Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0G06490g2.151ON92923801e-48
TDEL0B051302.151ON93912783e-33
KLLA0F24068g2.151ON95672645e-31
SAKL0E10978g2.151ON95672593e-30
KAFR0J020902.151ON92672507e-29
Kpol_505.212.151ON85692481e-28
Ecym_82022.151ON98672491e-28
ABR133W2.151ON96952481e-28
KNAG0I021302.151ON92672462e-28
Kwal_33.147622.151ON91642463e-28
CAGL0L04070g2.151ON95922463e-28
KLTH0B05214g2.151ON91672453e-28
NCAS0G024702.151ON88672436e-28
NDAI0F028202.151ON128672423e-27
TPHA0F018802.151ON99692361e-26
Suva_14.2182.151ON112662256e-25
Skud_14.2102.151ON103662249e-25
Smik_14.2062.151ON113662205e-24
YNL122C2.151ON115662189e-24
TBLA0B012302.151ON97671934e-20
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0G06490g
         (92 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0G06490g Chr7 complement(515132..515410) [279 bp, 92 aa] {ON...   150   1e-48
TDEL0B05130 Chr2 complement(904074..904355) [282 bp, 93 aa] {ON}...   111   3e-33
KLLA0F24068g Chr6 (2242939..2243226) [288 bp, 95 aa] {ON} simila...   106   5e-31
SAKL0E10978g Chr5 (919541..919828) [288 bp, 95 aa] {ON} some sim...   104   3e-30
KAFR0J02090 Chr10 (400769..401047) [279 bp, 92 aa] {ON} Anc_2.15...   100   7e-29
Kpol_505.21 s505 (56756..57013) [258 bp, 85 aa] {ON} (56756..570...   100   1e-28
Ecym_8202 Chr8 complement(418239..418535) [297 bp, 98 aa] {ON} s...   100   1e-28
ABR133W Chr2 (644796..645086) [291 bp, 96 aa] {ON} Syntenic homo...   100   1e-28
KNAG0I02130 Chr9 (416674..416952) [279 bp, 92 aa] {ON} Anc_2.151...    99   2e-28
Kwal_33.14762 s33 complement(808878..809153) [276 bp, 91 aa] {ON...    99   3e-28
CAGL0L04070g Chr12 (478686..478973) [288 bp, 95 aa] {ON} highly ...    99   3e-28
KLTH0B05214g Chr2 (430231..430506) [276 bp, 91 aa] {ON} some sim...    99   3e-28
NCAS0G02470 Chr7 complement(439576..439842) [267 bp, 88 aa] {ON}...    98   6e-28
NDAI0F02820 Chr6 (693148..693534) [387 bp, 128 aa] {ON} Anc_2.15...    98   3e-27
TPHA0F01880 Chr6 (428432..428731) [300 bp, 99 aa] {ON} Anc_2.151...    96   1e-26
Suva_14.218 Chr14 complement(394669..394965,394969..394983,39499...    91   6e-25
Skud_14.210 Chr14 complement(388110..388406,388410..388421) [309...    91   9e-25
Smik_14.206 Chr14 complement(377692..377997,378001..378009,37801...    89   5e-24
YNL122C Chr14 complement(398023..398370) [348 bp, 115 aa] {ON} P...    89   9e-24
TBLA0B01230 Chr2 complement(262437..262730) [294 bp, 97 aa] {ON}...    79   4e-20

>ZYRO0G06490g Chr7 complement(515132..515410) [279 bp, 92 aa] {ON}
          similar to uniprot|Q75D91 Ashbya gossypii ABR133W 50S
          ribosomal protein L35 and some similarites with YNL122C
          uniprot|P53921 Saccharomyces cerevisiae YNL122C
          Hypothetical ORF
          Length = 92

 Score =  150 bits (380), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 76/92 (82%), Positives = 76/92 (82%)

Query: 1  MFFNSIVGLXXXXXXXXXXXXXXXXLVFTRNLMKTHKGTAKRWKKTADGFKRGKAGRNHG 60
          MFFNSIVGL                LVFTRNLMKTHKGTAKRWKKTADGFKRGKAGRNHG
Sbjct: 1  MFFNSIVGLGSRSAFASFGGFNSSSLVFTRNLMKTHKGTAKRWKKTADGFKRGKAGRNHG 60

