHLLYVMARYSVA----LENFEELAELAPDE 678

Query: 466 GDLEKALKQ-YDIAKRLEEAV 485
             +   L Q Y I  R ++AV
Sbjct: 679 ATVHFLLGQLYQIMGRKKDAV 699

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 33.5 bits (75), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALTLK-KDPVFYSNISACYVSMNQLDKVVENSTKAL 166
            K +GN++FK+ +Y +A+K Y+  + +  ++P+ YSN +   +  N+  + V      L
Sbjct: 6   FKTEGNQYFKEGNYASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAVRTCQDGL 64

>KNAG0H00160 Chr8 complement(21501..23843) [2343 bp, 780 aa] {ON}
           Anc_2.665 YKL022C
          Length = 780

 Score = 35.4 bits (80), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 51/102 (50%), Gaps = 6/102 (5%)

Query: 85  EKGEPKLDNVAEMSEEQKESWSTALK---DKGNEFFKQKDYDNALKYYDYALT-LKKDPV 140
           EK +  L   AE + E   +  TA+    + G+ + K  DY++A+K + Y L   ++D  
Sbjct: 596 EKSKKFLKRAAEETRELDSNSKTAISIQTNLGHTYKKLGDYEHAIKCFKYILEDSERDVD 655

Query: 141 FYSNISACYVSMNQLDKVVENSTKALELKPDYSKA--LLRRA 180
            Y  +   Y+  NQL K V+   +AL ++P    A  +L RA
Sbjct: 656 TYCTLGFLYLKTNQLQKAVDILHRALAIEPSNQNANEMLVRA 697

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 33.1 bits (74), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 110 KDKGNEFFKQKDYDNALKYYDYALTLK-KDPVFYSNISACYVSMNQLDKVVENSTKALEL 168
           K++GN  FK+  Y  A + Y   + ++ ++P+ YSN +   + + +  +VVE   K L  
Sbjct: 7   KEEGNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKGLTF 66

Query: 169 KPDYSKALLRRAS 181
            P+ +  + ++ +
Sbjct: 67  TPNTTDTVYKKLN 79

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 63/147 (42%), Gaps = 9/147 (6%)

Query: 341 QKAI--DLHPRVNSYIYMALIMADKGKAEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITA 398
           +KAI  DLH   N+Y  M +     G+ E+   +F+KA  ++P NA +    G       
Sbjct: 648 RKAISNDLH-HYNAYYGMGMCSMKLGEYEQALVYFEKARSINPSNAILICCCGVTMEKLG 706

Query: 399 QYEKAGQDFDKAKQLNEENIFPYIQLACLAYRENKFDDCETLFSEAKRKFATAPE---VP 455
             EKA   ++ A Q+   +     + A L Y   K+      F E  +    APE   V 
Sbjct: 707 NQEKALNYYELACQIQPTSSLAKFKRAHLLYSMAKYTQALDAFEELIK---IAPEEATVQ 763

Query: 456 NFFAEILADKGDLEKALKQYDIAKRLE 482
               ++    G  + A+K+Y IA  L+
Sbjct: 764 FILGQLYQIMGRKKDAIKRYTIAMNLD 790

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 25/110 (22%), Positives = 47/110 (42%)

Query: 373 FDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYREN 432
           FDKA KLDP     Y  +G  Y     Y+ A   + KA   +  +   Y  +   + +  
Sbjct: 613 FDKATKLDPNFVYAYTLQGHEYLSMDSYDTAKTFYRKAISNDLHHYNAYYGMGMCSMKLG 672

Query: 433 KFDDCETLFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKRLE 482
           +++     F +A+    +   +       +   G+ EKAL  Y++A +++
Sbjct: 673 EYEQALVYFEKARSINPSNAILICCCGVTMEKLGNQEKALNYYELACQIQ 722

>KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 941

 Score = 35.0 bits (79), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 23/110 (20%), Positives = 52/110 (47%), Gaps = 2/110 (1%)

Query: 312 LKEKDAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNS-YIYMALIMADKGKAEEYY 370
           +   DA +  H G    ++ND   A++  Q+A++   R  + +  + ++     +  +  
Sbjct: 353 IDSTDATSWYHLGRIHMIRNDYTSAYDAFQQAVNRDSRNPTFWCSIGVLYYQIAQYRDAL 412

