Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0G01606g5.443ON1305130566740.0
TDEL0D025805.443ON1272126043320.0
Suva_8.1765.443ON1270125737990.0
SAKL0G02728g5.443ON1237125237920.0
YOR124C (UBP2)5.443ON1272126537420.0
NCAS0H021005.443ON1269125937380.0
Smik_15.3015.443ON1272125737270.0
Skud_15.2865.443ON1278126237140.0
Kpol_1062.235.443ON1266128537080.0
KLTH0F15862g5.443ON1241125935640.0
NDAI0C015505.443ON1295125835550.0
Kwal_55.213935.443ON1233125135450.0
KAFR0D050705.443ON1227126734950.0
TBLA0A064705.443ON1320129434040.0
KNAG0B041905.443ON1262126633820.0
TPHA0E017105.443ON1283127833770.0
Ecym_45145.443ON1246127132280.0
CAGL0K10252g5.443ON1267128130690.0
ACL164C5.443ON138981220740.0
KLLA0E02377g5.443ON122081118640.0
Kpol_1016.15.443ON125178211091e-129
TPHA0J026205.443ON122579810371e-119
NCAS0D006001.369ON493551245e-06
NDAI0H035501.369ON502641238e-06
TBLA0C012001.369ON5031181221e-05
KNAG0C019401.369ON499551211e-05
KAFR0C045201.369ON4991071156e-05
TDEL0D024001.369ON494611157e-05
Kwal_34.162681.369ON449951157e-05
ZYRO0G01188g1.369ON500921131e-04
KNAG0J008003.270ON7652551112e-04
KLTH0H13354g1.369ON495951103e-04
TPHA0A025101.369ON505531103e-04
KLLA0A10791g1.369ON4841071093e-04
Smik_7.3141.369ON499881085e-04
SAKL0D10120g1.369ON492401076e-04
Smik_4.1152.307ON790841087e-04
Skud_4.1332.307ON787841077e-04
Suva_4.1252.307ON793841069e-04
Ecym_27171.369ON483331069e-04
Kpol_534.231.369ON496341069e-04
TPHA0P006807.390ON727791050.001
Kwal_27.114442.307ON757831050.001
YBL067C (UBP13)7.390ON747631050.001
Skud_2.387.390ON748611040.002
AEL029W1.369ON446501030.002
NDAI0B034302.307ON856631040.002
YDL122W (UBP1)2.307ON809841040.002
Suva_5.2177.390ON754781030.002
SAKL0E07106g2.307ON791841030.002
Kpol_1003.532.307ON788511030.002
Skud_6.941.369ON499331020.002
YFR010W (UBP6)1.369ON499331020.002
NCAS0E026107.390ON7171581020.003
Skud_5.2237.390ON748881020.003
KAFR0L017307.390ON701931020.003
Skud_13.4785.18ON12311061020.003
Smik_5.2447.390ON749781010.004
Ecym_40095.712ON1517441020.004
Suva_2.507.390ON750631010.004
KNAG0A054502.307ON764511010.004
CAGL0K10494g1.369ON495511000.004
Suva_13.4955.18ON12301061010.005
CAGL0H10582g2.307ON790511000.005
Smik_13.5215.18ON12311061000.005
YMR304W (UBP15)5.18ON12301061000.005
NDAI0G007802.307ON48666990.006
Smik_9.135.712ON1060531000.006
KLTH0G10934g2.307ON75851990.006
Suva_6.831.369ON50033990.007
NCAS0B061302.307ON77051990.007
Ecym_46857.390ON77842990.007
KNAG0F012202.69ON78472980.008
NCAS0D023905.18ON121199980.009
TBLA0B060802.307ON82465980.009
CAGL0M13783g5.18ON1196106980.009
AGR389C2.307ON77549970.010
KAFR0A069102.307ON67848970.010
KAFR0A075802.69ON80268970.012
Kpol_2001.541.137ON122329970.012
TDEL0G023702.307ON74753970.012
ZYRO0A05962g8.742ON46571950.017
TBLA0E017605.712ON121233960.018
TDEL0C056401.137ON117830960.018
TDEL0A011002.69ON66177950.018
KLLA0D08459g2.69ON75068950.019
ZYRO0A02420g2.307ON74551950.020
Smik_2.497.390ON74562950.021
TDEL0B020805.712ON102548950.022
TBLA0D010708.742ON48364940.024
ZYRO0D07062g5.18ON1193181950.024
Smik_13.4318.742ON47150930.026
TPHA0G008502.307ON78251940.027
KLLA0A00396g5.712ON101230940.028
Smik_10.371.137ON124730940.030
YJL197W (UBP12)1.137ON125430940.031
NCAS0G018002.69ON87568930.031
ZYRO0C17908g1.137ON120430930.034
Skud_10.221.137ON125530930.034
Suva_14.1562.69ON78868930.035
NDAI0F034102.69ON87066930.036
TBLA0B097602.69ON89873930.036
ABL145W2.69ON74968930.037
YIL156W (UBP7)5.712ON107153930.038
NCAS0G036802.307ON48256920.039
TPHA0L022905.18ON1193106930.041
CAGL0J11352g2.69ON77168920.041
Smik_14.1442.69ON76368920.044
NCAS0G001705.712ON103084920.045
KAFR0D021605.712ON84633920.047
KNAG0L022005.712ON116126920.049
TPHA0D046605.712ON104550920.051
KAFR0F015601.137ON117129910.057
NDAI0I025305.18ON1197106910.059
NDAI0F002005.712ON110547910.059
Suva_6.2761.137ON125649910.059
KAFR0I026005.18ON121395910.062
AGR370W7.390ON74031910.063
Skud_14.1482.69ON77668910.063
ZYRO0C09812g2.69ON70268900.067
KLTH0F03674g1.137ON119830910.069
Ecym_56715.18ON1176104910.071
SAKL0D03322g3.270ON76556900.072
Suva_9.305.712ON106250900.074
Kwal_33.144302.69ON51168900.075
Kpol_513.255.18ON119093900.078
SAKL0H00418g5.18ON119095900.079
Skud_9.125.712ON106439900.080
Kwal_55.196455.712ON97030900.081
Kpol_1044.242.69ON72468900.084
Kwal_27.108427.390ON71131890.088
Kwal_33.136281.137ON116030890.11
YER098W (UBP9)7.390ON75466880.12
TPHA0A025401.137ON128628890.12
Kwal_26.95985.18ON119195890.12
SAKL0E13002g2.69ON73968880.12
NCAS0I031401.137ON120130880.13
CAGL0M11198g8.742ON46171880.13
TBLA0C070205.18ON124758880.13
KLLA0C03476g1.137ON125229880.14
AFR296C5.712ON116930880.15
NCAS0A143707.390ON72931870.15
KNAG0E012905.18ON1196108880.15
KLTH0H07678g8.188ON86141870.17
NDAI0A016707.390ON84649870.17
KLTH0E00814g5.712ON97430870.18
KLTH0B07150g2.69ON75668870.18
Klac_YGOB_Anc_5.18b5.18ON116695870.18
CAGL0I05522g7.390ON72492870.19
KNAG0B023707.390ON75331860.20
TPHA0E008707.390ON71531860.21
AFR627C1.137ON128729860.22
YNL186W (UBP10)2.69ON79268860.22
Suva_11.3355.712ON72487860.22
KLLA0C06974g8.742ON44667850.22
Kpol_1045.417.390ON71229860.22
KNAG0C035807.390ON77694860.22
KAFR0A042108.742ON44061850.23
KLTH0B09944g5.18ON118958860.23
CAGL0A04477g7.390ON77090860.24
CAGL0H06721g5.712ON108126860.25
YKR098C (UBP11)5.712ON717102850.28
TBLA0D006207.390ON117131850.28
KAFR0C004103.270ON76967850.29
AGL357W5.18ON116695850.29
TDEL0G004105.18ON1186106850.29
YMR223W (UBP8)8.742ON47150850.29
KLLA0E08801g2.307ON77179850.30
Skud_13.3928.742ON47350840.31
NCAS0B005808.742ON466188840.32
KLLA0E20351g7.390ON69731850.32
Ecym_81401.137ON126437850.33
SAKL0E15136g5.712ON103730850.33
Suva_4.2953.270ON78267850.33
CAGL0L01639g1.137ON114727850.34
NDAI0E008108.742ON49348840.35
NDAI0B004801.137ON125329850.36
Suva_13.4078.742ON47150840.36
Kpol_1018.937.390ON75591840.38
SAKL0F12430g7.390ON75431840.39
CAGL0G05247g8.188ON94757840.39
KNAG0C021801.137ON123129840.40
ZYRO0B16544g5.712ON104426840.46
SAKL0C04246g1.137ON129729830.51
YDR069C (DOA4)8.188ON926108830.54
Skud_11.3385.712ON71297830.55
SAKL0H04994g8.742ON45451820.58
NDAI0A036808.188ON111667820.65
CAGL0G02563gsingletonON63129820.67
YER144C (UBP5)8.188ON80541810.80
Kpol_1032.288.188ON88268810.85
KLTH0C06732g7.390ON71431801.00
KLTH0E10626g8.457ON534114801.1
Suva_5.2728.188ON78841801.1
Skud_4.3238.188ON92672801.1
Skud_2.1773.270ON78239801.1
Kwal_26.91518.742ON45464801.1
Ecym_62488.742ON46664801.2
Suva_2.2288.188ON92772801.2
Skud_5.2818.188ON82341801.2
Kwal_56.230843.270ON762161801.2
Smik_4.3078.188ON92972801.3
TBLA0F036108.188ON114468801.4
ZYRO0B03300g7.390ON81331791.5
NDAI0E041807.390ON82767791.6
TPHA0O016402.69ON74685781.8
CAGL0I06765g8.188ON88775781.9
TBLA0J006001.137ON146229782.0
YBR136W (MEC1)3.401ON2368113782.1
TDEL0C015707.390ON76531772.3
Smik_2.1893.270ON78238772.4
KAFR0H001505.712ON65626772.4
KAFR0C025908.188ON97867772.5
Kwal_14.20088.188ON42437762.7
YKL155C (RSM22)5.264ON628154772.8
KNAG0D019308.188ON98653772.8
KNAG0G029308.742ON45951763.3
Smik_11.3625.712ON72180763.3
ZYRO0F01276g3.270ON77652763.4
TBLA0E025703.270ON78556763.5
Smik_5.3098.188ON80541763.9
TDEL0B036708.742ON46355754.1
KLTH0D12760g8.742ON45364754.1
KAFR0K018107.390ON71431754.3
Kpol_1064.488.742ON46664746.0
AFR551W8.742ON46966736.9
YBR058C (UBP14)3.270ON78152737.0
YDR001C (NTH1)3.205ON751103737.3
Suva_4.2543.205ON752134737.3
Smik_4.2363.205ON751134737.3
Kpol_251.73.270ON48021737.5
NCAS0I016203.270ON79527737.8
Kpol_1055.318.202ON82276738.0
Ecym_55448.202ON83468738.5
ZYRO0B11044g8.202ON82668729.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0G01606g
         (1305 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] ...  2575   0.0  
TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5....  1673   0.0  
Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {O...  1467   0.0  
SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] ...  1465   0.0  
YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}...  1446   0.0  
NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {...  1444   0.0  
Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] ...  1440   0.0  
Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] ...  1435   0.0  
Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON} (51365...  1432   0.0  
KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} sim...  1377   0.0  
NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....  1373   0.0  
Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR12...  1370   0.0  
KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {...  1350   0.0  
TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_...  1315   0.0  
KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5....  1307   0.0  
TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5....  1305   0.0  
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...  1248   0.0  
CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa...  1186   0.0  
ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON} Sy...   803   0.0  
KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] ...   722   0.0  
Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340...   431   e-129
TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] ...   404   e-119
NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.3...    52   5e-06
NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {O...    52   8e-06
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    52   1e-05
KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {O...    51   1e-05
KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500...    49   6e-05
TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 a...    49   7e-05
Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010...    49   7e-05
ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa] ...    48   1e-04
KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {...    47   2e-04
KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035) ...    47   3e-04
TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 a...    47   3e-04
KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [145...    47   3e-04
Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W ...    46   5e-04
SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [147...    46   6e-04
Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W ...    46   7e-04
Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W ...    46   7e-04
Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W ...    45   9e-04
Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar...    45   9e-04
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    45   9e-04
TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7....    45   0.001
Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {...    45   0.001
YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}  UB...    45   0.001
Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON} Y...    45   0.002
AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic ho...    44   0.002
NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}     45   0.002
YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}  UBP1Ubiqui...    45   0.002
Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W ...    44   0.002
SAKL0E07106g Chr5 complement(584164..586539) [2376 bp, 791 aa] {...    44   0.002
Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON} (1216...    44   0.002
Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}...    44   0.002
YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}  UBP6Ubiqui...    44   0.002
NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {O...    44   0.003
Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W ...    44   0.003
KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7....    44   0.003
Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR30...    44   0.003
Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W ...    44   0.004
Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to...    44   0.004
Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON} Y...    44   0.004
KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.3...    44   0.004
CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} hig...    43   0.004
Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR30...    44   0.005
CAGL0H10582g Chr8 complement(1029876..1032248) [2373 bp, 790 aa]...    43   0.005
Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR30...    43   0.005
YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}  UBP15Ubi...    43   0.005
NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON}               43   0.006
Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (R...    43   0.006
KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} simila...    43   0.006
Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}...    43   0.007
NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] ...    43   0.007
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    43   0.007
KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.6...    42   0.008
NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {...    42   0.009
TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON} Anc_2...    42   0.009
CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} si...    42   0.009
AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}...    42   0.010
KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] ...    42   0.010
KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa] ...    42   0.012
Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]...    42   0.012
TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.3...    42   0.012
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    41   0.017
TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {...    42   0.018
TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]...    42   0.018
TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.6...    41   0.018
KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {...    41   0.019
ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} simila...    41   0.020
Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON} Y...    41   0.021
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....    41   0.022
TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {O...    41   0.024
ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] ...    41   0.024
Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223...    40   0.026
TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.3...    41   0.027
KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar...    41   0.028
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    41   0.030
YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiqu...    41   0.031
NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69      40   0.031
ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa...    40   0.034
Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W ...    40   0.034
Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186...    40   0.035
NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {O...    40   0.036
TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] ...    40   0.036
ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic ho...    40   0.037
YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}  UBP7Ubiquit...    40   0.038
NCAS0G03680 Chr7 complement(682617..684065) [1449 bp, 482 aa] {O...    40   0.039
TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5...    40   0.041
CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa...    40   0.041
Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186...    40   0.044
NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712      40   0.045
KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.7...    40   0.047
KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] ...    40   0.049
TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]...    40   0.051
KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1....    40   0.057
NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5....    40   0.059
NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712      40   0.059
Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {O...    40   0.059
KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5....    40   0.062
AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic ...    40   0.063
Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186...    40   0.063
ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {...    39   0.067
KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} simil...    40   0.069
Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {...    40   0.071
SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} simila...    39   0.072
Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {O...    39   0.074
Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186...    39   0.075
Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON} (71125.....    39   0.078
SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar...    39   0.079
Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (R...    39   0.080
Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W ...    39   0.081
Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON} (56564....    39   0.084
Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {...    39   0.088
Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL19...    39   0.11 
YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiqui...    39   0.12 
TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1....    39   0.12 
Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]...    39   0.12 
SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]...    39   0.12 
NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {...    39   0.13 
CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} sim...    39   0.13 
TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_...    39   0.13 
KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} simil...    39   0.14 
AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON} ...    39   0.15 
NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7...    38   0.15 
KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {...    39   0.15 
KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} simila...    38   0.17 
NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {O...    38   0.17 
KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar ...    38   0.18 
KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {...    38   0.18 
Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [35...    38   0.18 
CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {...    38   0.19 
KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {O...    38   0.20 
TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {O...    38   0.21 
AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON...    38   0.22 
YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}  UBP10Ubiq...    38   0.22 
Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {...    38   0.22 
KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {...    37   0.22 
Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {O...    38   0.22 
KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {O...    38   0.22 
KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.7...    37   0.23 
KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] ...    38   0.23 
CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} simila...    38   0.24 
CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...    38   0.25 
YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON} ...    37   0.28 
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    37   0.28 
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    37   0.29 
AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic hom...    37   0.29 
TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON...    37   0.29 
YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}  UBP8Ubiqu...    37   0.29 
KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} simila...    37   0.30 
Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223...    37   0.31 
NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742       37   0.32 
KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} simi...    37   0.32 
Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON...    37   0.33 
SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa...    37   0.33 
Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON...    37   0.33 
CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} simi...    37   0.34 
NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {O...    37   0.35 
NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON...    37   0.36 
Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223...    37   0.36 
Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON} (2480...    37   0.38 
SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} simila...    37   0.39 
CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {...    37   0.39 
KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1....    37   0.40 
ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa...    37   0.46 
SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} simil...    37   0.51 
YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}  ...    37   0.54 
Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {...    37   0.55 
SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {...    36   0.58 
NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON}              36   0.65 
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...    36   0.67 
YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}  ...    36   0.80 
Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {O...    36   0.85 
KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {...    35   1.00 
KLTH0E10626g Chr5 (957868..959472) [1605 bp, 534 aa] {ON} simila...    35   1.1  
Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON...    35   1.1  
Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON...    35   1.1  
Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON...    35   1.1  
Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] ...    35   1.1  
Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar t...    35   1.2  
Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON...    35   1.2  
Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON...    35   1.2  
Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {...    35   1.2  
Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON...    35   1.3  
TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8....    35   1.4  
ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} simila...    35   1.5  
NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {O...    35   1.6  
TPHA0O01640 Chr15 complement(325844..328084) [2241 bp, 746 aa] {...    35   1.8  
CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} simila...    35   1.9  
TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1...    35   2.0  
YBR136W Chr2 (505668..512774) [7107 bp, 2368 aa] {ON}  MEC1Genom...    35   2.1  
TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {O...    34   2.3  
Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON...    34   2.4  
KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...    34   2.4  
KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {O...    34   2.5  
Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C...    34   2.7  
YKL155C Chr11 complement(159456..161342) [1887 bp, 628 aa] {ON} ...    34   2.8  
KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.1...    34   2.8  
KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.7...    34   3.3  
Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {...    34   3.3  
ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} simila...    34   3.4  
TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {O...    34   3.5  
Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON...    34   3.9  
TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {O...    33   4.1  
KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} simi...    33   4.1  
KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7....    33   4.3  
Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON} (88495....    33   6.0  
AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic ...    33   6.9  
YBR058C Chr2 complement(353672..356017) [2346 bp, 781 aa] {ON}  ...    33   7.0  
YDR001C Chr4 complement(450220..452475) [2256 bp, 751 aa] {ON}  ...    33   7.3  
Suva_4.254 Chr4 complement(447775..450033) [2259 bp, 752 aa] {ON...    33   7.3  
Smik_4.236 Chr4 complement(429539..431794) [2256 bp, 751 aa] {ON...    33   7.3  
Kpol_251.7 s251 (12280..13719) [1440 bp, 480 aa] {ON} (12280..13...    33   7.5  
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    33   7.8  
Kpol_1055.31 s1055 complement(78247..80715) [2469 bp, 822 aa] {O...    33   8.0  
Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar...    33   8.5  
ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {...    32   9.1  

>ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] {ON}
            similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124C UBP2 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions capable of cleaving
            polyubiquitin and possesses isopeptidase activity
          Length = 1305

 Score = 2575 bits (6674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1265/1305 (96%), Positives = 1265/1305 (96%)

Query: 1    MLLKDESSEPXXXXXXXXXXXXXDLPPELVETEQIGETMSESEISEDPGKNELLDTQDSG 60
            MLLKDESSEP             DLPPELVETEQIGETMSESEISEDPGKNELLDTQDSG
Sbjct: 1    MLLKDESSEPAVGGSARGVASSSDLPPELVETEQIGETMSESEISEDPGKNELLDTQDSG 60

Query: 61   KVPLYPEAAARFPFKTADRLLDDILHDLSFINSDDHSILYSDLSNGILKSPVLSYSRKVG 120
            KVPLYPEAAARFPFKTADRLLDDILHDLSFINSDDHSILYSDLSNGILKSPVLSYSRKVG
Sbjct: 61   KVPLYPEAAARFPFKTADRLLDDILHDLSFINSDDHSILYSDLSNGILKSPVLSYSRKVG 120

Query: 121  KTRAYNLGSLVDQVVLQTKFEYDSVSCPQHNHLQVFMGVLIDVTQQNVATFNNLATLPIF 180
            KTRAYNLGSLVDQVVLQTKFEYDSVSCPQHNHLQVFMGVLIDVTQQNVATFNNLATLPIF
Sbjct: 121  KTRAYNLGSLVDQVVLQTKFEYDSVSCPQHNHLQVFMGVLIDVTQQNVATFNNLATLPIF 180

Query: 181  HLKVTVKTRDVLERTKKKAGITHYHSLDESEIHPYDKQDLLTFDSKDPQLLDYAIYVSSD 240
            HLKVTVKTRDVLERTKKKAGITHYHSLDESEIHPYDKQDLLTFDSKDPQLLDYAIYVSSD
Sbjct: 181  HLKVTVKTRDVLERTKKKAGITHYHSLDESEIHPYDKQDLLTFDSKDPQLLDYAIYVSSD 240

Query: 241  SNKLILIEIFKPEFDSDEERDAFKEESINNRYEMACNRFDSLDPTRIPTQPDCINTLFKI 300
            SNKLILIEIFKPEFDSDEERDAFKEESINNRYEMACNRFDSLDPTRIPTQPDCINTLFKI
Sbjct: 241  SNKLILIEIFKPEFDSDEERDAFKEESINNRYEMACNRFDSLDPTRIPTQPDCINTLFKI 300

Query: 301  FKGPLNRKSSEEPRKTINPNNVSLNSHIDPTWLTSKYGFELHVEKDEETGEDILEYAPPD 360
            FKGPLNRKSSEEPRKTINPNNVSLNSHIDPTWLTSKYGFELHVEKDEETGEDILEYAPPD
Sbjct: 301  FKGPLNRKSSEEPRKTINPNNVSLNSHIDPTWLTSKYGFELHVEKDEETGEDILEYAPPD 360

Query: 361  LTNYHRDWKVRRLRESFTRRCLELIFLGRVSIRLLSQEAVNRNPKVYRIFSMMQTNFSTM 420
            LTNYHRDWKVRRLRESFTRRCLELIFLGRVSIRLLSQEAVNRNPKVYRIFSMMQTNFSTM
Sbjct: 361  LTNYHRDWKVRRLRESFTRRCLELIFLGRVSIRLLSQEAVNRNPKVYRIFSMMQTNFSTM 420

Query: 421  FWFQLLGEYRAIFSTESSSPLDSDHHFIDLSACYNYIDRDIIRNYEAQCTLDPENVGVYV 480
            FWFQLLGEYRAIFSTESSSPLDSDHHFIDLSACYNYIDRDIIRNYEAQCTLDPENVGVYV
Sbjct: 421  FWFQLLGEYRAIFSTESSSPLDSDHHFIDLSACYNYIDRDIIRNYEAQCTLDPENVGVYV 480

Query: 481  DALNFIANRKGAYQLIAYCGKQDFVGQEALDHALGVFQIDSKEFDPHNLNDSVLLSIYKN 540
            DALNFIANRKGAYQLIAYCGKQDFVGQEALDHALGVFQIDSKEFDPHNLNDSVLLSIYKN
Sbjct: 481  DALNFIANRKGAYQLIAYCGKQDFVGQEALDHALGVFQIDSKEFDPHNLNDSVLLSIYKN 540

Query: 541  ESASTRNPNRHAELKNSLRLLAKFKKSPKLKFYADYEPYRNVTQAYEILEVDESVDDDII 600
            ESASTRNPNRHAELKNSLRLLAKFKKSPKLKFYADYEPYRNVTQAYEILEVDESVDDDII
Sbjct: 541  ESASTRNPNRHAELKNSLRLLAKFKKSPKLKFYADYEPYRNVTQAYEILEVDESVDDDII 600

Query: 601  QTAYTVKVNDSPGLKIDCDRALYTIAVHSRSLALFNFLVQQSEEFQEYFGPDQFSYQDAL 660
            QTAYTVKVNDSPGLKIDCDRALYTIAVHSRSLALFNFLVQQSEEFQEYFGPDQFSYQDAL
Sbjct: 601  QTAYTVKVNDSPGLKIDCDRALYTIAVHSRSLALFNFLVQQSEEFQEYFGPDQFSYQDAL 660

Query: 661  SVLQVNENAGDDTILEIFQRKWYKEPVFDADQFLKLKGALSKIGFERNSKLISHFIDTGT 720
            SVLQVNENAGDDTILEIFQRKWYKEPVFDADQFLKLKGALSKIGFERNSKLISHFIDTGT
Sbjct: 661  SVLQVNENAGDDTILEIFQRKWYKEPVFDADQFLKLKGALSKIGFERNSKLISHFIDTGT 720

Query: 721  VDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQEYASR 780
            VDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQEYASR
Sbjct: 721  VDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQEYASR 780

Query: 781  RIGGREITEAEVERSVQFVYQLRDLFDSMIHAQDRCVTPRKELAYLAFVPSGLGVEFELP 840
            RIGGREITEAEVERSVQFVYQLRDLFDSMIHAQDRCVTPRKELAYLAFVPSGLGVEFELP
Sbjct: 781  RIGGREITEAEVERSVQFVYQLRDLFDSMIHAQDRCVTPRKELAYLAFVPSGLGVEFELP 840

Query: 841  NASQANANAPVEKENYVXXXXXXXXXXXXXXXXXXXXXXXXXXXHSKLNKNSNDDGKINE 900
            NASQANANAPVEKENYV                           HSKLNKNSNDDGKINE
Sbjct: 841  NASQANANAPVEKENYVNIDSEPSPPPNDEPLLIDLDDDSDPNNHSKLNKNSNDDGKINE 900

Query: 901  FDNSQAGENDVDVDISMTDSPAEEEKVTKADSGSSSNNSNKAVAMNTSTRVAKISSDQLE 960
            FDNSQAGENDVDVDISMTDSPAEEEKVTKADSGSSSNNSNKAVAMNTSTRVAKISSDQLE
Sbjct: 901  FDNSQAGENDVDVDISMTDSPAEEEKVTKADSGSSSNNSNKAVAMNTSTRVAKISSDQLE 960

Query: 961  NALEMGRQQDVTECIGNVLFQLESASDPISLGDDNEQNDLVKQLFYGNIKQNIIPLKDET 1020
            NALEMGRQQDVTECIGNVLFQLESASDPISLGDDNEQNDLVKQLFYGNIKQNIIPLKDET
Sbjct: 961  NALEMGRQQDVTECIGNVLFQLESASDPISLGDDNEQNDLVKQLFYGNIKQNIIPLKDET 1020

Query: 1021 QVRTKYERFLSLLVNIGDHPKDIYDALDLYFRDEYLKLEEYGDVKRTVAVTDFPTILQIQ 1080
            QVRTKYERFLSLLVNIGDHPKDIYDALDLYFRDEYLKLEEYGDVKRTVAVTDFPTILQIQ
Sbjct: 1021 QVRTKYERFLSLLVNIGDHPKDIYDALDLYFRDEYLKLEEYGDVKRTVAVTDFPTILQIQ 1080

Query: 1081 IQRVYYDRERFMPFKSVAPLPFNETIYMDRYSDTNNPVLINRKRETEKLVQELNGLKGRQ 1140
            IQRVYYDRERFMPFKSVAPLPFNETIYMDRYSDTNNPVLINRKRETEKLVQELNGLKGRQ
Sbjct: 1081 IQRVYYDRERFMPFKSVAPLPFNETIYMDRYSDTNNPVLINRKRETEKLVQELNGLKGRQ 1140

Query: 1141 RELLSKNELGLSRKGALIETSNFLKSDVLETQGIQIDNRTGLAQELDNIVLGINDELSQL 1200
            RELLSKNELGLSRKGALIETSNFLKSDVLETQGIQIDNRTGLAQELDNIVLGINDELSQL
Sbjct: 1141 RELLSKNELGLSRKGALIETSNFLKSDVLETQGIQIDNRTGLAQELDNIVLGINDELSQL 1200

Query: 1201 YHNITQLESKISHQFDDFKSIGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDET 1260
            YHNITQLESKISHQFDDFKSIGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDET
Sbjct: 1201 YHNITQLESKISHQFDDFKSIGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDET 1260

Query: 1261 ITEVPESEVFNFSEGNTATPYFLVYVKQGHEQEIEPLKRVLEVTV 1305
            ITEVPESEVFNFSEGNTATPYFLVYVKQGHEQEIEPLKRVLEVTV
Sbjct: 1261 ITEVPESEVFNFSEGNTATPYFLVYVKQGHEQEIEPLKRVLEVTV 1305

>TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5.443
            YOR124C
          Length = 1272

 Score = 1673 bits (4332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 806/1260 (63%), Positives = 993/1260 (78%), Gaps = 55/1260 (4%)

Query: 54   LDTQDSGKVPLYPEAAARFPFKTADRLLDDILHDLSFINSDDHSILYSDLSNGILKSPVL 113
            L  +DSGK  LY E + +FPFKT+DRLLDD++HDL+FINS DH ILYSDL NGILK+PVL
Sbjct: 55   LTHRDSGKEVLYREVSTKFPFKTSDRLLDDLIHDLAFINSKDHDILYSDLHNGILKAPVL 114

Query: 114  SYSRKVGKTRAYNLGSLVDQVVLQTKFEYDSVSCPQHNHLQVFMGVLIDVTQQNVATFNN 173
            +YSR++ +   Y+ G+LVDQ+ LQT FEY S+SCP HN L V+MGVLIDV      T + 
Sbjct: 115  AYSRRISQLYPYSFGTLVDQITLQTSFEYPSISCPGHNKLNVYMGVLIDVPHDYKITSST 174

Query: 174  LATLPIFHLKVTVKTRDVLERTKKKAGITHYHSLDESEIHPYDKQDLLTFDSKDPQLLDY 233
            L+   ++HLKVTVKTR +LE TKKKAG+THYH + E+++H +D+QDL  FD  DP+L+D+
Sbjct: 175  LSENTVYHLKVTVKTRSILEHTKKKAGVTHYHCISEADLHQFDRQDL-EFDPTDPRLVDH 233

Query: 234  AIYVSSDSNKLILIEIFKPEFDSDEERDAFKEESINNRYEMACNRFDSLDPTRIPTQPDC 293
            AIYVSSD+NKL+LIE+F PEFD +E+ + +   +I  RY  AC RFD+LDP+ IPTQ DC
Sbjct: 234  AIYVSSDTNKLVLIEVFLPEFDREEKTECWSGTAIKTRYSEACQRFDTLDPSEIPTQADC 293

Query: 294  INTLFKIFKGPLNRKSSEEPRKTINPNNVSLNSHIDPTWLTSKYGFELHVEKDEETGEDI 353
            INTL KIF+GPLNR++SEEP KTIN +NV LNS I+P WLTSKYGFELHVEKDE TGE  
Sbjct: 294  INTLLKIFRGPLNRQNSEEPLKTINSDNVVLNSRINPNWLTSKYGFELHVEKDESTGESY 353

Query: 354  LEYAPPDLTNYHRDWKVRRLRESFTRRCLELIFLGRVSIRLLSQEAVNRNPKVYRIFSMM 413
             E+ PP+LTNY  D KVRRLRESF R+C+ELIFLG+ +I LL ++A     KVYR F+ +
Sbjct: 354  FEFEPPNLTNYIEDRKVRRLRESFIRKCIELIFLGKTAIELLGKDA-KTTSKVYRTFNAI 412

Query: 414  QTNFSTMFWFQLLGEYRAIFSTESSSPLDSDHHFIDLSACYNYIDRDIIRNYEAQCTLDP 473
            Q  FS   WF++LGE+R+IFS ES+SPLD++++FI+LSAC+ YIDRDII+NYEAQC LDP
Sbjct: 413  QIAFSKTTWFKMLGEHRSIFSFESASPLDANYNFINLSACFYYIDRDIIKNYEAQCALDP 472

Query: 474  ENVGVYVDALNFIANRKGAYQLIAYCGKQDFVGQEALDHALGVFQIDSKEFDPHNLNDSV 533
            EN G+Y DAL +IANRKGAYQL+AYCGKQD VGQEALD AL +F IDSK+ D   ++DS+
Sbjct: 473  ENTGIYFDALTYIANRKGAYQLVAYCGKQDVVGQEALDQALKLFGIDSKDVDVATIDDSL 532

Query: 534  LLSIYKNESASTRNPNRHAELKNSLRLLAKFKKSPKLKFYADYEPYRNVTQAYEILEVDE 593
            L+SIYK+E+ +  N NRH +LKN+LRLLAK+KKS KLKF+ADYEPY+NV++AYEILEVDE
Sbjct: 533  LVSIYKSETMANPNENRHTDLKNALRLLAKYKKSDKLKFFADYEPYKNVSRAYEILEVDE 592

Query: 594  SVDDDIIQTAYTVKVNDSPGLKIDCDRALYTIAVHSRSLALFNFLVQQSEEFQEYFGPDQ 653
            SVDDDII+TAY++ +NDSPGLKIDCDRALYTI V  RSL L N+L+QQ  +FQ Y+GP  
Sbjct: 593  SVDDDIIETAYSISINDSPGLKIDCDRALYTIGVRKRSLRLLNYLLQQCPDFQLYYGPGT 652

Query: 654  FSYQDALSVLQVNENAGDDTILEIFQRKWYKEPVFDADQFLKLKGALSKIGFERNSKLIS 713
              Y +ALS+LQ+NENAGD+T+LE+FQRKW++E  F++D  LKLK AL+KIG ERNSKLI 
Sbjct: 653  LLYSEALSMLQLNENAGDETVLEVFQRKWHQETAFESDYLLKLKAALTKIGIERNSKLIL 712

Query: 714  HFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLN 773
            HFIDTGT+DASCLPA+NWPTGLNNIGNTCYLNSLLQYYFS++ LR+YVL+Y+ T++HF +
Sbjct: 713  HFIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETMEHFRH 772

Query: 774  NQEYASRRIGGREITEAEVERSVQFVYQLRDLFDSMIHAQDRCVTPRKELAYLAFVPSGL 833
            +     RRIGGRE++EAEVERSVQFVYQLRDLF +MI++++RCVTPRKELAYLAF PS  
Sbjct: 773  HTGNELRRIGGREVSEAEVERSVQFVYQLRDLFQAMIYSKERCVTPRKELAYLAFAPSNF 832

Query: 834  GVEFELPNASQANANAPVEKENYVXXXXXXXXXXXXXXXXXXXXXXXXXXXHSKLNKNSN 893
             VEFE    +  NA   V                                  SK+ +++N
Sbjct: 833  EVEFE---PTTVNAQHEV----------------------------------SKIAESTN 855

Query: 894  DD----GKINEFDNSQAG-------ENDVDVDISMTDSPAEEEKVTKADSGSSSNNSNKA 942
            +D    G  N  DN Q G         + D+D+SMT  P+EE K     S +  +N    
Sbjct: 856  NDILMYGPTNRSDNDQTGPIELDSDSGNEDIDVSMTKEPSEEYKEDIPMSDAEKDN---- 911

Query: 943  VAMNTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPISLGDDNEQNDLVK 1002
              ++TSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPI+L +DNEQNDLVK
Sbjct: 912  -IISTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPINLDEDNEQNDLVK 970

Query: 1003 QLFYGNIKQNIIPLKDETQVRTKYERFLSLLVNIGDHPKDIYDALDLYFRDEYLKLEEYG 1062
            QLFYG IKQ IIPL   T+++TK ER+LSLLVNIGDHPKDIYDALD YF DE L + EYG
Sbjct: 971  QLFYGKIKQTIIPLAKSTEIQTKIERYLSLLVNIGDHPKDIYDALDSYFSDERLTMAEYG 1030

Query: 1063 DVKRTVAVTDFPTILQIQIQRVYYDRERFMPFKSVAPLPFNETIYMDRYSDTNNPVLINR 1122
            DVKRTVAVT+FPTILQIQIQRVYYDRERFMPFKS+ PLPFNE +YMDRYSD+ +P ++ +
Sbjct: 1031 DVKRTVAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFNEVLYMDRYSDSQDPKMVEK 1090