Query: 61 NVGWSRRSLKVLSGKTPAHESHIQRLRRLLPY 92
          NVGWSRRSLKVLSGKTPAHESHIQRLRRLLPY
Sbjct: 61 NVGWSRRSLKVLSGKTPAHESHIQRLRRLLPY 92

>TDEL0B05130 Chr2 complement(904074..904355) [282 bp, 93 aa] {ON}
          Anc_2.151 YNL122C
          Length = 93

 Score =  111 bits (278), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 65/91 (71%)

Query: 1  MFFNSIVGLXXXXXXXXXXXXXXXXLVFTRNLMKTHKGTAKRWKKTADGFKRGKAGRNHG 60
          MFF+SI+                  L+ TR+LMKTHKG AKRW+KTA  FKRGKAGR+HG
Sbjct: 2  MFFSSIINPIFRTCLNTFSKVEAPSLILTRSLMKTHKGAAKRWRKTATSFKRGKAGRSHG 61

Query: 61 NVGWSRRSLKVLSGKTPAHESHIQRLRRLLP 91
          N GWSRRSLK LSGKT AHE+HI+ L+RL+P
Sbjct: 62 NAGWSRRSLKSLSGKTLAHETHIKHLKRLMP 92

>KLLA0F24068g Chr6 (2242939..2243226) [288 bp, 95 aa] {ON} similar
          to uniprot|P53921 Saccharomyces cerevisiae YNL122C
          Hypothetical ORF
          Length = 95

 Score =  106 bits (264), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 57/67 (85%)

Query: 26 LVFTRNLMKTHKGTAKRWKKTADGFKRGKAGRNHGNVGWSRRSLKVLSGKTPAHESHIQR 85
          L+ TRNLMKTHKG AKRW+KTA+ FKRGKAGRNHGN GWSR SLK LSG++ A  +H+ R
Sbjct: 28 LILTRNLMKTHKGAAKRWRKTANSFKRGKAGRNHGNAGWSRNSLKSLSGRSLADSTHMHR 87

Query: 86 LRRLLPY 92
          L+RLLPY
Sbjct: 88 LKRLLPY 94

>SAKL0E10978g Chr5 (919541..919828) [288 bp, 95 aa] {ON} some
          similarities with uniprot|P53921 Saccharomyces
          cerevisiae YNL122C Hypothetical ORF
          Length = 95

 Score =  104 bits (259), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 48/67 (71%), Positives = 57/67 (85%)

Query: 26 LVFTRNLMKTHKGTAKRWKKTADGFKRGKAGRNHGNVGWSRRSLKVLSGKTPAHESHIQR 85
          LV TRNLMKTHKG AKRWKKTA+ +KRG+AGRNHGN GW++ +LK L GKT AH +HI+ 
Sbjct: 28 LVLTRNLMKTHKGAAKRWKKTANSYKRGRAGRNHGNAGWNKSTLKSLDGKTLAHPTHIKH 87

Query: 86 LRRLLPY 92
          L+RLLPY
Sbjct: 88 LKRLLPY 94

>KAFR0J02090 Chr10 (400769..401047) [279 bp, 92 aa] {ON} Anc_2.151
          YNL122C
          Length = 92

 Score =  100 bits (250), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 48/67 (71%), Positives = 56/67 (83%)

Query: 26 LVFTRNLMKTHKGTAKRWKKTADGFKRGKAGRNHGNVGWSRRSLKVLSGKTPAHESHIQR 85
          L+  RNLMKTHKGTAKRW+KTA+GFKRG AGRNHGN GWSRRSLK L+G+  A  S  +R
Sbjct: 25 LIIARNLMKTHKGTAKRWRKTANGFKRGIAGRNHGNGGWSRRSLKCLTGRKTATPSQAKR 84

Query: 86 LRRLLPY 92
          L+RLLP+
Sbjct: 85 LKRLLPF 91

>Kpol_505.21 s505 (56756..57013) [258 bp, 85 aa] {ON}
          (56756..57013) [258 nt, 86 aa]
          Length = 85