Query: 371 EFFDKAIKLDPKNAAVYYHRGQMY-FITAQYEKAGQDFDKAKQLNEENIF 419
           + + +AI+L+P  + V+Y  G +Y     Q   A   + +A +L+  N+ 
Sbjct: 413 DAYTRAIRLNPYISEVWYDLGTLYETCNNQVNDALDAYKQAARLDPNNVH 462

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 57/136 (41%), Gaps = 17/136 (12%)

Query: 292 FSQAVDAYAKLREGNSDDAALKEKDAIALEHRGIFRFLKN----DPLGAHEDVQKAIDLH 347
           +  A DAY  +   N       ++ A  L+  G    + N    DP  A   + K++++ 
Sbjct: 302 WQGARDAYEHIISQN-------DRHAKVLQQLGCLYGMNNVSFYDPQKALNLLLKSLEID 354

Query: 348 PR-VNSYIYMALIMADKGKAEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQD 406
                S+ ++  I   +      Y+ F +A+  D +N   +   G +Y+  AQY  A   
Sbjct: 355 STDATSWYHLGRIHMIRNDYTSAYDAFQQAVNRDSRNPTFWCSIGVLYYQIAQYRDALDA 414

Query: 407 FDKAKQLNEENIFPYI 422
           + +A +LN     PYI
Sbjct: 415 YTRAIRLN-----PYI 425

>Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {ON}
           YDR320C (REAL)
          Length = 642

 Score = 34.7 bits (78), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 48/111 (43%), Gaps = 26/111 (23%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALT--LKKDP---VFYSNISACYVSMNQLDKVVENST 163
            K KG   FK  DY N+L+ Y+ AL       P   +  SNI A  + + +  K + NS 
Sbjct: 359 FKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYSKSIVNSD 418

Query: 164 KALELKPD---------------------YSKALLRRASANESLENYPDAM 193
            AL L P                      + K ++RRA + E LE++ +A+
Sbjct: 419 LALALFPPAKASWNNKISNSDPQRSFNDIWPKIMIRRAESFEHLESFKNAL 469

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 34.3 bits (77), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 51/108 (47%), Gaps = 12/108 (11%)

Query: 324 GIFRFLKNDPLGAHEDVQKAIDLHPRVN-SYIYMALIMADKGKAEEYYE----FFDKAIK 378
           G F  L+ D    HED  KA +   +V+ ++ Y   +   +  + + ++     + KA+ 
Sbjct: 542 GNFLSLQKD----HEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRKALA 597

Query: 379 LDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLAC 426
            DP++   YY  G       QY++A   F+KA+ +N  N+   I + C
Sbjct: 598 CDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSINPINV---ILICC 642

>SAKL0H06886g Chr8 complement(604406..605269) [864 bp, 287 aa] {ON}
           conserved hypothetical protein
          Length = 287

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 49/104 (47%), Gaps = 13/104 (12%)

Query: 208 SSIEPMLERNLNKQAMTVLKDKLGQQKNQLLPSDTALAS---------FFGIFTPETEFA 258
           S I+P  +  LN +A  +L D  G   ++LLP++ A  +         +  I  P  +  
Sbjct: 140 SEIDPQAQERLNSEAQQLLSDGRG---DELLPAEFARRADKTPITAYRWCSIMVPGGD-D 195

Query: 259 NYDETSEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAYAKL 302
           +Y  +  A++ + +    L K     Y +ADEF  Q+VD +A L
Sbjct: 196 DYFSSDLAEETISSTFGKLNKPFLVAYSEADEFVPQSVDKHALL 239

>Kpol_1067.25 s1067 (57301..58476) [1176 bp, 391 aa] {ON}
           (57301..58476) [1176 nt, 392 aa]
          Length = 391

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 44/100 (44%), Gaps = 23/100 (23%)

Query: 106 STALKDKGNEFFKQKDYDNALKYYDYALT----------LKKDPV---------FYSNIS 146
           +  +K+ G   FKQKDY NAL  Y  +L           + KD            Y NIS
Sbjct: 238 TNTIKESGTLLFKQKDYQNALLKYKKSLKYVNEFIPEMEVNKDNCILFTVLKMKLYLNIS 297