Query: 1123 KRETEKLVQELNGLKGRQRELLSKNELGLSRKGALIETSNFLKSDVLETQGIQIDNRTGL 1182
            K+E+E+L  +L+ LK RQ+ELLS NELGLSRK A +ET N+LKSD++++Q ++  N   L
Sbjct: 1091 KKESEQLKAQLSRLKIRQKELLSVNELGLSRKAAYMETINYLKSDLIKSQELKGLNNDFL 1150

Query: 1183 AQELDNIVLGINDELSQLYHNITQLESKISHQFDDFKSIGYSLFAVFIHRGEASYGHYWI 1242
             ++L   +  I+ EL+ LYH+I +LE+ I  QF++FK IGYSLFAVFIHRGEASYGHYW+
Sbjct: 1151 IEQLKQSIADIDQELTSLYHDIAKLENTIDKQFEEFKKIGYSLFAVFIHRGEASYGHYWV 1210

Query: 1243 YIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPYFLVYVKQGHEQEIEPLKRVLE 1302
            YIKDR K+G WRKYNDETITEVPE+EVFNF+EGNTATPYFLVYV+QGHE +IEPLKR+++
Sbjct: 1211 YIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATPYFLVYVRQGHEHDIEPLKRIID 1270

>Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {ON}
            YOR124C (REAL)
          Length = 1270

 Score = 1467 bits (3799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 731/1257 (58%), Positives = 925/1257 (73%), Gaps = 52/1257 (4%)

Query: 58   DSGKVPLYPEAAARFPFKTADRLLDDILHDLSFINSDDHSILYSDL-SNGILKSPVLSYS 116
            D GK  LYP+ A   P KT+DRLLDDIL D +F NS D S++   L ++GILK  +LSYS
Sbjct: 54   DDGKHLLYPDIATYLPLKTSDRLLDDILCDTAFFNSTDPSVIERGLQTSGILKKSMLSYS 113

Query: 117  RKVGKTRAYNLGSLVDQVVLQTKFEYDSVSCPQHNHLQVFMGVLID--VTQQNVATFNNL 174
                + R   LGSL DQVVLQTK EYDS+SCPQ+N +QV   V+ +  + +Q +A F+++
Sbjct: 114  NFRSRIRPDALGSLTDQVVLQTKTEYDSISCPQYNKIQVLQAVIFNPSLPEQQIAAFDDI 173

Query: 175  ATLPIFHLKVTVKTRDVLERTKKKAGITHYHSLDESEIHPYDKQDLLTFDSKDPQLLDYA 234
              +PI+HLKVTVK R  LER KK  G+T +H+LD   +H YD  DL TFDS DP L DY 
Sbjct: 174  VKIPIYHLKVTVKIRQELERLKKHVGVTQFHALDH--LHEYDLADLSTFDSSDPNLKDYG 231

Query: 235  IYVSSDSNKLILIEIFKPEFDSDEERDAFKEESINNRYEMACNRFDSLDPTRIPTQPDCI 294
            IYVS D+NKLILIEIF PEFDS EERD+F   +I  RY   C + +SL+    P+QPDC 
Sbjct: 232  IYVSDDTNKLILIEIFNPEFDSPEERDSFTTAAIQKRYNDVCLKNESLNENETPSQPDCF 291

Query: 295  NTLFKIFKGPLNRKSSEEPRKTINPNNVSLNSHIDPTWLTSKYGFELHVEKDEETGEDIL 354
             TLFKIFKGPL RKS+ +P KTI+  N+ LN+H++P WLTSKYGF+   E DEET E   
Sbjct: 292  YTLFKIFKGPLARKSTADPIKTIDSGNIVLNTHLNPEWLTSKYGFQASSEIDEETNESFT 351

Query: 355  EYAPPDLTNYHRDWKVRRLRESFTRRCLELIFLGRVSIRLLSQEAVNRNPKVYRIFSMMQ 414
            EY PPD+ +Y  DWK+R++RES+ R+CL+LIF G++S  LL+  ++ +N K  +  S +Q
Sbjct: 352  EYVPPDMVDYVGDWKIRKIRESYVRKCLQLIFWGQLSASLLAPNSLLKNTKSVKGLSSIQ 411

Query: 415  TNFSTMFWFQLLGEYRAI----FSTESSSPLDSDHHFIDLSACYNYIDRDIIRNYEAQCT 470
            T+FS + WFQLLGE RA     F+ ++ SPLD++ HFI+LS  + Y DRDIIRNYEA  +
Sbjct: 412  TSFSILPWFQLLGESRARILLNFNEQAHSPLDAEPHFINLSVSHYYTDRDIIRNYEALSS 471

Query: 471  LDPENVGVYVDALNFIANRKGAYQLIAYCGKQDFVGQEALDHALGVFQIDSKEFDPHNLN 530
            LDPEN+G+Y DAL +IANRKGAYQ+IAYCGKQD +GQEAL++AL VF+ID K++D   LN
Sbjct: 472  LDPENIGLYFDALTYIANRKGAYQIIAYCGKQDIIGQEALENALMVFKIDPKDYDIAELN 531

Query: 531  DSVLLSIYKNESASTRNP--NRHAELKNSLRLLAKFKKSPKLKFYADYEPYRNVTQAYEI 588
            ++ LLSIYK E+++      N    LKN+LRLLAK+ KS KLKFY D+EPYR ++QAY+ 
Sbjct: 532  EATLLSIYKFETSNKNKAASNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDT 591

Query: 589  LEVDESVDDDIIQTAYTVKVNDSPGLKIDCDRALYTIAVHSRSLALFNFLVQQSEEFQEY 648
            L +DESVD+DII+TAY++K+NDSPGLK+DCDRALYTIA+  RSL LFNFL  +  +FQ Y
Sbjct: 592  LAIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFQNY 651

Query: 649  FGPDQFSYQDALSVLQVNENAGDDTILEIFQRKWYKEPVFDADQFLKLKGALSKIGFERN 708
            +GP++  YQ+AL +LQVNENA D+TIL+IF+ KW+ E V++ DQFL LK AL+KI  ERN
Sbjct: 652  YGPEKLDYQEALKLLQVNENASDETILKIFKGKWFDENVYEPDQFLILKAALTKISIERN 711

Query: 709  SKLISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTV 768
            S LI++F+ TGT+D + LP ENWPTG+NNIGNTCYLNSLLQYYFSI+ LR Y+L+Y+ T+
Sbjct: 712  SNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTL 771

Query: 769  QHF---LNNQEYASRRIGGREITEAEVERSVQFVYQLRDLFDSMIHAQDRCVTPRKELAY 825
             +F   L+N E+  RR+GGREI+E EVERS+QF++QLR+LF +M+H+++RCVTP KELAY
Sbjct: 772  NNFNDHLSNSEHV-RRVGGREISEGEVERSIQFIHQLRNLFYAMVHSRERCVTPSKELAY 830

Query: 826  LAFVPSGLGVEFELPNASQANANAPVEKENYVXXXXXXXXXXXXXXXXXXXXXXXXXXXH 885
            LAF PS + VEFE+    ++N +A + KE                               
Sbjct: 831  LAFAPSNVEVEFEVEGNKESN-DATILKE-------------EETGGANAINEQDPILID 876

Query: 886  SKLNKNSNDDGKINEFDNSQAGENDVDVDISMTDSPAEEEKVTKADSGSSSNNSNKAVAM 945
             ++++N+N D + +E ++ +   N  DV+I MTD                      A  +
Sbjct: 877  FEVDENTNGDVEKDENNHEKTESN--DVEIIMTDD---------------------ATDL 913

Query: 946  NTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPISLGDDNEQNDLVKQLF 1005
             + TRVAKISSDQLENALEMGRQQDVTECIGNVLFQ+ES S+PI   +DNEQ DL+KQLF
Sbjct: 914  ASPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLIKQLF 973

Query: 1006 YGNIKQNIIPLKDETQVRTKYERFLSLLVNIGDHPKDIYDALDLYFRDEYLKLEEYGDVK 1065
            YG  KQ I+PL    +VRTK ERFLSLLVNIGDHPKDIYDA D YFRDEYL + EYGDVK
Sbjct: 974  YGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFRDEYLTMAEYGDVK 1033

Query: 1066 RTVAVTDFPTILQIQIQRVYYDRERFMPFKSVAPLPFNETIYMDRYSDTNNPVLINRKRE 1125
            RTVAVT FPTILQ+QIQRVYYDRERFMPFKS+ PLPF E IYMDRY+DT+N  L+ +K E
Sbjct: 1034 RTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYADTDNLTLLAKKEE 1093

Query: 1126 TEKLVQELNGLKGRQRELLSKNELGLSRKGALIETSNFLKSDVLETQGIQIDNRTGLAQE 1185
            TE+L Q+   +K RQRELL+++  GL+RK A +ET   L+S ++E   + I+++  L + 
Sbjct: 1094 TEQLKQKSKDMKNRQRELLNRDGSGLTRKDAFLETIKLLESSIVENTVLNIEDKKNLIKT 1153

Query: 1186 LDNIVLGINDELSQLYHNITQLESKISHQFDDFKSIGYSLFAVFIHRGEASYGHYWIYIK 1245
            L N V  I++EL  LY +I  LE KISHQFDDFK  GYSLF+VFIHRGEASYGHYWIYIK
Sbjct: 1154 LKNKVTDIDNELMSLYSDINSLEDKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIK 1213

Query: 1246 DRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPYFLVYVKQGHEQEIEPLKRVLE 1302
            DR ++G+WRKYNDETI+EVPE EVFNF+EGNTATPYFLVYVKQG E +IEPLKR+LE
Sbjct: 1214 DRNQNGVWRKYNDETISEVPEEEVFNFNEGNTATPYFLVYVKQGQEADIEPLKRILE 1270

>SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] {ON}
            similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124C UBP2 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions capable of cleaving
            polyubiquitin and possesses isopeptidase activity
          Length = 1237

 Score = 1465 bits (3792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 735/1252 (58%), Positives = 928/1252 (74%), Gaps = 56/1252 (4%)

Query: 58   DSGKVPLYPEAAARFPFKTADRLLDDILHDLSFINSDDHSILYSDLSNGILKSPVLSYSR 117
            D GK  LYP     FPFKT+DRLLDDI  D+ F+NS++H ILYS L NG+L+ P+L YSR
Sbjct: 34   DDGKTLLYPGVHLNFPFKTSDRLLDDIRSDMFFLNSEEHDILYSQLHNGVLRLPMLEYSR 93

Query: 118  KVGKTRAYNLGSLVDQVVLQTKFEYDSVSCPQHNHLQVFMGVLIDVTQQNV--ATFNNLA 175
            K   T+  ++G L+DQV L+TK+EY+S +CP+ N + VFMGVL+D   Q++   + +++ 
Sbjct: 94   K-KTTQPCSVGYLLDQVTLKTKYEYESKTCPELNKINVFMGVLVD---QHIRPESLDDVI 149

Query: 176  TLPIFHLKVTVKTRDVLERTKKKAGITHYHSLDESEIHPYDKQDLLTFDSKDPQLLDYAI 235
             +PI+HLK+TVKTR  LER KK  G+THYH +D+  +H +DKQD+    ++  QL+D A 
Sbjct: 150  NVPIYHLKITVKTRLHLERVKKHVGVTHYHLIDQ--LHSFDKQDIF-MTTESEQLVDSAT 206

Query: 236  YVSSDSNKLILIEIFKPEFDSDEERDAFKEESINNRYEMACNRFDSLDPTRIPTQPDCIN 295
            YVSSD+N+L+ IEIFKPEF + E+   F +E +  RY  AC +F  LDPT +PTQ +C+N
Sbjct: 207  YVSSDTNRLLRIEIFKPEF-TKEDLAIFSQEKVKERYASACEKFQDLDPTSVPTQVECLN 265

Query: 296  TLFKIFKGPLNRKSSEEPRKTINPNNVSLNSHIDPTWLTSKYGFELHVEKDEETGEDILE 355
            TLFKIFKGPLNR+SSE+  KTI+ +N  LNS IDP+WLT KY F+L    DEETGE I E
Sbjct: 266  TLFKIFKGPLNRRSSEDILKTISADNKFLNSQIDPSWLTEKYDFKLVETTDEETGELIRE 325

Query: 356  YAPPDLTNYHRDWKVRRLRESFTRRCLELIFLGRVSIRLLSQEAVNRNPKVYRIFSMMQT 415
            + PPDLT+Y +DW VR  RES+TR+CLELIFLG+ S +LL ++ ++++ K  R F++ QT
Sbjct: 326  FEPPDLTDYVQDWSVRSKRESYTRKCLELIFLGKTSAQLLPKDILSKDSKS-RSFNLYQT 384

Query: 416  NFSTMFWFQLLGEYRAIFSTESSSPLDSDHHFIDLSACYNYIDRDIIRNYEAQCTLDPEN 475
            NFST FWF LLG+ R         P D+D+HFI+LSA   Y D+DII+NYE Q +LDPEN
Sbjct: 385  NFSTSFWFHLLGDGRNFQDHNLQQPFDNDYHFINLSASSYYSDKDIIKNYETQISLDPEN 444

Query: 476  VGVYVDALNFIANRKGAYQLIAYCGKQDFVGQEALDHALGVFQIDSKEFDPHNLNDSVLL 535
            VG+Y DALN+IAN KG YQLIAYCGKQ+ VG+EALD AL VF IDSK+ D  ++ D +LL
Sbjct: 445  VGIYFDALNYIANTKGGYQLIAYCGKQNIVGKEALDGALTVFGIDSKDTDVKSITDELLL 504

Query: 536  SIYKNESASTRNPNRHAELKNSLRLLAKFKKSPKLKFYADYEPYRNVTQAYEILEVDESV 595
            SIYKNE  +     R  +LKN+LRLLAKFK+S KLKF+ DYEPY + ++AY++LE+ ESV
Sbjct: 505  SIYKNELKAASVQKR-TDLKNALRLLAKFKESKKLKFHVDYEPYTSTSKAYQLLEIGESV 563

Query: 596  DDDIIQTAYTVKVNDSPGLKIDCDRALYTIAVHSRSLALFNFLVQQSEEFQEYFGPDQFS 655
            D DIIQTAYT++V D+PGLKIDCDRALYT+AV  RSL LFNFL Q+   FQE++  D +S
Sbjct: 564  DLDIIQTAYTIRVADAPGLKIDCDRALYTLAVAKRSLVLFNFLTQECPIFQEFYNIDNWS 623

Query: 656  YQDALSVLQVNENAGDDTILEIFQRKWYKEPVFDADQFLKLKGALSKIGFERNSKLISHF 715
            Y++ALS+LQVNENA DD ILEIFQRKW +EP+   DQFL LK AL+K+G ERNSKLI++F
Sbjct: 624  YKEALSLLQVNENATDDVILEIFQRKWSQEPMTSPDQFLILKTALTKLGIERNSKLINNF 683

Query: 716  IDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHF---- 771
            IDTG VD SCLPA NWPTGLNNIGNTCYLNSLLQYYFSIS LR YVL+Y+  +  F    
Sbjct: 684  IDTGIVDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFSISPLRDYVLNYQKMLNCFRDIE 743

Query: 772  -LNNQEYASRRIGGREITEAEVERSVQFVYQLRDLFDSMIHAQDRCVTPRKELAYLAFVP 830
                 E + RRIG RE+++ EVERSVQFVYQLRDLF  M+H ++R VTP KELAYLAF P
Sbjct: 744  DATGGEISKRRIGSREVSKPEVERSVQFVYQLRDLFRDMVHTKERFVTPTKELAYLAFAP 803

Query: 831  SGLGVEFELPNASQANANAPVEKENYVXXXXXXXXXXXXXXXXXXXXXXXXXXXHSKLNK 890
            S + VEFE P  +        E+ N +                                 
Sbjct: 804  SNIEVEFEAPTITTVAPEDLDERTNKLDIIDLAA-------------------------- 837

Query: 891  NSNDDGKINEFDNSQAGENDVDVDISMTDSPAEEEKVTKADSGSSSNNSNKAVAMNTSTR 950
                DG  NE   ++ G     +D+     P  EE+      G +        A+N S R
Sbjct: 838  ----DGIDNE---TEKGSKSSLLDVHNQQKP--EEQTEDIIMGGTQEEE----AVNASMR 884

Query: 951  VAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPISLGDDNEQNDLVKQLFYGNIK 1010
            VAKISSDQLEN LE+GRQQDVTECIGNVLFQLESASDP SL +DNEQ+DL+K+LFYG IK
Sbjct: 885  VAKISSDQLENTLELGRQQDVTECIGNVLFQLESASDPWSLEEDNEQHDLIKELFYGKIK 944

Query: 1011 QNIIPLKDETQVRTKYERFLSLLVNIGDHPKDIYDALDLYFRDEYLKLEEYGDVKRTVAV 1070
            Q++IP+K+ +++RTK ERF+SLLVNIGDHPKDIYDALDLYF+D+ L+L+E G+VKRTVAV
Sbjct: 945  QHLIPVKNPSKIRTKIERFVSLLVNIGDHPKDIYDALDLYFKDDLLQLDEDGEVKRTVAV 1004

Query: 1071 TDFPTILQIQIQRVYYDRERFMPFKSVAPLPFNETIYMDRYSDTNNPVLINRKRETEKLV 1130
            T+ P ILQIQIQRVYYDRERFMPFKS+ PLPF+ETIYMDRY DT++PV++ ++ +T+KL 
Sbjct: 1005 TNLPKILQIQIQRVYYDRERFMPFKSIEPLPFSETIYMDRYMDTDDPVMLAKRDDTKKLK 1064

Query: 1131 QELNGLKGRQRELLSKNELGLSRKGALIETSNFLKSDVLETQGIQIDNRTGLAQELDNIV 1190
            +EL  LK RQ +LLSKN+ GLS KG+L++T  FL+S+VL+   I ++N+  L   +D+++
Sbjct: 1065 EELRALKDRQHQLLSKNDTGLSFKGSLLQTKKFLQSEVLDKHEIAVENKGALVCHIDSMI 1124

Query: 1191 LGINDELSQLYHNITQLESKISHQFDDFKSIGYSLFAVFIHRGEASYGHYWIYIKDRYKS 1250
              I+ ELS LY  IT LE +I++QF++F  IGYSLFA FIHRGEASYGHYWIYIKDR K+
Sbjct: 1125 TKIDGELSSLYQKITALEVQIANQFNEFTKIGYSLFAAFIHRGEASYGHYWIYIKDRKKN 1184