 Score =  100 bits (248), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 58/69 (84%), Gaps = 2/69 (2%)

Query: 26 LVFTRNLMKTHKGTAKRWK--KTADGFKRGKAGRNHGNVGWSRRSLKVLSGKTPAHESHI 83
          L  TR+LMKTHKGTAKRWK  K+ D FKRGK+GR HGNVGWS+RSLK LSG+T AH +H+
Sbjct: 16 LQITRSLMKTHKGTAKRWKFIKSLDTFKRGKSGRQHGNVGWSQRSLKHLSGRTYAHTTHV 75

Query: 84 QRLRRLLPY 92
           RLR+LLPY
Sbjct: 76 SRLRKLLPY 84

>Ecym_8202 Chr8 complement(418239..418535) [297 bp, 98 aa] {ON}
          similar to Ashbya gossypii ABR133W
          Length = 98

 Score =  100 bits (249), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 58/67 (86%)

Query: 26 LVFTRNLMKTHKGTAKRWKKTADGFKRGKAGRNHGNVGWSRRSLKVLSGKTPAHESHIQR 85
          L+F+R+LMKTHKG AKRW+KTA+ FKRGKAGR+HGN GWS+ SLKVLSG+  A+ S + R
Sbjct: 31 LIFSRSLMKTHKGAAKRWRKTANSFKRGKAGRSHGNSGWSKNSLKVLSGRALANGSQLNR 90

Query: 86 LRRLLPY 92
          L+RLLPY
Sbjct: 91 LKRLLPY 97

>ABR133W Chr2 (644796..645086) [291 bp, 96 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL122C
          Length = 96

 Score =  100 bits (248), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 51/95 (53%), Positives = 62/95 (65%), Gaps = 3/95 (3%)

Query: 1  MFFN---SIVGLXXXXXXXXXXXXXXXXLVFTRNLMKTHKGTAKRWKKTADGFKRGKAGR 57
          MFFN    + GL                L+  R LMKTHKG AKRW+KTA G+KR KAGR
Sbjct: 1  MFFNMLRPLTGLPVRFGSGAFAATTQPSLIMVRTLMKTHKGAAKRWRKTAGGYKRSKAGR 60

Query: 58 NHGNVGWSRRSLKVLSGKTPAHESHIQRLRRLLPY 92
          +HGN GW +R+LK LSG+T A  +H++RLRRLLPY
Sbjct: 61 SHGNTGWGQRALKQLSGRTMAASAHLKRLRRLLPY 95

>KNAG0I02130 Chr9 (416674..416952) [279 bp, 92 aa] {ON} Anc_2.151
          YNL122C
          Length = 92

 Score = 99.4 bits (246), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 44/67 (65%), Positives = 57/67 (85%)

Query: 26 LVFTRNLMKTHKGTAKRWKKTADGFKRGKAGRNHGNVGWSRRSLKVLSGKTPAHESHIQR 85
          ++ TR+LMKTHKG AKRW+K A+GFKRG +GR HGN GWS+R LK L+G+T AH+S I+R
Sbjct: 25 MIVTRSLMKTHKGAAKRWRKNANGFKRGISGRKHGNCGWSQRGLKALTGRTEAHQSQIKR 84

Query: 86 LRRLLPY 92
          L++LLPY
Sbjct: 85 LKKLLPY 91

>Kwal_33.14762 s33 complement(808878..809153) [276 bp, 91 aa] {ON}
          YNL122C - Hypothetical ORF [contig 101] FULL
          Length = 91

 Score = 99.4 bits (246), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 54/64 (84%)

Query: 29 TRNLMKTHKGTAKRWKKTADGFKRGKAGRNHGNVGWSRRSLKVLSGKTPAHESHIQRLRR 88
          TRNLMKTHKGTAKRW+KT+  +KRG+AGRNHGN GW + +LK L GKT AH +HI+ L+R
Sbjct: 27 TRNLMKTHKGTAKRWRKTSTSYKRGRAGRNHGNAGWGKSTLKALDGKTLAHSTHIKHLKR 86

Query: 89 LLPY 92
          LLPY
Sbjct: 87 LLPY 90

>CAGL0L04070g Chr12 (478686..478973) [288 bp, 95 aa] {ON} highly
          similar to uniprot|P53921 Saccharomyces cerevisiae
          YNL122c
          Length = 95