Query: 147 ACYVSMNQLDKVVENSTKALELK--PDY--SKALLRRASA 182
             Y ++   D  +  +T  L+++  PD   +KA  RR +A
Sbjct: 298 LVYFNLKDNDNCITYTTYLLDMENVPDLDQAKAYYRRGNA 337

>SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {ON}
           highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 880

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/106 (21%), Positives = 50/106 (47%), Gaps = 2/106 (1%)

Query: 316 DAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNS-YIYMALIMADKGKAEEYYEFFD 374
           DA    H G    ++ND   A++  Q+A++   R  + +  + ++     +  +  + + 
Sbjct: 307 DATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYT 366

Query: 375 KAIKLDPKNAAVYYHRGQMY-FITAQYEKAGQDFDKAKQLNEENIF 419
           +AI+L+P  + V+Y  G +Y     Q   A   + +A +L+  N+ 
Sbjct: 367 RAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLDPNNVH 412

>Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR189W
           (REAL)
          Length = 1424

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 2/73 (2%)

Query: 349 RVNSYIYMALIMADKGKAEEY--YEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQD 406
           R N++ +  + +A   K EE    E+F  A+++DP +   +   GQ Y    + E + + 
Sbjct: 692 RSNNWPFRVVGIAHLEKQEESDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKV 751

Query: 407 FDKAKQLNEENIF 419
           FDKA +L   + +
Sbjct: 752 FDKAIELQPSHTY 764

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 42/84 (50%), Gaps = 9/84 (10%)

Query: 94  VAEMSEEQKESWST--------ALKDKGNEFFKQKDYDNALKYYDYALTL-KKDPVFYSN 144
           V E  EE KE+  +         LK+KGNE  K K Y  A+  Y  A+ L   +  +Y+N
Sbjct: 114 VIEDIEETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNN 173

Query: 145 ISACYVSMNQLDKVVENSTKALEL 168
            +  Y+  N  D  + ++ K++E+
Sbjct: 174 RALAYIKANNFDHAIIDANKSIEI 197

>Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..253898)
           [4083 bp, 1360 aa] {ON}
           (249717..252797,252855..252863,252906..253898) [4083 nt,
           1361 aa]
          Length = 1360

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 29/49 (59%)

Query: 371 EFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIF 419
           E+F  A++++P N   +   GQ Y    + E + + F+KA +L+ ++++
Sbjct: 689 EWFQSALRIEPNNVESWVGLGQSYLSCGRIEASIRVFEKATELDPDHLY 737

>KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 795

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/106 (21%), Positives = 49/106 (46%), Gaps = 2/106 (1%)

Query: 316 DAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNS-YIYMALIMADKGKAEEYYEFFD 374
           DA    H G    ++ND   A++  Q A++   R  + +  + ++     +  +  + + 
Sbjct: 311 DATTWYHLGRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYT 370

Query: 375 KAIKLDPKNAAVYYHRGQMY-FITAQYEKAGQDFDKAKQLNEENIF 419
           +AI+L+P  + V+Y  G +Y     Q   A   + +A +L+  N+ 
Sbjct: 371 RAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLDTNNVH 416

>Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar to
           Ashbya gossypii ADL344W
          Length = 1115

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/106 (21%), Positives = 50/106 (47%), Gaps = 2/106 (1%)

Query: 316 DAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNS-YIYMALIMADKGKAEEYYEFFD 374
           DA    H G    ++ND   A++  Q+A++   R  + +  + ++     +  +  + + 
Sbjct: 377 DATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYT 436

Query: 375 KAIKLDPKNAAVYYHRGQMY-FITAQYEKAGQDFDKAKQLNEENIF 419
           +AI+L+P  + V+Y  G +Y     Q   A   + +A +L+  N+ 
Sbjct: 437 RAIRLNPYISEVWYDLGTLYETCNNQLNDALDAYKQAARLDPNNVH 482

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 5/79 (6%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALTLKKD-----PVFYSNISACYVSMNQLDKVVENST 163
            K++GN+ ++ K Y +A + Y+  + +K D        +SN +AC + +    + V +  
Sbjct: 81  FKNQGNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLFSNRAACELELKNYRRCVNDCK 140