Query: 1251 GIWRKYNDETITEVPESEVFNFSEGNTATPYFLVYVKQGHEQEIEPLKRVLE 1302
            GIWRKYNDE++TEVP+SEVFNF+EGNTATPYFLVY+K+GHE EIEPLKRV++
Sbjct: 1185 GIWRKYNDESVTEVPQSEVFNFTEGNTATPYFLVYIKEGHEDEIEPLKRVIK 1236

>YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}
            UBP2Ubiquitin-specific protease that removes ubiquitin
            from ubiquitinated proteins; interacts with Rsp5p and is
            required for MVB sorting of membrane proteins; can cleave
            polyubiquitin and has isopeptidase activity
          Length = 1272

 Score = 1446 bits (3742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 722/1265 (57%), Positives = 918/1265 (72%), Gaps = 66/1265 (5%)

Query: 58   DSGKVPLYPEAAARFPFKTADRLLDDILHDLSFINSDDHSILYSDL-SNGILKSPVLSYS 116
            D GK  LYP+ A   P KT+DRLLDDIL D  F+NS D  ++   L S GILK  +LSYS
Sbjct: 54   DDGKHLLYPDIATNLPLKTSDRLLDDILCDTIFLNSTDPKVMQKGLQSRGILKESMLSYS 113

Query: 117  RKVGKTRAYNLGSLVDQVVLQTKFEYDSVSCPQHNHLQVFMGVLID--VTQQNVATFNNL 174
                  R   LGSL DQVV QTK EYDS+SCP++N + VF  V+ +  + +Q ++TF+++
Sbjct: 114  TFRSSIRPNCLGSLTDQVVFQTKSEYDSISCPKYNKIHVFQAVIFNPSLAEQQISTFDDI 173

Query: 175  ATLPIFHLKVTVKTRDVLERTKKKAGITHYHSLDESEIHPYDKQDLLTFDSKDPQLLDYA 234
              +PI+HLKV+VK R  LER KK  G+T +HSLD   +H YD+ DL TFDS DP LLDY 
Sbjct: 174  VKIPIYHLKVSVKVRQELERLKKHVGVTQFHSLDH--LHEYDRVDLSTFDSSDPNLLDYG 231

Query: 235  IYVSSDSNKLILIEIFKPEFDSDEERDAFKEESINNRYEMACNRFDSLDPTRIPTQPDCI 294
            IYVS D+NKLILIEIFKPEF+S EE ++F  ++I  RY   C + +SLD +  P+Q DC 
Sbjct: 232  IYVSDDTNKLILIEIFKPEFNSPEEHESFTADAIKKRYNAMCVKNESLDKSETPSQVDCF 291

Query: 295  NTLFKIFKGPLNRKSSEEPRKTINPNNVSLNSHIDPTWLTSKYGFELHVEKDEETGEDIL 354
             TLFKIFKGPL RKS  EP KTI+  N++LN+H++P WLTSKYGF+   E DEET E   
Sbjct: 292  YTLFKIFKGPLTRKSKAEPTKTIDSGNLALNTHLNPEWLTSKYGFQASSEIDEETNEIFT 351

Query: 355  EYAPPDLTNYHRDWKVRRLRESFTRRCLELIFLGRVSIRLLSQEAVNRNPKVYRIFSMMQ 414
            EY PPD+ +Y  D + R++RESF R+CL+LIF G++S  LL+  +  +N K  +  S +Q
Sbjct: 352  EYVPPDMVDYVNDLETRKIRESFVRKCLQLIFWGQLSTSLLAPNSPLKNTKSVKGMSSLQ 411

Query: 415  TNFSTMFWFQLLGEYRAIF----STESSSPLDSDHHFIDLSACYNYIDRDIIRNYEAQCT 470
            T+FST+ WF LLGE RA      + ++ SPLD++ HFI+LS  + Y DRDIIRNYE+  +
Sbjct: 412  TSFSTLPWFHLLGESRARILLNSNEQTHSPLDAEPHFINLSVSHYYTDRDIIRNYESLSS 471

Query: 471  LDPENVGVYVDALNFIANRKGAYQLIAYCGKQDFVGQEALDHALGVFQIDSKEFDPHNLN 530
            LDPEN+G+Y DAL +IANRKGAYQLIAYCGKQD +GQEAL++AL +F+I+ KE +   LN
Sbjct: 472  LDPENIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLMFKINPKECNISELN 531

Query: 531  DSVLLSIYKNESA--STRNPNRHAELKNSLRLLAKFKKSPKLKFYADYEPYRNVTQAYEI 588
            ++ LLSIYK E++  S    N    LKN+LRLLAK+ KS KLKFY D+EPYR ++QAY+ 
Sbjct: 532  EATLLSIYKYETSNKSQVTSNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDT 591

Query: 589  LEVDESVDDDIIQTAYTVKVNDSPGLKIDCDRALYTIAVHSRSLALFNFLVQQSEEFQEY 648
            L +DESVD+DII+TAY+VK+NDSPGLK+DCDRALYTIA+  RSL LFNFL ++  +F  Y
Sbjct: 592  LSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTEECPQFSNY 651

Query: 649  FGPDQFSYQDALSVLQVNENAGDDTILEIFQRKWYKEPVFDADQFLKLKGALSKIGFERN 708
            +GP++  YQ+AL +LQVNENA D+TIL+IF++KW+ E V++ DQFL L+ AL+KI  ERN
Sbjct: 652  YGPEKLDYQEALKLLQVNENASDETILKIFKQKWFDENVYEPDQFLILRAALTKISIERN 711

Query: 709  SKLISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTV 768
            S LI++F+ TGT+D + LP ENWPTG+NNIGNTCYLNSLLQYYFSI+ LR+YVL+Y+ TV
Sbjct: 712  STLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTV 771

Query: 769  QHF---LNNQEYASRRIGGREITEAEVERSVQFVYQLRDLFDSMIHAQDRCVTPRKELAY 825
            ++F   L+N  +  RRIGGREI+  EVERS+QF+YQLR+LF +M+H ++RCVTP KELAY
Sbjct: 772  ENFNDHLSNSGHI-RRIGGREISRGEVERSIQFIYQLRNLFYAMVHTRERCVTPSKELAY 830

Query: 826  LAFVPSGLGVEFELPNASQANANAPVEKENYVXXXXXXXXXXXXXXXXXXXXXXXXXXXH 885
            LAF PS + VEFE+        N  V++   +                            
Sbjct: 831  LAFAPSNVEVEFEV------EGNKVVDQTGVL---------------------------- 856

Query: 886  SKLNKNSNDDGKINEFDNSQAGENDVDVDISMTDSPAEEEKVTKADSGSSSNNSNKA--- 942
            S   K + DD    +  ++        +D+ M D    +      D+    N SN A   
Sbjct: 857  SDSKKETTDDAFTTKIKDTSL------IDLEMEDGLNGD---VGTDANRKKNESNDAEVS 907

Query: 943  -----VAMNTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPISLGDDNEQ 997
                   + + TRVAKISSDQLENALEMGRQQDVTECIGNVLFQ+ES S+PI   +DNEQ
Sbjct: 908  ENEDTTGLTSPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQ 967

Query: 998  NDLVKQLFYGNIKQNIIPLKDETQVRTKYERFLSLLVNIGDHPKDIYDALDLYFRDEYLK 1057
             DLVKQLFYG  KQ+I+PL    +VRTK ERFLSLL+NIGDHPKDIYDA D YF+DEYL 
Sbjct: 968  YDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLT 1027

Query: 1058 LEEYGDVKRTVAVTDFPTILQIQIQRVYYDRERFMPFKSVAPLPFNETIYMDRYSDTNNP 1117
            +EEYGDV RTVAVT FPTILQ+QIQRVYYDRER MPFKS+ PLPF E IYMDRY+DT NP
Sbjct: 1028 MEEYGDVIRTVAVTTFPTILQVQIQRVYYDRERLMPFKSIEPLPFKEVIYMDRYADTENP 1087

Query: 1118 VLINRKRETEKLVQELNGLKGRQRELLSKNELGLSRKGALIETSNFLKSDVLETQGIQID 1177
            +L+ +K+ETE++ Q+L  +K RQRELLS+++ GL+RK A +E+   L+SD ++   ++I+
Sbjct: 1088 LLLAKKKETEEMKQKLKVMKNRQRELLSRDDSGLTRKDAFLESIKLLESDTIKKTPLKIE 1147

Query: 1178 NRTGLAQELDNIVLGINDELSQLYHNITQLESKISHQFDDFKSIGYSLFAVFIHRGEASY 1237
                + + L N V  I++EL +LY++I  LE KISHQFDDFK  GYSLF+VFIHRGEASY
Sbjct: 1148 AANDVIKTLRNNVQNIDNELMKLYNDINSLEEKISHQFDDFKEYGYSLFSVFIHRGEASY 1207

Query: 1238 GHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPYFLVYVKQGHEQEIEPL 1297
            GHYWIYIKDR ++GIWRKYNDETI+EV E EVFNF+EGNTATPYFLVYVKQG E +IEPL
Sbjct: 1208 GHYWIYIKDRNRNGIWRKYNDETISEVQEEEVFNFNEGNTATPYFLVYVKQGQEGDIEPL 1267

Query: 1298 KRVLE 1302
            KR+L+
Sbjct: 1268 KRILK 1272

>NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1269

 Score = 1444 bits (3738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 726/1259 (57%), Positives = 918/1259 (72%), Gaps = 41/1259 (3%)

Query: 58   DSGKVPLYPEAAARFPFKTADRLLDDILHDLSF-----INSDDHSILYSDLSNGILKSPV 112
            D GK  LYP     FP KTA+RL+DDI+ DLSF     +++     + + L NGILK  +
Sbjct: 36   DDGKQLLYPNVENHFPMKTAERLIDDIIADLSFLTGIAVDNGSRGDIDTMLGNGILKQSM 95

Query: 113  LSYSRKVGKTRAYNLGSLVDQVVLQTKFEYDSVSCPQHNHLQVFMGVLIDVTQQNVATFN 172
            L+YS+   +  ++ +GSL+DQV LQTK+EY SV+CP+ N LQVF GVL + + Q +   +
Sbjct: 96   LNYSKVKNQPGSFEMGSLIDQVTLQTKYEYKSVTCPELNKLQVFFGVLFNNSTQ-ITNLD 154

Query: 173  NLATLPIFHLKVTVKTRDVLERTKKKAGITHYHSLDESEIHPYDKQDLLTFDSKDPQLLD 232
             +   PI+HLKVTVKTR+ LE TKK AG+T +H +D+  +H YDKQD+ TF+ +DP LLD
Sbjct: 155  EVTQFPIYHLKVTVKTRNHLELTKKHAGVTQFHLVDQ--LHVYDKQDIPTFNPEDPNLLD 212

Query: 233  YAIYVSSDSNKLILIEIFKPEFDSDEERDAFKEESINNRYEMACNRFDSLDPTRIPTQPD 292
            YAIYVS+D+NKLILIE+FKPEF S +E ++FK E+IN RY+ AC +FD+L+P   PTQ D
Sbjct: 213  YAIYVSNDTNKLILIEVFKPEFQSADEIESFKSENINERYQKACEQFDTLNPNEPPTQLD 272

Query: 293  CINTLFKIFKGPLNRKSSEEPRKTINPNNVSLNSHIDPTWLTSKYGFELHVEKDEETGED 352
            C+NTLFK+FKGPL+RKSS+EP KTI+  N +LNSHI+P WLTSKYGF + V++D    + 
Sbjct: 273  CLNTLFKVFKGPLSRKSSDEPSKTIDSTNKTLNSHINPEWLTSKYGFNIVVDEDLPNAQQ 332

Query: 353  ILEYAPPDLTNYHRDWKVRRLRESFTRRCLELIFLGRVSIRLLSQEAVNRNPKVYRIFSM 412
             +EY PP+L NY  D++VRRLRE++ RRCL+LIF G++SI L   +   +N K Y+  + 
Sbjct: 333  SVEYEPPELVNYVEDFEVRRLRETYIRRCLQLIFWGKLSINLRINDPTLKNSKSYKSINA 392

Query: 413  MQTNFSTMFWFQLL--GEYRAIFSTESSSPLDSDHHFIDLSACYNYIDRDIIRNYEAQCT 470
            +QTNF+     QL        +   ES SPLD + HFI+LSACY+Y DRD+IRNYE  C 
Sbjct: 393  LQTNFTITPLLQLFKGSGQNFLMGPESRSPLDFNFHFINLSACYHYTDRDVIRNYERLCH 452

Query: 471  LDPENVGVYVDALNFIANRKGAYQLIAYCGKQDFVGQEALDHALGVFQIDSKEFDPHNLN 530
            LDP+NVGVY DALN+IAN KG+YQLIAYCGKQD VGQEALD AL  F +D  E D   +N
Sbjct: 453  LDPQNVGVYFDALNYIANTKGSYQLIAYCGKQDIVGQEALDQALKSFNLDPMEVDITKIN 512

Query: 531  DSVLLSIYKNE-SASTRN-PNRHAELKNSLRLLAKFKKSPKLKFYADYEPYRNVTQAYEI 588
            DSVLL++YKNE   ST + PN    LKN++RL AK K S KLKFY D+EPYR V QAYE 
Sbjct: 513  DSVLLTLYKNELKISTSDIPN----LKNAMRLFAKVKHSSKLKFYIDHEPYRRVAQAYET 568

Query: 589  LEVDESVDDDIIQTAYTVKVNDSPGLKIDCDRALYTIAVHSRSLALFNFLVQQSEEFQEY 648
            L++DESVDDDI+QTAY +KV DSPGL +DCDRALYTIA+H RSL LF FL+++  +FQEY
Sbjct: 569  LDIDESVDDDIVQTAYDIKVVDSPGLTMDCDRALYTIAIHKRSLLLFTFLIERCPDFQEY 628

Query: 649  FGPDQFSYQDALSVLQVNENAGDDTILEIFQRKWYKEPVFDADQFLKLKGALSKIGFERN 708
            + PD+F+Y DALS+ QVNENA D+ I++ FQ +W+ E VF+ + F+    AL +IG +RN
Sbjct: 629  YCPDRFTYHDALSMFQVNENAADELIIKNFQARWFNESVFEPESFVICVHALVEIGLQRN 688

Query: 709  SKLISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTV 768
            S LIS+F+ TG +D +CLP ++WP G+NNIGNTCYLNSLLQYYFSI+ LR YVL Y  T+
Sbjct: 689  SSLISNFLQTGKIDPNCLPIKDWPAGINNIGNTCYLNSLLQYYFSIAPLRNYVLQYSKTI 748

Query: 769  QHF--LNNQEYASRRIGGREITEAEVERSVQFVYQLRDLFDSMIHAQDRCVTPRKELAYL 826
            + F  L N     RRIGGRE++  EVERS+QF+YQLRDLF +M+++ +RCVTPR+ELAYL
Sbjct: 749  EDFKTLENNASTVRRIGGREVSNNEVERSIQFIYQLRDLFHAMVYSNERCVTPRRELAYL 808

Query: 827  AFVPSGLGVEFELPNASQANANAPVEKENYVXXXXXXXXXXXXXXXXXXXXXXXXXXXHS 886
            AF PS + VEFE       N N P  +++                               
Sbjct: 809  AFAPSNIEVEFE------TNENQPATQQD--------NPEVTTAELGQDKDEKERSVDSG 854

Query: 887  KLNKNSNDDGKINEFDNSQAGENDVDVDIS-MTDSPAEEEKVTKADSGSSSNNSNKAVAM 945
             ++ + N   K  E +  Q  E++ + D+S +  SP ++  +T       SN        
Sbjct: 855  DISMSDNITPKDAEEEEDQVAESNKNQDVSAIVSSPTKDIIMTDNTDTVVSNEG------ 908

Query: 946  NTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPISLGD-DNEQNDLVKQL 1004
             TST+VAKISSDQLENALEMGRQQDVTECIGNVLFQLES S+P+ L + DNEQ+DLVKQL
Sbjct: 909  -TSTKVAKISSDQLENALEMGRQQDVTECIGNVLFQLESGSEPLDLHENDNEQDDLVKQL 967

Query: 1005 FYGNIKQNIIPLKDETQVRTKYERFLSLLVNIGDHPKDIYDALDLYFRDEYLKLEEYGDV 1064
            FYG ++Q I+PL +  Q R K ERFLSLLVNIGDHP+DIYDALDLYF+DEYLK+EEYGDV
Sbjct: 968  FYGELEQTIVPLANPDQRRPKLERFLSLLVNIGDHPRDIYDALDLYFKDEYLKMEEYGDV 1027

Query: 1065 KRTVAVTDFPTILQIQIQRVYYDRERFMPFKSVAPLPFNETIYMDRYSDTNNPVLINRKR 1124
            KRTVAVT FPTILQIQIQRVYYDRE+FMPFKS+ PLPF E IYMDRYS T+NP LI RK 
Sbjct: 1028 KRTVAVTKFPTILQIQIQRVYYDREKFMPFKSIEPLPFEEKIYMDRYSVTDNPELIARKN 1087

Query: 1125 ETEKLVQELNGLKGRQRELLSKNELGLSRKGALIETSNFLKSDVLETQGIQIDNRTGLAQ 1184
            ET  + ++L  LK +QR+LLS+N +GLS+K + IE    L SD LE+QGI +  +  +  
Sbjct: 1088 ETLLMKEKLVELKKKQRDLLSRNSVGLSKKDSYIELGKLLSSDSLESQGIILPEKDEMVS 1147

Query: 1185 ELDNIVLGINDELSQLYHNITQLESKISHQFDDFKSIGYSLFAVFIHRGEASYGHYWIYI 1244
             L  +  GI+DEL+QLY  I+QLE  I+ QF++FK IGYS+FAVFIHRGEASYGHYWIYI
Sbjct: 1148 SLKTLTAGIDDELNQLYAEISQLEETINGQFNEFKGIGYSIFAVFIHRGEASYGHYWIYI 1207