 Score = 99.4 bits (246), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 60/92 (65%)

Query: 1  MFFNSIVGLXXXXXXXXXXXXXXXXLVFTRNLMKTHKGTAKRWKKTADGFKRGKAGRNHG 60
          +F N+I                   +VF R LMKTH+G  KRW++T+ GFKRG AGR HG
Sbjct: 3  LFNNAITACTSRLLSMKTMGVSSFGMVFCRTLMKTHRGALKRWRQTSTGFKRGIAGRKHG 62

Query: 61 NVGWSRRSLKVLSGKTPAHESHIQRLRRLLPY 92
          N+GWS RSLK L+G+T AH + ++RLRRL+PY
Sbjct: 63 NIGWSHRSLKSLTGRTDAHPTQMKRLRRLMPY 94

>KLTH0B05214g Chr2 (430231..430506) [276 bp, 91 aa] {ON} some
          similarities with uniprot|P53921 Saccharomyces
          cerevisiae YNL122C Hypothetical ORF
          Length = 91

 Score = 99.0 bits (245), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 56/67 (83%)

Query: 26 LVFTRNLMKTHKGTAKRWKKTADGFKRGKAGRNHGNVGWSRRSLKVLSGKTPAHESHIQR 85
          ++ TRNLMKTHKGTAKRW+KT+  +KRG+AGRNHGN GW + +LK L GKT AH +HI+ 
Sbjct: 24 MMQTRNLMKTHKGTAKRWRKTSTSYKRGRAGRNHGNAGWGKSTLKSLDGKTLAHPTHIKH 83

Query: 86 LRRLLPY 92
          L+RLLPY
Sbjct: 84 LKRLLPY 90

>NCAS0G02470 Chr7 complement(439576..439842) [267 bp, 88 aa] {ON}
          Anc_2.151 YNL122C
          Length = 88

 Score = 98.2 bits (243), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 55/67 (82%)

Query: 26 LVFTRNLMKTHKGTAKRWKKTADGFKRGKAGRNHGNVGWSRRSLKVLSGKTPAHESHIQR 85
          L  TRNLMKTHKGTAKRW++TA  FKRG AGRNHGN GWSRRSLK LSG+  A  S+++ 
Sbjct: 21 LTITRNLMKTHKGTAKRWRRTAQSFKRGIAGRNHGNAGWSRRSLKHLSGRKDADPSYLRH 80

Query: 86 LRRLLPY 92
          L+RL+PY
Sbjct: 81 LKRLMPY 87

>NDAI0F02820 Chr6 (693148..693534) [387 bp, 128 aa] {ON} Anc_2.151
           YNL122C
          Length = 128

 Score = 97.8 bits (242), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 54/67 (80%)

Query: 26  LVFTRNLMKTHKGTAKRWKKTADGFKRGKAGRNHGNVGWSRRSLKVLSGKTPAHESHIQR 85
           LV TRNLMKTHKG AKRW+K+A GFKRG AGRNHGNVGWS R L  L+G+  A  +H++ 
Sbjct: 61  LVITRNLMKTHKGAAKRWRKSAQGFKRGIAGRNHGNVGWSHRYLNKLTGRKEADPTHVKH 120

Query: 86  LRRLLPY 92
           L+R+LPY
Sbjct: 121 LKRMLPY 127

>TPHA0F01880 Chr6 (428432..428731) [300 bp, 99 aa] {ON} Anc_2.151
          YNL122C
          Length = 99

 Score = 95.5 bits (236), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 46/69 (66%), Positives = 56/69 (81%), Gaps = 2/69 (2%)

Query: 26 LVFTRNLMKTHKGTAKRWKKTA--DGFKRGKAGRNHGNVGWSRRSLKVLSGKTPAHESHI 83
          L F R LMKTHKGTAKRWK  +  D FKRGK+GR HGN+GWS+RSLK LSG+T A ++H+
Sbjct: 30 LDFRRTLMKTHKGTAKRWKYISKLDTFKRGKSGRQHGNIGWSQRSLKTLSGRTYADKTHV 89