Query: 164 KALELKPDYSKALLRRASA 182
           +AL+      K   R A A
Sbjct: 141 RALQYNVKNIKCYYRIAKA 159

>KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]
           {ON} weakly similar to uniprot|Q06677 Saccharomyces
           cerevisiae YDR320C SWA2 auxilin-like protein
          Length = 623

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 48/109 (44%), Gaps = 24/109 (22%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYA-----LTLKKDPVFYSNISACYVSMNQLDKVVENST 163
            K+KG   F+  DY  A + Y+ +     LT     V +SNI  C + + +  + + +++
Sbjct: 328 FKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSDAS 387

Query: 164 KALELKPD-------------------YSKALLRRASANESLENYPDAM 193
            AL+L P                    +SK +  +A A E +ENY  A+
Sbjct: 388 SALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKAL 436

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 36/75 (48%), Gaps = 5/75 (6%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALTLKK-----DPVFYSNISACYVSMNQLDKVVENST 163
            K +GNE +K K + +A + Y   + ++      +   ++N +AC + +    K VE+  
Sbjct: 86  FKKQGNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELELKNYRKCVEDCG 145

Query: 164 KALELKPDYSKALLR 178
           KAL + P   K   R
Sbjct: 146 KALTINPKNIKCYYR 160

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 38/89 (42%), Gaps = 5/89 (5%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALTLKKDPV-----FYSNISACYVSMNQLDKVVENST 163
            K++GN+ +K K + +A + Y   + +K D        Y+N +AC + +      + +  
Sbjct: 81  FKNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRSCISDCK 140

Query: 164 KALELKPDYSKALLRRASANESLENYPDA 192
            AL   P   K   R   A  ++  +  A
Sbjct: 141 TALTYNPKNIKCYFRMGKAFTAINKFESA 169

>TBLA0B07970 Chr2 (1887119..1889182) [2064 bp, 687 aa] {ON} Anc_5.72
           YHR166C
          Length = 687

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 52/113 (46%), Gaps = 6/113 (5%)

Query: 329 LKNDPLGAHEDVQKAIDLHPRVNSYIY---MALIMADKGKAEEYYEFFDKAIKLDPKNAA 385
           LKN    A E  ++A+D++PR     Y    A  + D      YY  F KA  L P +  
Sbjct: 500 LKNSH-AAIECYRRAVDINPRDFKAWYGLGQAYEVLDMHLYSLYY--FQKACALKPLDKR 556

Query: 386 VYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRENKFDDCE 438
           ++   G+ YFI    + A + + +A QL++  +   I L  LA    K DD E
Sbjct: 557 MWQALGECYFIVDNTDSALKCYKRALQLSDLALQDSIILYKLAILYEKMDDIE 609

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 10/66 (15%)

Query: 373 FDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLAC------ 426
           + KA+  DP++   YY  G       QYE+A   F+KA+ +N  N+   + + C      
Sbjct: 602 YRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNV---VLICCCGGSLE 658

Query: 427 -LAYRE 431
            L Y+E
Sbjct: 659 KLGYKE 664

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 373 FDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLAC 426
           + KA+  DP++   YY  G       QYE+A   F+KA+ +N  N+   + + C
Sbjct: 590 YRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNV---VLICC 640

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALTL-KKDPVFYSNISACYVSMN 153
            K KGN  +KQ ++ +A+ +Y  A+T    +PV YSN +   + +N
Sbjct: 7   FKIKGNTAYKQNNFTDAVNFYKKAITYDPTNPVGYSNCAMALIKLN 52

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 10/66 (15%)

Query: 373 FDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLAC------ 426
           + KA+  DP++   YY  G       QYE+A   F+KA+ +N  N+   + + C      
Sbjct: 597 YRKALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKARSINPVNV---VLICCCGGSLE 653

Query: 427 -LAYRE 431
            L Y+E
Sbjct: 654 KLGYKE 659

>ZYRO0D00572g Chr4 complement(42511..44830,45510..45547) [2358 bp,
           785 aa] {ON} similar to uniprot|P09798 Saccharomyces
           cerevisiae YKL022C CDC16 Subunit of the
           anaphase-promoting complex/cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition required for sporulation
          Length = 785

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 85/205 (41%), Gaps = 24/205 (11%)