Query: 1245 KDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPYFLVYVKQGHEQEIEPLKRVLEV 1303
            KDR ++GIWRKYNDET++EVPE EV+NF+EGNTATPYFLVYVK+G EQEIEPLKR++E 
Sbjct: 1208 KDRSQNGIWRKYNDETVSEVPEEEVYNFTEGNTATPYFLVYVKEGEEQEIEPLKRIIET 1266

>Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] {ON}
            YOR124C (REAL)
          Length = 1272

 Score = 1440 bits (3727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 719/1257 (57%), Positives = 913/1257 (72%), Gaps = 50/1257 (3%)

Query: 58   DSGKVPLYPEAAARFPFKTADRLLDDILHDLSFINSDDHSILYSDL-SNGILKSPVLSYS 116
            D GK  LYP+ A   P KT+DRLLDDIL D  F+NS D S++   L + GIL+  +LSYS
Sbjct: 54   DDGKHLLYPDIATSLPLKTSDRLLDDILCDTIFLNSTDPSVIEKGLQTTGILRESMLSYS 113

Query: 117  RKVGKTRAYNLGSLVDQVVLQTKFEYDSVSCPQHNHLQVFMGVLID--VTQQNVATFNNL 174
                  R   LGS+ DQVV+QTK EYDS SCP++N + VF  V+++  +T+Q+V++F+++
Sbjct: 114  SFRSSIRPNALGSVTDQVVIQTKIEYDSYSCPKYNKIHVFQAVILNPSLTEQHVSSFDDI 173

Query: 175  ATLPIFHLKVTVKTRDVLERTKKKAGITHYHSLDESEIHPYDKQDLLTFDSKDPQLLDYA 234
              +PI+HLKVTVK R  LER KK  G+T +HS+D   +H YD+ D  TFDS DP L+DY 
Sbjct: 174  VKIPIYHLKVTVKIRQELERLKKHVGVTQFHSIDF--LHEYDRVDFSTFDSSDPNLMDYG 231

Query: 235  IYVSSDSNKLILIEIFKPEFDSDEERDAFKEESINNRYEMACNRFDSLDPTRIPTQPDCI 294
            IYVS D+NKLILIEIFKPEFDS EE ++F   +I  RY   C   +SLD    P+Q DC 
Sbjct: 232  IYVSDDTNKLILIEIFKPEFDSPEEHESFTINAIKRRYSDMCLNNESLDKNNTPSQADCF 291

Query: 295  NTLFKIFKGPLNRKSSEEPRKTINPNNVSLNSHIDPTWLTSKYGFELHVEKDEETGEDIL 354
             TLFKIFKGPL RKS  EP KTI+  N++LN+H++P WLTSKYGF++  E DEET E   
Sbjct: 292  YTLFKIFKGPLTRKSKTEPVKTIDSGNLALNTHLNPEWLTSKYGFQVSSEIDEETNERFT 351

Query: 355  EYAPPDLTNYHRDWKVRRLRESFTRRCLELIFLGRVSIRLLSQEAVNRNPKVYRIFSMMQ 414
            EY PPD+ +Y  D KVR++RESF R+CL+L+F G++S  LL+  +  +N K  +  S +Q
Sbjct: 352  EYLPPDMVDYVDDLKVRKIRESFVRKCLQLLFWGQLSTSLLAPNSPLKNTKSVKGLSCLQ 411

Query: 415  TNFSTMFWFQLLGEYRA---IFSTESSSPLDSDHHFIDLSACYNYIDRDIIRNYEAQCTL 471
            T+FS++ WF LLGE R+   + S ES SPLD++ HF++LS  + Y DRDIIRNYE+  +L
Sbjct: 412  TSFSSLPWFHLLGESRSRILLNSNESHSPLDAEPHFVNLSVSHYYTDRDIIRNYESLSSL 471

Query: 472  DPENVGVYVDALNFIANRKGAYQLIAYCGKQDFVGQEALDHALGVFQIDSKEFDPHNLND 531
            DP+N+G+Y DAL +IANRKGAYQLIAYCGKQD +GQEAL++AL VF+I+ KE +   LN+
Sbjct: 472  DPKNIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLVFKIEPKECNIAELNE 531

Query: 532  SVLLSIYKNESA--STRNPNRHAELKNSLRLLAKFKKSPKLKFYADYEPYRNVTQAYEIL 589
            + LLSIYK E++  S         LKN+LRLLAK+ KS KLKFY D+EPYR ++QAY+ L
Sbjct: 532  ATLLSIYKFETSNKSQVTSGHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTL 591

Query: 590  EVDESVDDDIIQTAYTVKVNDSPGLKIDCDRALYTIAVHSRSLALFNFLVQQSEEFQEYF 649
             +DESVD+DII+TAY+VK+NDSPGLK+DCDRALYTIA+  +SL LFNFL  +  +F  Y+
Sbjct: 592  SIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKKSLDLFNFLTDECPQFLTYY 651

Query: 650  GPDQFSYQDALSVLQVNENAGDDTILEIFQRKWYKEPVFDADQFLKLKGALSKIGFERNS 709
            G +Q  YQ+AL +LQVNENA D+TIL+IF++KW+ E V++ DQFL LK AL+KI  ERNS
Sbjct: 652  GAEQLDYQEALKLLQVNENASDETILKIFKQKWFDESVYEPDQFLTLKAALTKISIERNS 711

Query: 710  KLISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQ 769
             LIS+F+ TGT+D + LP ENWPTG+NNIGNTCYLNSLLQYYFSI+ LR+Y+LDY+ TV+
Sbjct: 712  NLISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVE 771

Query: 770  HF---LNNQEYASRRIGGREITEAEVERSVQFVYQLRDLFDSMIHAQDRCVTPRKELAYL 826
            +F   L+N  +  RRIGGR+I++ EVERSVQF+YQLR+LF +M+H+++RCVTP KELAYL
Sbjct: 772  NFNDHLSNSGHV-RRIGGRKISKGEVERSVQFIYQLRNLFYAMVHSRERCVTPSKELAYL 830

Query: 827  AFVPSGLGVEFELPNASQANANA-PVEKENYVXXXXXXXXXXXXXXXXXXXXXXXXXXXH 885
            AF PS + VEFE+     A+  A P+                                  
Sbjct: 831  AFAPSNIEVEFEVEGNKPADGAAIPI------------GLKEEATQESCTTKENDPKSIG 878

Query: 886  SKLNKNSNDDGKINEFDNSQAGENDVDVDISMTDSPAEEEKVTKADSGSSSNNSNKAVAM 945
            SK+  N+N D   N  +  +   N+V              ++   D  +          +
Sbjct: 879  SKMEDNTNRDTHRNPSNTEKNEPNNV--------------QIVGGDDTTD---------L 915

Query: 946  NTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPISLGDDNEQNDLVKQLF 1005
            N+ TRVAKISSDQLENALEMGRQQDVTECIGNVLFQ+ES S+PI   +DNEQ DLVKQLF
Sbjct: 916  NSLTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIKYDEDNEQYDLVKQLF 975

Query: 1006 YGNIKQNIIPLKDETQVRTKYERFLSLLVNIGDHPKDIYDALDLYFRDEYLKLEEYGDVK 1065
            YG  KQ+I+PL    +VRTK ERFLSLL+NIGDHPKDIYDA D YF+DEYL +EEYGDV 
Sbjct: 976  YGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYGDVT 1035

Query: 1066 RTVAVTDFPTILQIQIQRVYYDRERFMPFKSVAPLPFNETIYMDRYSDTNNPVLINRKRE 1125
            RTVAVT FPTILQ+QIQRVYYDRERFMPFKS+ PLPF E IYMDRY+DT NP+L+ +K E
Sbjct: 1036 RTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKNE 1095

Query: 1126 TEKLVQELNGLKGRQRELLSKNELGLSRKGALIETSNFLKSDVLETQGIQIDNRTGLAQE 1185
            TE++ Q+L  +K RQRELLS++  GL+RK A +E+   L+S V+E   ++ + +  +   
Sbjct: 1096 TEEMKQKLRVMKNRQRELLSRDNSGLTRKDAFLESIKLLESSVVEKTTLKTEVKIDVINT 1155

Query: 1186 LDNIVLGINDELSQLYHNITQLESKISHQFDDFKSIGYSLFAVFIHRGEASYGHYWIYIK 1245
            L   V  I++EL  LY+NI  LE KISHQFDDFK  GYSLF+VFIHRGEASYGHYWIYIK
Sbjct: 1156 LRTNVNNIDNELMSLYNNINNLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIK 1215

Query: 1246 DRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPYFLVYVKQGHEQEIEPLKRVLE 1302
            DR  +G+WRKYNDET++EV E EVFNF+EGNTATPYFLVYVKQG E +IEPLKR+L+
Sbjct: 1216 DRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPYFLVYVKQGQEADIEPLKRILQ 1272

>Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] {ON}
            YOR124C (REAL)
          Length = 1278

 Score = 1435 bits (3714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 710/1262 (56%), Positives = 916/1262 (72%), Gaps = 54/1262 (4%)

Query: 58   DSGKVPLYPEAAARFPFKTADRLLDDILHDLSFINSDDHSILYSDL-SNGILKSPVLSYS 116
            D GK  LYP+ A   P KT+DRLLDD+L D  F+NS D +++   L ++GIL+  +LSYS
Sbjct: 54   DDGKHLLYPDIATSLPLKTSDRLLDDVLCDTIFLNSTDPNVIEKGLQTSGILRESMLSYS 113

Query: 117  RKVGKTRAYNLGSLVDQVVLQTKFEYDSVSCPQHNHLQVFMGVLID--VTQQNVATFNNL 174
                  R   LGSL DQV +QTK EYDS+SCP++N + VF  V+++  +++Q +++F+++
Sbjct: 114  SFRSSIRPNALGSLTDQVTIQTKTEYDSISCPRYNKIYVFQAVILNPSLSEQQISSFDDI 173

Query: 175  ATLPIFHLKVTVKTRDVLERTKKKAGITHYHSLDESEIHPYDKQDLLTFDSKDPQLLDYA 234
              +PI+HLKVTVK R  LER KK  G+T +HSLD   +H YD+ DL TFDS DP+L+DY 
Sbjct: 174  VRIPIYHLKVTVKIRQELERLKKHVGVTQFHSLDH--LHEYDRVDLSTFDSSDPKLMDYG 231

Query: 235  IYVSSDSNKLILIEIFKPEFDSDEERDAFKEESINNRYEMACNRFDSLDPTRIPTQPDCI 294
            IYVS D+NKLILIEIF+PEF+S EE ++F  ++I  RY   C + +SL+    P+QPDC 
Sbjct: 232  IYVSDDTNKLILIEIFQPEFNSPEEHESFTTDAIKKRYNDLCLKNESLNKKEAPSQPDCF 291

Query: 295  NTLFKIFKGPLNRKSSEEPRKTINPNNVSLNSHIDPTWLTSKYGFELHVEKDEETGEDIL 354
             TLFKIFKGPL RKS EEP KTI+  N+ LN+H++  WLTSKYGF+   E DEET +   
Sbjct: 292  YTLFKIFKGPLTRKSKEEPIKTIDSGNLVLNTHLNAEWLTSKYGFQASSEIDEETNDPFT 351

Query: 355  EYAPPDLTNYHRDWKVRRLRESFTRRCLELIFLGRVSIRLLSQEAVNRNPKVYRIFSMMQ 414
            EY PPD+  Y  DW  R++RESF ++CL+LIF G++S  LL+  +  +N K  +  S +Q
Sbjct: 352  EYVPPDMVGYVGDWNKRKIRESFVKKCLQLIFWGQLSASLLTPNSSLKNTKSVKGLSSLQ 411

Query: 415  TNFSTMFWFQLLGEYRAIF----STESSSPLDSDHHFIDLSACYNYIDRDIIRNYEAQCT 470
            T+FST  WF LLGE RA      + ++ SPLD++ HFI+LS  + Y DRDIIRNYEA  +
Sbjct: 412  TSFSTSPWFHLLGESRARILLNSNEQAHSPLDAEQHFINLSVSHYYTDRDIIRNYEALSS 471

Query: 471  LDPENVGVYVDALNFIANRKGAYQLIAYCGKQDFVGQEALDHALGVFQIDSKEFDPHNLN 530
            LDP+N+G+Y DAL +IANRKGAYQLIAYCGKQ+ +GQEAL++AL  F+ID KEF+   LN
Sbjct: 472  LDPDNIGLYFDALTYIANRKGAYQLIAYCGKQNIIGQEALENALVTFKIDPKEFNIAELN 531

Query: 531  DSVLLSIYKNESA--STRNPNRHAELKNSLRLLAKFKKSPKLKFYADYEPYRNVTQAYEI 588
            ++ LLSIYK E++  S    N     KN+LRLLAK+ KS KLKFY D+EPYR ++QAY+ 
Sbjct: 532  EATLLSIYKFETSNKSKVTSNHLTNFKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDT 591

Query: 589  LEVDESVDDDIIQTAYTVKVNDSPGLKIDCDRALYTIAVHSRSLALFNFLVQQSEEFQEY 648
            L +DESVD+DII+TAY++K+NDSPGLK+DCDRALYTIA+  RSL LFNFL  +  +F +Y
Sbjct: 592  LSIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFLKY 651

Query: 649  FGPDQFSYQDALSVLQVNENAGDDTILEIFQRKWYKEPVFDADQFLKLKGALSKIGFERN 708
            +GP++  YQ+AL +LQVNENA D+T+L+IF++KWY E VF+ DQFL L+ AL++I  ERN
Sbjct: 652  YGPEKLHYQEALKLLQVNENASDETVLKIFKQKWYDESVFEPDQFLILRAALTRISIERN 711

Query: 709  SKLISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTV 768
            S LI++F+ TGT+D + LP ENWPTG+NNIGNTCYLNSLLQYYFSI+ LR+Y+L+Y+ T+
Sbjct: 712  SNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTL 771

Query: 769  QHF---LNNQEYASRRIGGREITEAEVERSVQFVYQLRDLFDSMIHAQDRCVTPRKELAY 825
             +F   L+N  +  RRIGGREI+  EVERS+QF+YQLR+LF +M+H+++RCVTP KELAY
Sbjct: 772  DNFNDHLSNSGHV-RRIGGREISRGEVERSIQFIYQLRNLFYAMVHSRERCVTPSKELAY 830

Query: 826  LAFVPSGLGVEFELPNASQANANAPVEKENYVXXXXXXXXXXXXXXXXXXXXXXXXXXXH 885
            LAF PS + VEFE+      +  A +  ++                              
Sbjct: 831  LAFAPSNVEVEFEVEGNKVGSNGAAISADS------------------------KGEVTQ 866

Query: 886  SKLNKNSNDDGKINEFDNSQAGENDVDVDISMTDSPAEEEKVTKADSGSSSNNSNKAVAM 945
                 +   D  + + +      +DVD DI         E V KA+  + +N+    V  
Sbjct: 867  EAATTSEEKDPSLIDLEMEDKTNSDVDKDI---------ENV-KANEANEANDIEITVGE 916

Query: 946  NTS-----TRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPISLGDDNEQNDL 1000
            N +     TRVAKI SDQLENALEMGRQQDVTECIGNVLFQ+ES S+PI   +DNEQ DL
Sbjct: 917  NITDLASPTRVAKIGSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDL 976

Query: 1001 VKQLFYGNIKQNIIPLKDETQVRTKYERFLSLLVNIGDHPKDIYDALDLYFRDEYLKLEE 1060
            +KQLFYG  KQ+I+PL    +VRTK ERFLSLLVNIGDHPKDIYDA D YF+DEYL +EE
Sbjct: 977  IKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTMEE 1036

Query: 1061 YGDVKRTVAVTDFPTILQIQIQRVYYDRERFMPFKSVAPLPFNETIYMDRYSDTNNPVLI 1120
            YGDVKRTVAVT FPTILQ+QIQRVYYDRERFMPFKS+ PLPF E IYMDRYSDT NP+L+
Sbjct: 1037 YGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYSDTENPLLL 1096

Query: 1121 NRKRETEKLVQELNGLKGRQRELLSKNELGLSRKGALIETSNFLKSDVLETQGIQIDNRT 1180
             +K ETE++ Q L  +K RQRELL ++E GL+RK A +E+   L+S+++ T+    ++  
Sbjct: 1097 AKKEETEQMKQNLKVMKNRQRELLDRDESGLTRKDAFLESIKLLESNIVVTEASNSEDNK 1156

Query: 1181 GLAQELDNIVLGINDELSQLYHNITQLESKISHQFDDFKSIGYSLFAVFIHRGEASYGHY 1240
             + + L + ++ I++EL  LY++I  LE KISHQFDDF+  GYSLF+VFIHRGEASYGHY
Sbjct: 1157 DVIRILKSNIIDIDNELMSLYNDINSLEDKISHQFDDFEEYGYSLFSVFIHRGEASYGHY 1216

Query: 1241 WIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPYFLVYVKQGHEQEIEPLKRV 1300
            WIYIKDR   G+WRKYNDETI+EV E EVFNF+EGNTATPYFLVYVKQG E +IEPLKR+
Sbjct: 1217 WIYIKDRNYGGVWRKYNDETISEVQEEEVFNFNEGNTATPYFLVYVKQGQESDIEPLKRI 1276

Query: 1301 LE 1302
            LE
Sbjct: 1277 LE 1278

>Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON}
            (51365..55165) [3801 nt, 1267 aa]
          Length = 1266

 Score = 1432 bits (3708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 714/1285 (55%), Positives = 933/1285 (72%), Gaps = 55/1285 (4%)

Query: 30   VETEQIGETMSESEISEDPGKNELLDTQDSGKVPLYPEAAARFPFKTADRLLDDILHDLS 89
            V+ E   E  S S   +  G    +  +D GK  LYP+A    PFKT++RLLD+I+  + 
Sbjct: 24   VDLENDSEVNSSSMDLDSCGDATSVSWKDDGKQLLYPDARDLTPFKTSERLLDEIMCSVP 83

Query: 90   FINSDDHSILYSDLSNGILKSPVLSYSRKVGKTRAYNLGSLVDQVVLQTKFEYDSVSCPQ 149
            +I   +    +++ SNG+LK  +LSYS+     + +++G++VDQ++LQTKFEY S +CP+
Sbjct: 84   YILLSEKDESFNEFSNGLLKKQLLSYSKSRHNVQPFSVGTIVDQIILQTKFEYKSTTCPE 143