Query: 84 QRLRRLLPY 92
           +LR+LLPY
Sbjct: 90 SKLRKLLPY 98

>Suva_14.218 Chr14
           complement(394669..394965,394969..394983,394990..395013)
           [336 bp, 112 aa] {ON} YNL122C (REAL)
          Length = 112

 Score = 91.3 bits (225), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 42/66 (63%), Positives = 54/66 (81%)

Query: 27  VFTRNLMKTHKGTAKRWKKTADGFKRGKAGRNHGNVGWSRRSLKVLSGKTPAHESHIQRL 86
           +  R LMKTHKGTAKRW++T + FKRG AGR HGN+GWS RSLKVL+G+  A+ S+++ L
Sbjct: 46  ITIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKVLTGRKTANSSYLKHL 105

Query: 87  RRLLPY 92
           +RLLPY
Sbjct: 106 KRLLPY 111

>Skud_14.210 Chr14 complement(388110..388406,388410..388421) [309
           bp, 103 aa] {ON} YNL122C (REAL)
          Length = 103

 Score = 90.9 bits (224), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 53/66 (80%)

Query: 27  VFTRNLMKTHKGTAKRWKKTADGFKRGKAGRNHGNVGWSRRSLKVLSGKTPAHESHIQRL 86
           +  R LMKTHKGTAKRW++T + FKRG AGR HGN+GWS RSLK L+G+  AH ++++ L
Sbjct: 37  ITIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKTAHPAYLKHL 96

Query: 87  RRLLPY 92
           +RLLPY
Sbjct: 97  KRLLPY 102

>Smik_14.206 Chr14
           complement(377692..377997,378001..378009,378013..378036)
           [339 bp, 113 aa] {ON} YNL122C (REAL)
          Length = 113

 Score = 89.4 bits (220), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 53/66 (80%)

Query: 27  VFTRNLMKTHKGTAKRWKKTADGFKRGKAGRNHGNVGWSRRSLKVLSGKTPAHESHIQRL 86
           V  R LMKTHKGTAKRW++T + FKRG AGR HGN+GWS RSLK L+G+  A+ ++++ L
Sbjct: 47  VTIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKTANSAYLKHL 106

Query: 87  RRLLPY 92
           +RLLPY
Sbjct: 107 KRLLPY 112

>YNL122C Chr14 complement(398023..398370) [348 bp, 115 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to mitochondria;
           YNL122C is not an essential gene
          Length = 115

 Score = 88.6 bits (218), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 52/66 (78%)

Query: 27  VFTRNLMKTHKGTAKRWKKTADGFKRGKAGRNHGNVGWSRRSLKVLSGKTPAHESHIQRL 86
           +  R LMKTHKGTAKRW++T + FKRG AGR HGN+GWS RSLK L+G+  AH ++ + L
Sbjct: 49  ITIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKIAHPAYSKHL 108

Query: 87  RRLLPY 92
           +RLLPY
Sbjct: 109 KRLLPY 114

>TBLA0B01230 Chr2 complement(262437..262730) [294 bp, 97 aa] {ON}
          Anc_2.151 YNL122C
          Length = 97

 Score = 79.0 bits (193), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 48/67 (71%), Gaps = 7/67 (10%)

Query: 33 MKTHKGTAKRWKK-------TADGFKRGKAGRNHGNVGWSRRSLKVLSGKTPAHESHIQR 85
          +KTHKGT KRW++        A+ F R KAGRNHGN+GWS R+L  LS + PAH +H++ 
Sbjct: 31 LKTHKGTLKRWRRRVAPGGPAAEQFVRSKAGRNHGNIGWSHRALAALSRRVPAHSTHVKA 90

Query: 86 LRRLLPY 92
          LR+LLPY
Sbjct: 91 LRKLLPY 97

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.136    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,758,629
Number of extensions: 229408
Number of successful extensions: 485
Number of sequences better than 10.0: 20
Number of HSP's gapped: 481
Number of HSP's successfully gapped: 20
Length of query: 92
Length of database: 53,481,399
Length adjustment: 63
Effective length of query: 29
Effective length of database: 46,257,441
Effective search space: 1341465789
Effective search space used: 1341465789
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 59 (27.3 bits)