Query: 365 KAEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQ----LNEENIFP 420
           K EE  ++F K+  LDP  A  +      Y I  + ++A   +  A +    ++  N+F 
Sbjct: 512 KIEEARKYFSKSSILDPNFAPAWLGFAHTYAIEGEQDQAISAYSTAARFFPGIHLPNLFL 571

Query: 421 YIQLACLAYRENKFDDCETLFSEAKRKFATAPEVPNFFAEILA---DKGDLEKALKQYDI 477
            +Q   L    N F   E  F+ A   + T P+ P    E+      + DL KA K+Y  
Sbjct: 572 GMQYMAL----NTFSLAEEYFTLA---YDTCPQDPLLLNEMGVMYFKRNDLHKA-KRY-- 621

Query: 478 AKRLEEAVDGIH----VGISPLVGKATLLARQPSVENFIEATKLLEEACAKDPRSEQGKV 533
            KR  EAV  ++      +S  +  A    R    E  I+  K + E  +KD  +     
Sbjct: 622 LKRALEAVKELNPTSRTSVSIQMNLAHAYRRLGENERAIKCFKTVLEVSSKDSDT---YC 678

Query: 534 GLAQLKLQQEDIDDAIKLFEEAASL 558
            L  L L+ +++  AI     A SL
Sbjct: 679 SLGFLYLKTKELQRAIDHLHTALSL 703

>KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {ON}
           Anc_7.412 YBL084C
          Length = 739

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 58/144 (40%), Gaps = 10/144 (6%)

Query: 353 YIYMALIMADKGKAEEYYE----FFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFD 408
           + Y   +   +  A E Y+     + KAI  DP++   YY  G       +Y+KA   F+
Sbjct: 554 FAYAYTLQGHEHAANETYDTAKIMYRKAIACDPQHYNAYYGLGDCASRLGKYDKALLYFE 613

Query: 409 KAKQLNEENIFPYIQLACLAYRENKFD--DCETLFSEAKRKFATAPEVPNF-FAEILADK 465
           KA+ +N  N    I + C  +   K +  D    + E   K      +P +  A++L   
Sbjct: 614 KARVINPVNA---ILICCCGHSLEKLNLPDQALTYYELAEKLQPEMTIPKYKKAQLLFSL 670

Query: 466 GDLEKALKQYDIAKRLEEAVDGIH 489
           G    A+  ++   +L      +H
Sbjct: 671 GKFSSAMYIFESLTKLSPEEVTVH 694

>ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR112C (CYC8)
          Length = 910

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 23/106 (21%), Positives = 50/106 (47%), Gaps = 2/106 (1%)

Query: 316 DAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNS-YIYMALIMADKGKAEEYYEFFD 374
           DA    H G    ++ND   A++  Q+A++   R  + +  + ++     +  +  + + 
Sbjct: 311 DATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYT 370

Query: 375 KAIKLDPKNAAVYYHRGQMY-FITAQYEKAGQDFDKAKQLNEENIF 419
           +AI+L+P  + V+Y  G +Y     Q   A   + +A +L+  N+ 
Sbjct: 371 RAIRLNPYISEVWYDLGTLYETCNNQLSDALDAYKQAVRLDPNNVH 416

>NDAI0G03710 Chr7 complement(894337..897702) [3366 bp, 1121 aa] {ON}
           Anc_3.5 YOL145C
          Length = 1121

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 43/98 (43%), Gaps = 18/98 (18%)

Query: 116 FFKQKDYDNALKYYDYALT----LKKDPVFYSNISACYVSMNQLDKVVENSTKALELKPD 171
            F++K++  +LK +   L     LK DP     I AC+  +      +    ++LEL P 
Sbjct: 207 LFRKKNFMASLKLFQELLVNNPVLKPDPRI--GIGACFWQLKDYKMAINAWERSLELDPT 264

Query: 172 ------------YSKALLRRASANESLENYPDAMFDLS 197
                       + K L+   + +E  +N+ DAM DLS
Sbjct: 265 NKNSKVLCLLGKFHKTLIDSGNDDEFKDNFKDAMIDLS 302

>KAFR0A02370 Chr1 (489885..493505) [3621 bp, 1206 aa] {ON} Anc_8.235
           YDR097C
          Length = 1206

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 46/93 (49%), Gaps = 11/93 (11%)