Query: 150  HNHLQVFMGVLIDVTQQNVATFNNLATLPIFHLKVTVKTRDVLERTKKKAGITHYHSLDE 209
             N++ V +GVLID   Q ++TF+++A L I+HLK+TVK R  LERTK+  G+  YH LD 
Sbjct: 144  FNNIYVRLGVLIDTNHQPLSTFDDVADLKIYHLKITVKVRSFLERTKRHVGVPRYHLLDS 203

Query: 210  SEIHPYDKQDLLTFDSKDPQLLDYAIYVSSDSNKLILIEIFKPEFDSDEERDAFKEESIN 269
              +HP+D+QDLL FD KDP+L+D+AIYVS D+NKL+L+EIF+PEFDS+EER++    +I 
Sbjct: 204  --LHPFDQQDLLNFDPKDPKLVDHAIYVSDDTNKLVLLEIFRPEFDSEEERNSLTMGAIK 261

Query: 270  NRYEMACNRFDSLDPTRIPTQPDCINTLFKIFKGPLNRKSSEEPRKTINPNNVSLNSHID 329
             R+  A  ++D+LD   IPTQ DCINT+FKIFKGPL RKS++EP KT++ +NV LNS ++
Sbjct: 262  ERHIKASKKYDTLDKDEIPTQIDCINTMFKIFKGPLTRKSNDEPVKTLSSDNVVLNSQMN 321

Query: 330  PTWLTSKYGFELHVEKDEETGEDILEYAPPDLTNYHRDWKVRRLRESFTRRCLELIFLGR 389
            P WL +KYGF+  +E +EET E +++Y PP+L ++  D  VR+ RE+ TR+CLELI+LG+
Sbjct: 322  PKWLVTKYGFQELIETEEETEEQLIDYLPPNLVDFETDQDVRKSREAVTRKCLELIWLGK 381

Query: 390  VSIRLLSQEAVNRNPKVYRIFSMMQTNFSTMFWFQLLGEYRAIFSTESSSPLDSDHHFID 449
            +SI L++ E      K  R F+++QT+FST+FW Q+L E + I + + +  ++ D+H ID
Sbjct: 382  ISISLMTPEQKESASKSLRTFNLLQTSFSTLFWSQILDENKNIATMKENPQMNLDYHLID 441

Query: 450  LSACYNYIDRDIIRNYEAQCTLDPENVGVYVDALNFIANRKGAYQLIAYCGKQDFVGQEA 509
            LSA Y+Y DRDII+NYE QC LDP N+G+Y D+L+FIAN +G+Y LI YC KQD VGQEA
Sbjct: 442  LSASYHYTDRDIIQNYELQCKLDPANIGIYFDSLHFIANNRGSYTLIGYCDKQDIVGQEA 501

Query: 510  LDHALGVFQIDSKEFDPHNLNDSVLLSIYKNESASTRN-PNRHAELKNSLRLLAKFKKSP 568
            L+ AL  F +D    D  + ND++ ++IYKNE     N P R   L+N+LR+LAK K S 
Sbjct: 502  LEQALKTFSLDPDTIDLSDTNDAIFMTIYKNEVKLHGNDPTRLTNLRNALRILAKHKNSS 561

Query: 569  KLKFYADYEPYRNVTQAYEILEVDESVDDDIIQTAYTVKVNDSPGLKIDCDRALYTIAVH 628
            +LKFY DYEPY ++ +A+ ILEVDESVDDDIIQTAY++KVND+PGLKIDCDRALYT+AV 
Sbjct: 562  RLKFYVDYEPYSSIQRAFNILEVDESVDDDIIQTAYSIKVNDTPGLKIDCDRALYTVAVS 621

Query: 629  SRSLALFNFLVQQSEEFQEYFGPDQFSYQDALSVLQVNENAGDDTILEIFQRKWYKEPVF 688
             RS+ L NFL Q+   FQ+++GPDQ++Y +AL  LQVNENA DDTILEIFQR+W  + V 
Sbjct: 622  KRSMILINFLFQECPPFQDFYGPDQYTYSEALQKLQVNENAADDTILEIFQRRWTSDSVI 681

Query: 689  DADQFLKLKGALSKIGFERNSKLISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLL 748
            DAD+ L LK  L+KI FERNSKLIS +++TG V+  CLPA+NWP GLNNIGNTCYLNSLL
Sbjct: 682  DADEILSLKSVLTKIAFERNSKLISSYLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLL 741

Query: 749  QYYFSISSLRQYVLDYRNTVQHFLNNQE--YASRRIGGREITEAEVERSVQFVYQLRDLF 806
            QYYF IS LR YV DY+ T++   N  E  +  RRIGGREI + EVERSVQFVYQLRDLF
Sbjct: 742  QYYFCISPLRNYVADYQKTLEAVENCLEDGWDKRRIGGREINKVEVERSVQFVYQLRDLF 801

Query: 807  DSMIHAQDRCVTPRKELAYLAFVPSGLGVEFELPNASQANANAPVEKENYVXXXXXXXXX 866
            + MIH+  RCVTP KELAYLAF PS + VEF+ PN  Q+     V+              
Sbjct: 802  NEMIHSSSRCVTPTKELAYLAFAPSNVEVEFDQPNELQSGNGEDVD-------------- 847

Query: 867  XXXXXXXXXXXXXXXXXXHSKLNKNSNDDGKINEFDNSQAGENDV-DVDISMTDSPAEEE 925
                                       D   I+E  +   G++ V D + S  ++  E +
Sbjct: 848  --------------------------GDIVFIDEDISEPKGKSLVLDEENSKVENSPENQ 881

Query: 926  KVTKADSGSSSN---------NSNKAVAMNTSTRVAKISSDQLENALEMGRQQDVTECIG 976
             +   DS  SS          N     + +TSTRVAKIS DQLENALE+GRQQDVTECIG
Sbjct: 882  LIEIDDSSDSSGHKKVEEISQNPCFGKSTDTSTRVAKISFDQLENALELGRQQDVTECIG 941

Query: 977  NVLFQLESASDPISLGDDNEQNDLVKQLFYGNIKQNIIPLKDETQVRTKYERFLSLLVNI 1036
            NVLFQLESAS+PISL +D+EQ DL+K+LFYG  KQ+IIPLK+  ++R K ERF+SLLVN+
Sbjct: 942  NVLFQLESASNPISLEEDDEQYDLIKKLFYGKTKQSIIPLKNNNEIRNKIERFVSLLVNV 1001

Query: 1037 GDHPKDIYDALDLYFRDEYLKLEEYGDVKRTVAVTDFPTILQIQIQRVYYDRERFMPFKS 1096
             DHPKD+YDALDLYF DEYL ++EYG+VK+++AVT+FPTILQIQIQRVYYDRERFMPFKS
Sbjct: 1002 SDHPKDVYDALDLYFSDEYLTMDEYGEVKKSLAVTEFPTILQIQIQRVYYDRERFMPFKS 1061

Query: 1097 VAPLPFNETIYMDRYSDTNNPVLINRKRETEKLVQELNGLKGRQRELLSKNELGLSRKGA 1156
            + PLPF+ETIYMDRY++T +  L+ +K ET +L ++L+ ++ RQ+ELLS+NELGLSRK A
Sbjct: 1062 IEPLPFSETIYMDRYTETTDADLLKKKDETFELKKQLSEMRKRQKELLSRNELGLSRKEA 1121

Query: 1157 LIETSNFLKSDVLETQGIQIDNRTGLAQELDNIVLGINDELSQLYHNITQLESKISHQFD 1216
             +ET  FL SD LE QGI+ +N+  L   L   +  I+DEL++LY++I  +E+KI  QFD
Sbjct: 1122 FMETRKFLSSDALEKQGIETENKQMLIDRLTGALKDIDDELTKLYNDIVNIEAKIDRQFD 1181

Query: 1217 DFKSIGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGN 1276
             F++IGYSLFAVFIHRGEASYGHYW+YIKD  K+GIWRKYNDETITEVPE+EVFNF+EGN
Sbjct: 1182 KFQNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGN 1241

Query: 1277 TATPYFLVYVKQGHEQEIEPLKRVL 1301
            TATPYFLVYVKQ +  EIEPLKR++
Sbjct: 1242 TATPYFLVYVKQENLNEIEPLKRIV 1266

>KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} similar
            to uniprot|Q01476 Saccharomyces cerevisiae YOR124C UBP2
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions capable of cleaving polyubiquitin and
            possesses isopeptidase activity
          Length = 1241

 Score = 1377 bits (3564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 697/1259 (55%), Positives = 898/1259 (71%), Gaps = 51/1259 (4%)

Query: 46   EDPGKNELLDTQDSGKVPLYPEAAARFPFKTADRLLDDILHDLSFINSDDHSILYSDLSN 105
            +D G  +   TQD+GK  LYP+A + FPFKT++RLLD+I  +L++ NS+ H ILYS L +
Sbjct: 24   DDGGLEDGGSTQDNGKALLYPDAGSLFPFKTSERLLDEIKAELAYRNSNGHDILYSALHS 83

Query: 106  GILKSPVLSYSRKVGKTRAYNLGSLVDQVVLQTKFEYDSVSCPQHNHLQVFMGVLIDVTQ 165
            G+LK PVL YSRK      +++G L+DQVVL+T++EY+S +CP  N + VFMGVL+  + 
Sbjct: 84   GVLKLPVLEYSRK-PVPDPFSIGHLLDQVVLKTRYEYESRTCPGLNKVSVFMGVLVSPSI 142

Query: 166  QNVATFNNLATLPIFHLKVTVKTRDVLERTKKKAGITHYHSLDESEIHPYDKQDLLTFDS 225
                   +LA  PI+HLK+TVKTR  LE T+K+AG+  YH L  SE+HP DKQDL   + 
Sbjct: 143  VPREP-EDLAAAPIYHLKLTVKTRMHLEHTRKQAGVCQYHML--SELHPSDKQDLFLAEE 199

Query: 226  KDPQLLDYAIYVSSDSNKLILIEIFKPEFDSDEERDAFKEESINNRYEMACNRFDSLDPT 285
             DP LLD A+YVSSD+NKL+ IEIFKPEF S E+   F  +SI  R+  AC +F  LDP 
Sbjct: 200  SDPSLLDSAMYVSSDTNKLVCIEIFKPEF-SHEDLATFSPDSIRRRFAEACGKFPDLDPE 258

Query: 286  RIPTQPDCINTLFKIFKGPLNRKSSEEPRKTINPNNVSLNSHIDPTWLTSKYGFELHVEK 345
            ++P+Q +C +TL KIFKGPLNR+S ++  KTI+ +N  LNS I+P WLT ++ F+L   +
Sbjct: 259  KVPSQAECFSTLLKIFKGPLNRRSPDDVLKTISADNKFLNSQIEPAWLTERFQFQLCETQ 318

Query: 346  DEETGEDILEYAPPDLTNYHRDWKVRRLRESFTRRCLELIFLGRVSIRLLSQEAVNRNPK 405
              E  E  LEY PPDLT+Y  +  VR+LRE +TR+CLEL+FLG++++ L+S++ V ++ +
Sbjct: 319  ASEEPETALEYQPPDLTDYVNNLSVRKLREEYTRKCLELVFLGKMAVALMSKDDVAQDSR 378

Query: 406  VYRIFSMMQTNFSTMFWFQLLGEYRAIFSTESSSPLDSDHHFIDLSACYNYIDRDIIRNY 465
              R F + Q ++S  F+F LLGE R +     +  +D ++HFI+LSAC+ Y D+DII+NY
Sbjct: 379  A-RSFHLYQISYSPSFFFHLLGETRGVMDY-GTQEIDKNYHFINLSACHYYSDKDIIKNY 436

Query: 466  EAQCTLDPENVGVYVDALNFIANRKGAYQLIAYCGKQDFVGQEALDHALGVFQIDSKEFD 525
            E Q  LDPEN+G+Y DALNFIAN KG+YQLI YC KQD VG+EALD AL +F ID+ + D
Sbjct: 437  ETQARLDPENIGIYFDALNFIANFKGSYQLITYCRKQDVVGKEALDSALSLFGIDASDTD 496

Query: 526  PHNLNDSVLLSIYKNESASTRNPNRHAELKNSLRLLAKFKKSPKLKFYADYEPYRNVTQA 585
               + D +LL IY+ ES+      R + LKNSLRL+AK KKS  L+FY  YEPY N  QA
Sbjct: 497  LSTVPDDLLLGIYRKESSQASQQKR-SSLKNSLRLIAKAKKSQILQFYTAYEPYDNTYQA 555

Query: 586  YEILEVDESVDDDIIQTAYTVKVNDSPGLKIDCDRALYTIAVHSRSLALFNFLVQQSEEF 645
            Y +LEV+ESVD DIIQTAYTVKV DSPGLKIDCDRA+YTIAV  RS+ LFNFL +Q   F
Sbjct: 556  YSLLEVNESVDVDIIQTAYTVKVTDSPGLKIDCDRAIYTIAVSRRSMPLFNFLAEQCPAF 615

Query: 646  QEYFGPDQFSYQDALSVLQVNENAGDDTILEIFQRKWYKEPVFDADQFLKLKGALSKIGF 705
             E++  D+ +YQ+AL++LQVNENA DD ILE+FQRKW++EPV   DQFL    AL+KIG 
Sbjct: 616  NEFYSADKLTYQEALNLLQVNENASDDVILEVFQRKWHQEPVSSPDQFLISSSALTKIGQ 675

Query: 706  ERNSKLISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYR 765
             RNS LI+ +++TG +D SCLPA NWPTGLNNIGNTCYLNSLLQYYF IS LRQ +++Y+
Sbjct: 676  VRNSLLINRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQ 735

Query: 766  NTVQHFLNNQEY--ASRRIGGREITEAEVERSVQFVYQLRDLFDSMIHAQDRCVTPRKEL 823
             T+  F  +  +  + RRIGGRE++EAEVERS+QFVYQLRDLF  M+H ++R VTP KEL
Sbjct: 736  KTLSEFHQSIGHLESKRRIGGREVSEAEVERSIQFVYQLRDLFTDMVHTENRYVTPTKEL 795

Query: 824  AYLAFVPSGLGVEFELPNASQANANAPVEKENYVXXXXXXXXXXXXXXXXXXXXXXXXXX 883
            AYLAF PS + VEFE   +S +   A  E+E  +                          
Sbjct: 796  AYLAFAPSNIEVEFEGTPSSGSVGEAEDEEEGAI-------------------------- 829

Query: 884  XHSKLNKNSNDDGKINEFDNSQAGENDVDVDISMTDSPAEEEKVTK--ADSGSSSNNSNK 941
                      +  ++ +  +    E D+++   +   P+E E + +   DS       + 
Sbjct: 830  ---------KETTEVIDLTSVPNAEQDIEM---LDPVPSESEMIVEQFVDSPKDDKKQDA 877

Query: 942  AVAMNTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPISLGDDNEQNDLV 1001
            A A+ TSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESAS+P  L  D EQ DL+
Sbjct: 878  AEAIGTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASEPTCLDTDGEQQDLI 937

Query: 1002 KQLFYGNIKQNIIPLKDETQVRTKYERFLSLLVNIGDHPKDIYDALDLYFRDEYLKLEEY 1061
            KQLF+G ++Q + PL D T+VRTK ERF+SLLVN+GDHPKD+YDALD YF+++ L+LE+ 
Sbjct: 938  KQLFFGKLRQVLTPLNDPTKVRTKIERFVSLLVNVGDHPKDVYDALDQYFKNDVLQLED- 996

Query: 1062 GDVKRTVAVTDFPTILQIQIQRVYYDRERFMPFKSVAPLPFNETIYMDRYSDTNNPVLIN 1121
            GDV R+VA+ + P +LQIQIQRVYYDRERFMPFKS+ PLPF ++IYMDRY DT +PV++ 
Sbjct: 997  GDVNRSVAIKELPAVLQIQIQRVYYDRERFMPFKSIEPLPFEDSIYMDRYMDTEDPVMLK 1056

Query: 1122 RKRETEKLVQELNGLKGRQRELLSKNELGLSRKGALIETSNFLKSDVLETQGIQIDNRTG 1181
            ++ E   L +EL  LK +QR LL KN  G+S K +L+ET  FL+SDVLE   I+  N+  
Sbjct: 1057 KREEAATLKKELVTLKEKQRSLLDKNGSGMSFKSSLLETKRFLQSDVLENNDIESPNKEQ 1116

Query: 1182 LAQELDNIVLGINDELSQLYHNITQLESKISHQFDDFKSIGYSLFAVFIHRGEASYGHYW 1241
              Q +D+++L I++EL+ +YH I  LE K+S  FDDFK  GYSLFAVFIHRGEASYGHYW
Sbjct: 1117 SIQTIDSMLLKIDEELASVYHRIAFLEQKLSSHFDDFKQEGYSLFAVFIHRGEASYGHYW 1176

Query: 1242 IYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPYFLVYVKQGHEQEIEPLKRV 1300
            IYIKD  K+GIWRKYNDE++TE PESEVFNFSEGNTATPYFLVYVK G E +IEPL RV
Sbjct: 1177 IYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPYFLVYVKNGQESQIEPLHRV 1235

>NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5.443
            YOR124C
          Length = 1295

 Score = 1373 bits (3555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 692/1258 (55%), Positives = 890/1258 (70%), Gaps = 53/1258 (4%)

Query: 58   DSGKVPLYPE-AAARFPFKTADRLLDDILHDLSFINSDDHSILYSDLSNGILKSPVLSYS 116
            D G   LYP+   A FP KT++R++DDIL DLSFIN  + S       NGIL+  ++ YS
Sbjct: 76   DPGNTLLYPDLGTANFPMKTSNRIIDDILCDLSFINGPNLS-----FKNGILQESMIMYS 130

Query: 117  RKVGKTRAYNLGSLVDQVVLQTKFEYDSVSCPQHNHLQVFMGVLIDVTQQNVATFNNLAT 176
            ++    +AY  GS+VDQV LQTK+EY+S++CP +N L+V  G+L+++          ++ 
Sbjct: 131  KERINNQAYLFGSMVDQVALQTKYEYNSLTCPANNKLEVQFGILMNLPSNITNVDEIISK 190