Query: 181 SANESLENYPDAMFDLS----------VLSLNGDFGGSSIEPMLERNLNKQAMTVLKDKL 230
           S ++S  N+PD +F +S          +L    D   S ++ ++ + +  + + + K+ L
Sbjct: 417 SFDDSTVNHPDKIFGISFIDTATGELQMLEFEDDNECSKLDTIMSQ-IRPKEIIIEKNNL 475

Query: 231 GQQKNQLLPSDTALASFFGIFTPETEFANYDET 263
               N+++  ++A  + F    P+TEF N+D T
Sbjct: 476 SNLANKIVKFNSAANAIFNNVKPDTEFYNFDRT 508

>ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 379

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 37/79 (46%), Gaps = 5/79 (6%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALTLK--KDPV---FYSNISACYVSMNQLDKVVENST 163
            K++ N+ +K K +  A + Y   + +K   D V    ++N++AC + +    + +    
Sbjct: 81  FKNQANDLYKAKRFKEAREVYKKGIEIKCNDDKVNESLFANLAACELEIKNFRRCINLCQ 140

Query: 164 KALELKPDYSKALLRRASA 182
           KAL+  P   K   R A A
Sbjct: 141 KALQFNPKNMKCYYRIAKA 159

>Skud_16.493 Chr16 (854949..859226) [4278 bp, 1425 aa] {ON} YPR189W
           (REAL)
          Length = 1425

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 36/73 (49%), Gaps = 2/73 (2%)

Query: 349 RVNSYIYMALIMADKGKAEEY--YEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQD 406
           R N++ +  + +A   K EE    E+F  A+++DP +   +   GQ Y    + E + + 
Sbjct: 692 RSNNWPFRVVGIAHLEKQEESDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKV 751

Query: 407 FDKAKQLNEENIF 419
           FDKA  L   + +
Sbjct: 752 FDKAIGLKPSHTY 764

>KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1420

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 28/47 (59%)

Query: 371 EFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEEN 417
           E+F  A+++DP +   +   GQ YF   + E + + F+KA +L+ ++
Sbjct: 705 EWFQSALRVDPNDIESWVGLGQAYFACGRVEASIKVFEKAVELSPDH 751

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 16/72 (22%), Positives = 35/72 (48%)

Query: 373  FDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYREN 432
            F KA+ L PK+  ++++   +         AG+   +A+ +  +N  P++ +A L  +E 
Sbjct: 993  FIKAMVLSPKDVEIWFNLALLALQNNDTVLAGEIMSRAQSMAPQNSSPWLGMALLYEKEG 1052

Query: 433  KFDDCETLFSEA 444
            K  +   +F  +
Sbjct: 1053 KSTESANMFGHS 1064

>TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {ON}
           Anc_3.367 YBR112C
          Length = 759

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 21/92 (22%), Positives = 44/92 (47%), Gaps = 6/92 (6%)

Query: 332 DPLGAHEDVQKAIDLHPR-VNSYIYMALIMADKGKAEEYYEFFDKAIKLDPKNAAVYYHR 390
           DP  A   + K+++++P    ++ ++  +   +      Y+ F +A+  D +N   +   
Sbjct: 257 DPQKALNFLLKSLEVNPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSI 316

Query: 391 GQMYFITAQYEKAGQDFDKAKQLNEENIFPYI 422
           G +Y+  +QY  A   + +A +LN     PYI
Sbjct: 317 GVLYYQISQYRDALDAYTRAIRLN-----PYI 343

>NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.412
           YBL084C
          Length = 783

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 56/145 (38%), Gaps = 34/145 (23%)

Query: 372 FFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENI------------- 418
           +F KA+  D ++   YY  G       ++E A   F+KA+ +N  N+             
Sbjct: 621 YFRKAVSTDSQHYNAYYGIGMCSMKLGEFEHALLYFEKARSINPSNVILICCCGVAFEKL 680

Query: 419 -FP-----YIQLACLAYREN---KFDDCETLFSEAKRKFA---------TAPE---VPNF 457
            +P     Y +LAC     +   KF     L+S A    A          APE   V   
Sbjct: 681 SYPEKALSYYELACQVQPSSSLAKFKRAHLLYSMANYPLALECFEELTKLAPEEATVHFI 740

Query: 458 FAEILADKGDLEKALKQYDIAKRLE 482
             ++    G  + A+K+Y IA  L+
Sbjct: 741 LGQLYNIMGRKKDAVKEYTIAMNLD 765

>NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}
           Anc_5.689 YOR080W
          Length = 764

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 47/99 (47%), Gaps = 4/99 (4%)

Query: 144 NISACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVLSLNG 203
           N +AC+  M +L+K + ++TK   ++P   K  +R+    + L    DA         N 
Sbjct: 99  NRAACWEKMGELEKALRDATKMCFIEPYNLKCFIRKGKILQKLHKLKDAYNTYKTALRNA 158

Query: 204 DFGGSSIEPMLERNLNKQAMTVLKDKLGQQKNQLLPSDT 242
           +F   S    L+ N++K  + ++  +    K+++L S T
Sbjct: 159 NFATDS----LKINVSKTFIDIIVHQKNLVKDKILSSRT 193

>KAFR0C03820 Chr3 complement(774134..776248) [2115 bp, 704 aa] {ON}
           Anc_2.665 YKL022C
          Length = 704

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 113 GNEFFKQKDYDNALKYYDYALT-LKKDPVFYSNISACYVSMNQLDKVVENSTKALELKPD 171
           G+ + K  D + A++ + Y L   +KDP  Y  +   Y+   QL K ++   +AL +KP 
Sbjct: 560 GHTYRKLGDNERAIECFKYVLQDSEKDPDLYVTLGFLYLQTKQLQKGIDCLHRALAIKPG 619

Query: 172 YSKA 175
            + A
Sbjct: 620 MTSA 623

>TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {ON}
           Anc_8.470 YDR244W
          Length = 549

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 48/89 (53%), Gaps = 2/89 (2%)

Query: 116 FFKQKDYDNALKYYDYALTLK-KDPVFYSNISACYVSMNQLDKVVENSTKALELKPDYSK 174
           F+   ++D  +  +  AL++   D + ++ + A   + N+ ++ ++   KAL+LKP + +
Sbjct: 406 FYADSEFDKTIDCFKAALSVNPNDELMWNRLGASLANSNRSEEAIQAYYKALQLKPSFVR 465

Query: 175 ALLRRASANESLENYPDAM-FDLSVLSLN 202
           A    A ++ ++  Y +A  + LS L ++
Sbjct: 466 ARYNLAVSSINIGCYKEAAEYLLSALKMH 494

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 34/79 (43%), Gaps = 5/79 (6%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALTLK--KDPV---FYSNISACYVSMNQLDKVVENST 163
            K++GN+ +K K Y +A   Y   + +K   D +    Y N +AC + +      + +  
Sbjct: 82  FKNQGNDLYKVKRYKDARTMYSKGIEVKCEDDSINGSLYLNRAACELELRNFRSCINDCK 141

Query: 164 KALELKPDYSKALLRRASA 182
           KAL       KA  R   A
Sbjct: 142 KALNFNAKCVKAFYRMGQA 160

>KLLA0B10197g Chr2 complement(891842..893707) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 621

 Score = 31.6 bits (70), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 53/120 (44%), Gaps = 25/120 (20%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYAL-TLK-KDP---VFYSNISACYVSMNQLDKVVENST 163
            K+ G ++F   DY NAL  ++ +  TL  K P   +  SNI +C + + +  K +E+  
Sbjct: 336 FKNNGVKYFSSGDYHNALLEFEKSFNTLPFKHPLRIISLSNIVSCQLKLGENSKALESVK 395

Query: 164 KALELK---PDYS-----------------KALLRRASANESLENYPDAMFDLSVLSLNG 203
            AL+L    P+ S                 K  L+ A   E LENY  A+   + L  NG
Sbjct: 396 LALDLSDLAPNASDIIEHSVPERTFKQMINKIQLKHAEIQEHLENYEKALSLYANLISNG 455

>CAGL0H10098g Chr8 complement(984334..986919) [2586 bp, 861 aa] {ON}
           similar to uniprot|P19735 Saccharomyces cerevisiae
           YBR055c PRP6 snRNP(U4/U6)-associated splicing factor
          Length = 861

 Score = 31.6 bits (70), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 36/70 (51%), Gaps = 9/70 (12%)