Query: 177  LPIFHLKVTVKTRDVLERTKKKAGITHYHSLDESEIHPYDKQDLLTFDSKDPQLLDYAIY 236
            +PI+HLK+TVKTR +LE +KK+AGIT YH LD  ++H +DK+DL+TFD  +P LLDYAIY
Sbjct: 191  VPIYHLKITVKTRQLLEVSKKQAGITQYHLLDFEDLHHFDKRDLMTFDPDNPDLLDYAIY 250

Query: 237  VSSDSNKLILIEIFKPEFDSDEERDAFKEESINNRYEMACNRFDSLDPTRIPTQPDCINT 296
            VSSD+N+LILIEIF  EFDS EER++F+  +I +RY+ AC +FD+LDP  +PT  DC+NT
Sbjct: 251  VSSDTNRLILIEIFSTEFDSREERESFQTATIKSRYQEACKKFDTLDPEAVPTGIDCLNT 310

Query: 297  LFKIFKGPLNRKSSEEPRKTINPNNVSLNSHIDPTWLTSKYGFELHVEKDEETGEDILEY 356
            + K+ K PL RK++ +  +T++ NN  L+SH +P WL  KY F  H   DE TG+++LEY
Sbjct: 311  VLKLLKQPLTRKNNNDKIRTVSSNNPILHSHFNPEWLLEKYNFTKHYATDETTGQEVLEY 370

Query: 357  APPDLTNYHRDWKVRRLRESFTRRCLELIFLGR--VSIRLLSQEAVNRNPKVYRIFSMMQ 414
             PPDL +Y + +KVR LRE + RRCL+LIF G+  V +R+   +   R  K YR F+++ 
Sbjct: 371  EPPDLISYVQGYKVRSLREKYIRRCLQLIFWGKCLVQLRVDQSDPALRGSKSYRAFNLLN 430

Query: 415  TNFSTMFWFQLLGEYRAIFSTES-----SSPLDSDHHFIDLSACYNYIDRDIIRNYEAQC 469
            T  ST   +QLL + ++ F   +     S  LD + HFI+LS    Y DRDII+NYE   
Sbjct: 431  TTTSTNPLYQLLNDSKSNFLASTRNDSDSMALDQNFHFINLSTSSYYTDRDIIKNYERLI 490

Query: 470  TLDPENVGVYVDALNFIANRKGAYQLIAYCGKQDFVGQEALDHALGVFQIDSKEFDPHNL 529
             LDP N+G Y DAL++IANRKG+YQLIAYCGKQD VGQE ++ AL  F ID    +  ++
Sbjct: 491  ALDPPNIGTYFDALSYIANRKGSYQLIAYCGKQDVVGQENINMALKCFNIDPNVVNLESI 550

Query: 530  NDSVLLSIYKNESASTRNPNRHAELKNSLRLLAKFKKSPKLKFYADYEPYRNVTQAYEIL 589
            +DS+LLSIYKNES   +       LKN++RL AK + SP+LKFY D+EPYRNV QAYE L
Sbjct: 551  DDSLLLSIYKNESV--KEGADFVNLKNAMRLFAKIRNSPQLKFYVDHEPYRNVNQAYETL 608

Query: 590  EVDESVDDDIIQTAYTVKVNDSPGLKIDCDRALYTIAVHSRSLALFNFLVQQSEEFQEYF 649
            E+D SVDDDIIQTAY++K  D+PGLKIDCDRALYTIA+  RS+ LFNFL++   EFQ Y+
Sbjct: 609  EIDSSVDDDIIQTAYSIKTVDAPGLKIDCDRALYTIAIQRRSMILFNFLLENCSEFQAYY 668

Query: 650  GPDQFSYQDALSVLQVNENAGDDTILEIFQRKWYKEPVFDADQFLKLKGALSKIGFERNS 709
               ++ Y+ AL +LQVNENA D+ IL+ FQ KW+ E + +ADQFL  K AL K+G ERNS
Sbjct: 669  NIGRYDYRQALGILQVNENANDEVILKNFQTKWFNEQIHEADQFLNYKCALMKLGLERNS 728

Query: 710  KLISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQ 769
            KLI++F+  G +D SCLP ENWPTG+NNIGNTCYLNSLLQYYFSIS LR+YVL Y  T +
Sbjct: 729  KLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYE 788

Query: 770  HFLNNQEYAS--RRIGGREITEAEVERSVQFVYQLRDLFDSMIHAQDRCVTPRKELAYLA 827
             F + +  A   RRIGGRE+ + EVERS+QF+YQLRDLF +MI+   RCVTPR+ELAYLA
Sbjct: 789  DFYDAKRNAKTIRRIGGREVGDNEVERSIQFIYQLRDLFYAMIYTNKRCVTPRRELAYLA 848

Query: 828  FVPSGLGVEFELPNASQANANAPVEKENYVXXXXXXXXXXXXXXXXXXXXXXXXXXXHSK 887
            F PS + VEFE       +A   V   N                                
Sbjct: 849  FAPSNVEVEFE---NGVTDAKEDVSHYN-------------------------DDKTSDT 880

Query: 888  LNKNSNDDGKINEFDNSQAGENDVDVDISMTDSPAEEEKVTKADSG--SSSNNSNKAVAM 945
            L K    D  + E + ++A   +   DI MTD   +     KA  G      ++   + +
Sbjct: 881  LIKIGEGDEDLGEAERTEASPTE---DIYMTDD--DMLGAAKATDGINKEDESTENGIDI 935

Query: 946  NTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPISLG-DDNEQNDLVKQL 1004
              ST+VAKISSDQLENALEMGRQQDVTECIGNVL+QLES S+P+ +  +DNEQ+DLVKQL
Sbjct: 936  LPSTKVAKISSDQLENALEMGRQQDVTECIGNVLYQLESGSEPLQINPEDNEQDDLVKQL 995

Query: 1005 FYGNIKQNIIPLKDETQVRTKYERFLSLLVNIGDHPKDIYDALDLYFRDEYLKLEEYGDV 1064
            FYG IKQ+IIPL    + R K ERFLSLLVN+GDHP+DIYDALD+YF+DE+L ++EYG+V
Sbjct: 996  FYGEIKQDIIPLSGVGETRPKLERFLSLLVNVGDHPRDIYDALDMYFKDEFLTMDEYGEV 1055

Query: 1065 KRTVAVTDFPTILQIQIQRVYYDRERFMPFKSVAPLPFNETIYMDRYSDTNNPVLINRKR 1124
            KRTVA+T FPTILQ+QIQRVYYDRERFMPFKS+ PLPF+  IYMDRY DT +P ++  + 
Sbjct: 1056 KRTVAITKFPTILQVQIQRVYYDRERFMPFKSIEPLPFSAKIYMDRYVDTADPEILETRE 1115

Query: 1125 ETEKLVQELNGLKGRQRELLSKNELGLSRKGALIETSNFLKSDVLETQGIQIDNRTGLAQ 1184
             T K+  EL  LK RQ+ELLS+NE+GLSRK A  ET NFL+S+ L+ QGI  + +  L+ 
Sbjct: 1116 RTAKMKAELVQLKKRQQELLSRNEVGLSRKEAYSETVNFLQSNALQLQGIVFEGQDELST 1175

Query: 1185 ELDNIVLGINDELSQLYHNITQLESKISHQFDDFKSIGYSLFAVFIHRGEASYGHYWIYI 1244
             L      I+DELS +Y+ ITQLE  ISHQF+ FK +GYSLFAVFIHRGEASYGHYW+YI
Sbjct: 1176 ILKKAGTDIDDELSTIYNQITQLEETISHQFEQFKKVGYSLFAVFIHRGEASYGHYWVYI 1235

Query: 1245 KDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPYFLVYVKQGHEQEIEPLKRVLE 1302
            KD  ++GIWRKYNDET++EVP+ EVFNF+EGNTATPYFLVYVK+G E++IEPLKR++E
Sbjct: 1236 KDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATPYFLVYVKEGSEKDIEPLKRIIE 1293

>Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR124C
            (UBP2) - Ubiquitin-specific protease [contig 130] FULL
          Length = 1233

 Score = 1370 bits (3545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 690/1251 (55%), Positives = 891/1251 (71%), Gaps = 63/1251 (5%)

Query: 57   QDSGKVPLYPEAAARFPFKTADRLLDDILHDLSFINSDDHSILYSDLSNGILKSPVLSYS 116
            +D+GK  LY +A   FPFKT++RLLDDI  +L++ NS +H ILYS+L  G+L+ P+L YS
Sbjct: 35   KDTGKTLLYADAGNLFPFKTSERLLDDIKLELAYKNSIEHDILYSELHKGVLRLPILEYS 94

Query: 117  RKVGKTRAYNLGSLVDQVVLQTKFEYDSVSCPQHNHLQVFMGVLIDVTQQNVATFNNLAT 176
            RK      YN+G LVDQVVL+T++EYDS +CP  N + VFMGVL++ +Q     ++++  
Sbjct: 95   RK-PTDDVYNIGHLVDQVVLKTRYEYDSKTCPGLNKITVFMGVLLNSSQMP-KIYDDVTQ 152

Query: 177  LPIFHLKVTVKTRDVLERTKKKAGITHYHSLDESEIHPYDKQDLLTFDSKDPQLLDYAIY 236
              ++HLKVTVKTR  LERT+K+AG+  YH L   E+HP+DK+DLL  D++DP L+D  +Y
Sbjct: 153  ASVYHLKVTVKTRLHLERTRKQAGVPQYHLL--PELHPFDKEDLLLTDAEDPHLIDSVMY 210

Query: 237  VSSDSNKLILIEIFKPEFDSDEERDAFKEESINNRYEMACNRFDSLDPTRIPTQPDCINT 296
            VSSD+NKLI IEIFKPEF S  +   F  ++I  RY  AC+++  LDP  IP+Q +C +T
Sbjct: 211  VSSDTNKLICIEIFKPEF-SQADLTEFCPDAIKKRYSSACDKYPDLDPDMIPSQAECFST 269

Query: 297  LFKIFKGPLNRKSSEEPRKTINPNNVSLNSHIDPTWLTSKYGFELHVEKDEETGEDILEY 356
            L KIFKGPLNR+  E+  KTI+ +N  LNS +DP WLT K+ F+L    D +     +E+
Sbjct: 270  LLKIFKGPLNRRGPEDVLKTISADNKFLNSQLDPKWLTEKFAFKLCQANDTDEAGSAMEF 329

Query: 357  APPDLTNYHRDWKVRRLRESFTRRCLELIFLGRVSIRLLSQEAVNRNPKVYRIFSMMQTN 416
             PPDLTNY  D  VR LRES+TR+CLELIFLG++S  L+++E + ++ +  R F + QT+
Sbjct: 330  QPPDLTNYVDDVSVRELRESYTRKCLELIFLGKMSSSLMTKEDIAKDSRA-RSFQLYQTS 388

Query: 417  FSTMFWFQLLGEYRAIFSTESSSPLDSDHHFIDLSACYNYIDRDIIRNYEAQCTLDPENV 476
             S  F+F LL E R +     S  +D +++F++LS+CY Y D+DII+NYE Q  LD EN+
Sbjct: 389  NSLSFFFHLLNETRGVMDY-GSQEIDRNYNFMNLSSCYYYTDKDIIKNYETQALLDRENI 447

Query: 477  GVYVDALNFIANRKGAYQLIAYCGKQDFVGQEALDHALGVFQIDSKEFDPHNLNDSVLLS 536
            G+Y DAL +IAN KG+Y LIAYC KQD VG+EALD AL +F ID  +     + D +LL 
Sbjct: 448  GIYFDALTYIANLKGSYALIAYCRKQDVVGKEALDSALSLFGIDPSDTSLMTIPDELLLG 507

Query: 537  IYKNESASTRNPNRHAELKNSLRLLAKFKKSPKLKFYADYEPYRNVTQAYEILEVDESVD 596
            +Y+ E  S  +  +HA LKN+LRLLAK K S  L+FYA YEPY NV QAY +LEVDESVD
Sbjct: 508  VYRKE-CSQGSTQKHATLKNALRLLAKAKNSSTLQFYAAYEPYDNVHQAYSLLEVDESVD 566

Query: 597  DDIIQTAYTVKVNDSPGLKIDCDRALYTIAVHSRSLALFNFLVQQSEEFQEYFGPDQFSY 656
             D+IQTAYT+KV DSPGLKIDCDRA+YT+AV  RS+ LFNFLV+Q   F+E++  D+ +Y
Sbjct: 567  VDVIQTAYTIKVADSPGLKIDCDRAIYTLAVTKRSMPLFNFLVEQCPVFEEFYSADKLTY 626

Query: 657  QDALSVLQVNENAGDDTILEIFQRKWYKEPVFDADQFLKLKGALSKIGFERNSKLISHFI 716
             DALS+LQVNENA DD ILE+FQRKW  E V   DQFLK   AL+KIG  RNS LI+ ++
Sbjct: 627  HDALSLLQVNENASDDIILEVFQRKWNHETVLSPDQFLKSSSALTKIGQVRNSLLINRYL 686

Query: 717  DTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNN-- 774
            +TGT+D  CLPA NWPTGLNNIGNTCYLNSLLQYYF IS LRQ+++DY+ T+  F ++  
Sbjct: 687  ETGTIDVRCLPARNWPTGLNNIGNTCYLNSLLQYYFCISPLRQFIVDYQKTLAEFHDSIG 746

Query: 775  QEYASRRIGGREITEAEVERSVQFVYQLRDLFDSMIHAQDRCVTPRKELAYLAFVPSGLG 834
               + RRIGGRE++E+EVERSVQFVYQLRDLF  MIH + R VTPRKELAYLAF PS + 
Sbjct: 747  NLGSKRRIGGREVSESEVERSVQFVYQLRDLFTDMIHTESRFVTPRKELAYLAFAPSNIE 806

Query: 835  VEFE-LPNASQANANAPVEKENYVXXXXXXXXXXXXXXXXXXXXXXXXXXXHSKLNKNSN 893
            VEFE  P    A                                            +NS 
Sbjct: 807  VEFEGTPTVEPA-------------------------------------------KENSE 823

Query: 894  DDGKINEFDNSQAGENDVDVDISMTDSPAEEEK---VTKADSGSSSNNSNKAVAMNTSTR 950
            +D ++   D +  GE   DVD+     PAE E     T+ +  +  N+      M +STR
Sbjct: 824  NDVEV--IDLTAEGEASEDVDML---KPAESETQVVTTQLNEDTVMNDVIATEPMVSSTR 878

Query: 951  VAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPISLGDDNEQNDLVKQLFYGNIK 1010
            VAKIS+DQLENALEMGRQQDVTECIGNVLFQLESASDPI+L  D EQ DL+K+LF+G +K
Sbjct: 879  VAKISTDQLENALEMGRQQDVTECIGNVLFQLESASDPINLDSDGEQRDLIKELFFGKLK 938

Query: 1011 QNIIPLKDETQVRTKYERFLSLLVNIGDHPKDIYDALDLYFRDEYLKLEEYGDVKRTVAV 1070
            Q++ PLKD +++RTK ERF+SLLVN+GDHPK++YDALD YF+D+ L+LE+ GDVKRT+A+
Sbjct: 939  QDLAPLKDPSKIRTKIERFVSLLVNVGDHPKNVYDALDQYFKDDVLQLED-GDVKRTLAI 997

Query: 1071 TDFPTILQIQIQRVYYDRERFMPFKSVAPLPFNETIYMDRYSDTNNPVLINRKRETEKLV 1130
             + P +LQIQIQRVYYDRE+FMPFKS+ PLPF +TIYMDRY DT +  +  +++E  K  
Sbjct: 998  KELPVVLQIQIQRVYYDREKFMPFKSIEPLPFRDTIYMDRYMDTQDAEMQQKRQEAAKYK 1057

Query: 1131 QELNGLKGRQRELLSKNELGLSRKGALIETSNFLKSDVLETQGIQIDNRTGLAQELDNIV 1190
             EL  LK RQ+ LL KN  G+S K +L+ET  FL+S VLE   I+I  +    + +++++
Sbjct: 1058 NELESLKLRQKALLEKNGNGMSFKTSLLETERFLESGVLEQNAIEIQKKDSALKAIESML 1117

Query: 1191 LGINDELSQLYHNITQLESKISHQFDDFKSIGYSLFAVFIHRGEASYGHYWIYIKDRYKS 1250
            L I++ELS++Y  IT L+ K+S  FD+FK +GYSLFAVFIHRGEASYGHYW+YIKD  ++
Sbjct: 1118 LKIDNELSEIYSRITALDQKLSSHFDNFKELGYSLFAVFIHRGEASYGHYWLYIKDHNRN 1177

Query: 1251 GIWRKYNDETITEVPESEVFNFSEGNTATPYFLVYVKQGHEQEIEPLKRVL 1301
            GIWRKYNDET+TE PE+EVFNF+EGNTATPYFLVYVK GHE EI+PL RV+
Sbjct: 1178 GIWRKYNDETVTEAPENEVFNFTEGNTATPYFLVYVKNGHESEIQPLHRVI 1228

>KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1227

 Score = 1350 bits (3495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 684/1267 (53%), Positives = 912/1267 (71%), Gaps = 67/1267 (5%)

Query: 41   ESEISEDPGKNELLDTQDSGKVPLYPEAAARFPFKTADRLLDDILHDLSFINSDDHSILY 100
            E  +S      + L   D GK  LYP      PFKT DRL+DDI++DL+FIN  D S  +
Sbjct: 19   EQSVSSTTADEKSLPPNDDGKQLLYPAVGLNLPFKTPDRLIDDIVYDLAFINDSDLSSEF 78

Query: 101  SDLSNGILKSPVLSYSRKVGKTR-AYNLGSLVDQVVLQTKFEYDSVSCPQHNHLQVFMGV 159
                 GILKS  L+YS++  + R +Y+LG+ +DQ+ LQTK+EY+S+SCP HN + VF GV
Sbjct: 79   K----GILKSSPLTYSKRRQELRPSYHLGTFIDQITLQTKYEYESISCPDHNRINVFFGV 134

Query: 160  LIDVTQQNVATFNNLATLPIFHLKVTVKTRDVLERTKKKAGITHYHSLDESEIHPYDKQD 219
            LID   +N  +F+ +A  PI+HLKVTVKTR  LE  KK  GI+HYH +  +E+HP+DKQD
Sbjct: 135  LIDSNMENPTSFDAVAETPIYHLKVTVKTRTKLEHLKKHVGISHYHLI--TELHPFDKQD 192