Query: 113 GNEFFKQKDYDNALKYYDYALTLKKDPVF---YSNISACYVSMN-QLDKVVENSTKALEL 168
           G  F+    Y  A+K++D A+T  K P F   ++ I  C   +N  LDK++E   K  EL
Sbjct: 773 GRSFYNDNQYKVAMKWFDRAVT--KQPRFGDGWAYIYNCKQKLNDDLDKLLE---KVAEL 827

Query: 169 KPDYSKALLR 178
            P Y +  ++
Sbjct: 828 DPAYGEEWIK 837

>Suva_8.129 Chr8 (231888..234113) [2226 bp, 741 aa] {ON} YOR080W
           (REAL)
          Length = 741

 Score = 31.2 bits (69), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 26/49 (53%)

Query: 144 NISACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDA 192
           NI ACY  ++ L   +  S K+L+L PD +K  +R       L+++  A
Sbjct: 83  NICACYEKLDDLKSCLSISQKSLKLDPDNAKCYIRCTRTLIKLKDWKRA 131

>CAGL0K05599g Chr11 (545761..547893) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q08496 Saccharomyces cerevisiae YOR080w
          Length = 710

 Score = 31.2 bits (69), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 26/49 (53%)

Query: 144 NISACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDA 192
           N+SAC+   N LD  ++ S K ++L+P   K  +R+      L  Y DA
Sbjct: 83  NLSACWEKQNILDNALKLSHKMVKLEPFNIKTYIRKGRILMKLTKYRDA 131

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 31.2 bits (69), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 17/80 (21%), Positives = 36/80 (45%), Gaps = 6/80 (7%)

Query: 109 LKDKGNEFFKQKDYDNALKYYDYALTLKKDP------VFYSNISACYVSMNQLDKVVENS 162
            K++GN+ +K K + +A   Y   + ++ +         ++N +AC + +    + + + 
Sbjct: 79  FKNQGNDLYKAKRFKDARDVYLKGIQIENNKDVKIKESLFANKAACELELKNFRRCINDC 138

Query: 163 TKALELKPDYSKALLRRASA 182
             AL+L P   K   R   A
Sbjct: 139 KNALQLNPKNVKCYFRMTRA 158

>KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1411

 Score = 31.2 bits (69), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 19/91 (20%), Positives = 43/91 (47%)

Query: 353 YIYMALIMADKGKAEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQ 412
           Y  + +   +K    E  E+F  A++++P +   +   GQ Y+   + E + + F+KA +
Sbjct: 684 YRVLGIAHLEKQAESESIEWFQSALRVEPADLESWLGLGQAYYSCGRVEASVKVFEKALE 743

Query: 413 LNEENIFPYIQLACLAYRENKFDDCETLFSE 443
           ++  N + +   A    +   +D+   +F E
Sbjct: 744 VSPGNAYAHYFKALSLSKMGLYDESIEIFRE 774

>TPHA0G00240 Chr7 complement(37417..41709) [4293 bp, 1430 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1430

 Score = 31.2 bits (69), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 71/165 (43%), Gaps = 21/165 (12%)

Query: 368 EYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACL 427
           E  E+F  A+++D ++   +   GQ Y    + E + + F+KA +L+  +++  + LA  
Sbjct: 716 ESIEWFQSALRIDKEDIESWVGLGQAYVGCGRIEASIKVFEKAIELDSNHLYAKLFLAES 775

Query: 428 AYRENKFDDCETLFSEAKRK-------FATAPEVPNFFAEILADKGDLEKALKQYDIAKR 480
                +++D   L  E            AT       +A  L ++G L K++K       
Sbjct: 776 LSNIGEYEDSILLLKELTLSSLDQEVFHATYASTLTNYATDLYNRGFLTKSIKVS----- 830

Query: 481 LEEAVDGIH-----VGISPLVGKATLLARQPSVENFIEATKLLEE 520
             EA+D I+     +   P +   +L +   S++ FI     +EE
Sbjct: 831 -VEAIDSIYHLFVDLQTHPQIAWISLFS---SLQLFISVQSKIEE 871

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.131    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,071,138
Number of extensions: 2576464
Number of successful extensions: 8385
Number of sequences better than 10.0: 293
Number of HSP's gapped: 8359
Number of HSP's successfully gapped: 436
Length of query: 604
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 489
Effective length of database: 40,294,809
Effective search space: 19704161601
Effective search space used: 19704161601
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)