Query: 220  LLTFDSKDPQLLDYAIYVSSDSNKLILIEIFKPEFDSDEERDAFKEESINNRYEMACNRF 279
            LLTFD  D  L+D+A YVSSD+NKLILIEIFKPEF S+EE ++FK E I +RY++ C ++
Sbjct: 193  LLTFDESDENLIDFAAYVSSDTNKLILIEIFKPEFSSEEEIESFKTEHITSRYQLVCEQY 252

Query: 280  DSLDPTRIPTQPDCINTLFKIFKGPLNRKSSE-EPRKTINPNNVSLNSHIDPTWLTSKYG 338
            DSL+   IP+Q DC  TLF++FKGPL+RKS++ +P KTIN  N +LNSH+D  WL SKYG
Sbjct: 253  DSLNSDTIPSQVDCFRTLFRVFKGPLDRKSADLDPIKTINATNKALNSHMDSKWLVSKYG 312

Query: 339  FELHVEKDEETGEDILEYAPPDLTNYHRDWKVRRLRESFTRRCLELIFLGRVSIRLLSQE 398
            F+ +  ++ E  +  LEY PPDL ++  DWK+R+LR+S+TR+CL+L F G++S +LLS+ 
Sbjct: 313  FQENSFQNPEANDQGLEYEPPDLIDHKNDWKIRKLRDSYTRKCLQLAFWGKLSNKLLSKA 372

Query: 399  AVNRNPKVYRIFSMMQTNFSTMFWFQLLGE--YRAIFSTESSSPLDSDHHFIDLSACYNY 456
             + +  K YR F+ M T+ ST   FQ+  +   R      S+SPLD+++HFI+LS+ Y Y
Sbjct: 373  NIQKYEKSYRFFNKMHTHTSTTALFQIFNDSARRLQQDDTSASPLDNNYHFINLSSSYYY 432

Query: 457  IDRDIIRNYEAQCTLDPENVGVYVDALNFIANRKGAYQLIAYCGKQDFVGQEALDHALGV 516
             DRDII+NYE  C +D  N G+Y DAL +IAN KG+YQLI+YCGKQD VGQE L ++L V
Sbjct: 433  TDRDIIQNYETLCNIDTNNKGIYFDALTYIANTKGSYQLISYCGKQDVVGQEVLQNSLRV 492

Query: 517  FQIDSKEFDPHNLNDSVLLSIYKNESASTR-NPNRHAELKNSLRLLAKFKKSPKLKFYAD 575
              +D+   D  +LNDS+L SIYK E  ++R +  R  ELK+++R++ K  +S KL+F+ D
Sbjct: 493  LGLDATSVDIKSLNDSLLFSIYKQEQNASRGDMQRLTELKSAMRVMIKLMRSKKLQFFID 552

Query: 576  YEPYRNVTQAYEILEVDESVDDDIIQTAYTVKVNDSPGLKIDCDRALYTIAVHSRSLALF 635
            +EPY NV  AY +L++DESVDDDI+QTAYT+++NDSPGLK+DCD+ALYTIA+ +RS+ LF
Sbjct: 553  HEPYPNVMDAYNLLDIDESVDDDIVQTAYTIRINDSPGLKMDCDKALYTIAIRTRSITLF 612

Query: 636  NFLVQQSEEFQEYFGPDQFSYQDALSVLQVNENAGDDTILEIFQRKWYKEPVFDADQFLK 695
            NFL++Q  +F  Y+GPD  S+Q ALS+LQVNENA D+ +++IFQ++W ++ + + DQ L 
Sbjct: 613  NFLMEQCPDFITYYGPDCLSFQQALSLLQVNENATDELVIKIFQQRWGQKILNEYDQLLI 672

Query: 696  LKGALSKIGFERNSKLISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSIS 755
            LK AL+KI  E+NSKLIS+F++TG +DA+ L  ENWP GLNNIGNTCYLNSLLQYYFSI+
Sbjct: 673  LKAALTKIASEKNSKLISYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIA 732

Query: 756  SLRQYVLDYRNTVQHFLNNQEYASRRIGGREITEAEVERSVQFVYQLRDLFDSMIHAQDR 815
             LR+Y+L+Y+ ++ ++  ++    RRIGGRE++E EVERS+QF+YQLRDLF+ MI+++ R
Sbjct: 733  PLREYILNYKGSISNYEIDETSNKRRIGGREVSENEVERSIQFMYQLRDLFNDMIYSKSR 792

Query: 816  CVTPRKELAYLAFVPSGLGVEFELPNASQANANAPVEKENYVXXXXXXXXXXXXXXXXXX 875
            C+TP+ ELAYLAF PS + VEF      +   + P +KE  +                  
Sbjct: 793  CITPKHELAYLAFAPSNIEVEFAASEVERTTVDLPFDKEGDI------------------ 834

Query: 876  XXXXXXXXXHSKLNKNSNDDGKINEFDNSQAGENDVDVDISMTDSPAEEEKVTKADSGSS 935
                        L   SND+  +N  +N+Q   +D+ V        A E+K         
Sbjct: 835  -----------DLVDLSNDN--LNTTNNAQEVTSDISV--------ATEDK--------- 864

Query: 936  SNNSNKAVAMNTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPISLGDDN 995
                   V  NTST+ AKISSDQLENALEMGRQQDVTECIGNVL+Q+ESAS PI L +D 
Sbjct: 865  -------VMTNTSTKTAKISSDQLENALEMGRQQDVTECIGNVLYQMESASKPIKLDEDF 917

Query: 996  EQNDLVKQLFYGNIKQNIIPLKDETQVRTKYERFLSLLVNIGDHPKDIYDALDLYFRDEY 1055
            EQ DL+K+LFYG  KQ I+PL D ++ RTKYE F SLLVNI DHP+DIYDAL+  F  E+
Sbjct: 918  EQYDLIKELFYGKTKQEIVPLSDISKTRTKYEGFSSLLVNISDHPRDIYDALESSFASEF 977

Query: 1056 LKLEEYGDVKRTVAVTDFPTILQIQIQRVYYDRERFMPFKSVAPLPFNETIYMDRYSDTN 1115
            LK++EYGDV+RTV++T+FP ILQIQIQRVYYDRERFMPFKS+ PLPF+ TIYMDRY+  +
Sbjct: 978  LKMDEYGDVQRTVSITNFPKILQIQIQRVYYDRERFMPFKSIEPLPFSNTIYMDRYAALD 1037

Query: 1116 NPVLINRKRETEKLVQELNGLKGRQRELLSKNELGLSRKGALIETSNFLKSDV-LETQGI 1174
            N +L  +K ET++L  +L  LK RQ ELL++NELGLSRK + +ET NFL  +  + +QG+
Sbjct: 1038 NELLQTKKNETKELRNKLKTLKARQVELLNRNELGLSRKESYLETINFLSDEATVTSQGL 1097

Query: 1175 QIDNRTGLAQELDNIVLGINDELSQLYHNITQLESKISHQFDDFKSIGYSLFAVFIHRGE 1234
             + NR  + ++L   +  I+ ELSQ+Y  I  +E+KI HQFD+F+ IGYSLFAVFIHRGE
Sbjct: 1098 SVLNRGQIIEKLRKAISNIDSELSQIYDEINLIENKIDHQFDEFRDIGYSLFAVFIHRGE 1157

Query: 1235 ASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPYFLVYVKQGHEQEI 1294
            ASYGHYW+YIKD  +SGIWRKYNDET+TEV E EVFNF+EGNTATPYFLV+VK  ++ +I
Sbjct: 1158 ASYGHYWVYIKDPERSGIWRKYNDETVTEVNEEEVFNFTEGNTATPYFLVFVKDYYKGDI 1217

Query: 1295 EPLKRVL 1301
            EPLKR++
Sbjct: 1218 EPLKRII 1224

>TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_5.443
            YOR124C
          Length = 1320

 Score = 1315 bits (3404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 685/1294 (52%), Positives = 883/1294 (68%), Gaps = 84/1294 (6%)

Query: 58   DSGKVPLYPEAAARFPFKTADRLLDDILHDLSFI---NSDDHSILYSDLS---------- 104
            D GK  LY   +    FKTADRLLDD++ DLS++   NS +H    ++ +          
Sbjct: 62   DDGKHILYDSFSNHSFFKTADRLLDDLMIDLSYMLFNNSSEHINDNNNNNDNNHNNNNNT 121

Query: 105  --------------NGILKSPVLSYSRKVGKTRAYNLGSLVDQVVLQTKFEYDSVSCPQH 150
                          NGIL+ P   YS+       + +G++VDQ+ LQT+FE+ SV+CP+ 
Sbjct: 122  SNSNNDTNEIKTYINGILRLPSHQYSKDRYSKFTFAMGTIVDQINLQTRFEFKSVTCPEF 181

Query: 151  NHLQVFMGVLID-VTQQNVATFNNLATLPIFHLKVTVKTRDVLERTKKKAGITHYHSLDE 209
            N + V +GVL+D  +Q  + TF     LP++H K+TVKTR  LE+TKK  GI+H+H +D 
Sbjct: 182  NDVHVLLGVLMDNRSQAPLGTF-----LPVYHFKITVKTRSYLEKTKKHVGISHFHLIDF 236

Query: 210  SEIHPYDKQDL--LTFDSKDPQLLDYAIYVSSDSNKLILIEIFKPEFDSDEERDAFKEES 267
             ++H +DK+DL     D     LLD AI++S D+NKL+++EIFKPEF+  EE ++F +ES
Sbjct: 237  DDLHEFDKKDLEITNHDINKKSLLDSAIFISEDTNKLVMLEIFKPEFNELEEIESFSQES 296

Query: 268  INNRYEMACNRFDSLDPTRIPTQPDCINTLFKIFKGPLNRKSSEEPRKTINPNNVSLNSH 327
            I  RY  AC+RF +LD  +IPTQ +C+NT+FKIFKGPLN K+  EP K IN +N  LNSH
Sbjct: 297  IAERYINACSRFPNLDQQKIPTQLECLNTVFKIFKGPLNHKNINEPLKAINADNPLLNSH 356

Query: 328  IDPTWLTSKYGFELHVEKDEETGEDILEYAPPDLTNYHRDWKVRRLRESFTRRCLELIFL 387
             +P WL +KYGF   ++ + +T E+  EY PP+L +Y  D   R LRES+ R+CLELIF+
Sbjct: 357  WNPNWLLTKYGFIETLDNNPDTQEEFKEYLPPNLADYINDINTRALRESYIRKCLELIFI 416

Query: 388  GRVSIRLLSQEAVNRNPKVYRIFSMMQTNFSTMFWFQLLGEYRAIFSTESSSPLDSDHHF 447
             + +I L+    +  N K  R F+++QT F+T FW Q L E++    T   + LD ++H+
Sbjct: 417  SKRNISLMGPNDLQYNSKAIRSFNILQTVFTTSFWHQFLYEHKPQLDT--YNKLDYEYHY 474

Query: 448  IDLSACYNYIDRDIIRNYEAQCTLDPENVGVYVDALNFIANRKGAYQLIAYCGKQDFVGQ 507
            I+L   + Y +RDIIRNY     LDP N+G+Y DAL +IA  K +YQLI++  KQD +GQ
Sbjct: 475  INLLTSFYYTERDIIRNYNCLTALDPVNIGIYYDALAYIAQSKNSYQLISFVSKQDVIGQ 534

Query: 508  EALDHALGVFQIDSKEFDP-HNLNDSVLLSIYKNESASTR-NPNRHAELKNSLRLLAKFK 565
            EAL+ AL +F ID+ +      L +S++ +IYK E      +  R AE+KN+LRLLAK+K
Sbjct: 535  EALNQALTLFNIDNNDSSAISTLTESMIFTIYKTERKQANISSARLAEMKNALRLLAKYK 594

Query: 566  KSPKLKFYADYEPYRNVTQAYEILEVDESVDDDIIQTAYTVKVNDSPGLKIDCDRALYTI 625
             S +LKFYADYEPY + +Q Y  LEVDESVDDDIIQTAYT+KVND+PGLKIDCDRAL T+
Sbjct: 595  HSDRLKFYADYEPYFSASQGYNTLEVDESVDDDIIQTAYTIKVNDAPGLKIDCDRALLTV 654

Query: 626  AVHSRSLALFNFLVQQSEEFQEYFGPDQFSYQDALSVLQVNENAGDDTILEIFQRKWYKE 685
            A   +SLALF FL+Q+  +F E++G D+F Y  AL+ LQVNENA D+TILEIFQ++W  +
Sbjct: 655  ATRRKSLALFKFLLQECPQFTEFYGVDRFDYFQALNTLQVNENATDETILEIFQQRWSND 714

Query: 686  PVFDADQFLKLKGALSKIGFERNSKLISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLN 745
               D D  L L+ ALSKI +E+NSKLIS+FIDTG VD +CLP ENWP GLNNIGNTCYLN
Sbjct: 715  KSLDYDSMLNLQSALSKIAYEKNSKLISNFIDTGIVDPTCLPVENWPAGLNNIGNTCYLN 774

Query: 746  SLLQYYFSISSLRQYVLDYRNTVQHF-----LNNQEYASRRIGGREITEAEVERSVQFVY 800
            SLLQYYFSI  LR ++L Y+ T++HF     LN Q    RRIGGRE+ E EVERSVQF+Y
Sbjct: 775  SLLQYYFSIKPLRDFILQYQMTMKHFQNEIVLNKQLEKRRRIGGREVNELEVERSVQFIY 834

Query: 801  QLRDLFDSMIHAQDRCVTPRKELAYLAFVPSGLGVEFELPNASQANANAPVEKENYVXXX 860
            Q+RDLF  MI +Q RCV+PR+ELAYLAF+PS + VEFE  +      +    ++  V   
Sbjct: 835  QVRDLFKEMIFSQMRCVSPRQELAYLAFMPSNIEVEFESASTEDDMGDKSNAQDAVVLQD 894

Query: 861  XXXXXXXXXXXXXXXXXXXXXXXXHSKLNKNSNDDG--KINEFDNSQAGENDVDVDISMT 918
                                         KN  D    ++N  D   A +     D    
Sbjct: 895  EA---------------------------KNDTDINLTEVNLIDLEPATKVSTSNDQPTM 927

Query: 919  DSPAEEEKVTKADSGS---SSNNSNKAVAMN----TSTRVAKISSDQLENALEMGRQQDV 971
            D+    E +T +D+ S   S  N  + V+ N     STRVAKISSDQLENA EMGRQQDV
Sbjct: 928  DAI---EILTNSDNKSKELSKTNPFREVSPNEDITISTRVAKISSDQLENAFEMGRQQDV 984

Query: 972  TECIGNVLFQLESASDPISL-GDDNEQNDLVKQLFYGNIKQNIIPLKDETQVRTKYERFL 1030
            TECIGNVLFQLE+  DPISL  +DNEQ DLVK+LFYG  KQ+IIPL   +  R K ERFL
Sbjct: 985  TECIGNVLFQLETGFDPISLDNEDNEQYDLVKELFYGKTKQSIIPLNHNSNERIKVERFL 1044

Query: 1031 SLLVNIGDHPKDIYDALDLYFRDEYLKLEEYGDVKRTVAVTDFPTILQIQIQRVYYDRER 1090
            SLLVNI DHPKDIYDAL+ YF DE+L +EEYGDVK+T+++T++P ILQIQIQRVYYDRER
Sbjct: 1045 SLLVNITDHPKDIYDALNQYFADEFLTMEEYGDVKKTLSMTEYPKILQIQIQRVYYDRER 1104

Query: 1091 FMPFKSVAPLPFNETIYMDRYSDTNNPVLINRKRETEKLVQELNGLKGRQRELLSKNELG 1150
            FMPFKS+ PLPF + IYMDRY+++++P LI++K ET +L  +L   + RQ+ELLSKNELG
Sbjct: 1105 FMPFKSIEPLPFEQVIYMDRYAESSDPELISKKEETAQLKLKLKEYRARQKELLSKNELG 1164

Query: 1151 LSRKGALIETSNFLKSDVLETQGIQIDNRTGLAQELDNIVLGINDELSQLYHNITQLESK 1210
            LSRK A++ET  FLKS V+   GI   N+  L +EL   V GIN+ELS LY+ I QL+++
Sbjct: 1165 LSRKEAMMETIKFLKSPVILENGIDTTNKDVLVRELQQYVDGINNELSNLYNKINQLQNR 1224

Query: 1211 ISHQFDDFKSIGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVF 1270
            I HQFDDFK + YSLFAVFIHRGEASYGHYW+YIKD  K+GIWRKYNDE++TEVPE EVF
Sbjct: 1225 IDHQFDDFKKLAYSLFAVFIHRGEASYGHYWVYIKDHSKNGIWRKYNDESVTEVPEQEVF 1284

Query: 1271 NFSEGNTATPYFLVYVKQGHEQEIEPLKRVLEVT 1304
            NF+EGNTATPYFLVYVKQ    +IEPLKR+++ T
Sbjct: 1285 NFTEGNTATPYFLVYVKQDSLSDIEPLKRIIQNT 1318

>KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5.443
            YOR124C
          Length = 1262

 Score = 1307 bits (3382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 672/1266 (53%), Positives = 894/1266 (70%), Gaps = 76/1266 (6%)

Query: 58   DSGKVPLYPEAAARFPFKTADRLLDDILHDLSFINSDDHSILYSDLSNGILKSPVLSYSR 117
            D GK  LY +     P KT+DRL+DDIL DLS +N     +L S+ S GILK   + YS+
Sbjct: 52   DDGKHLLYTDLKNGSPMKTSDRLIDDILCDLS-LNGQSQCLL-SEQSQGILKLLPIIYSK 109

Query: 118  KVGKTRAYN-LGSLVDQVVLQTKFEYDSVSCPQHNHLQVFMGVLIDVTQQNVATFNNLAT 176
            +  + +  + LGSL+DQV+ QTKFEY SVSCPQHN LQVF+GVL++V+    +T +++  
Sbjct: 110  QRQQLQNVSILGSLLDQVLFQTKFEYSSVSCPQHNKLQVFLGVLLNVSSSFEST-DDVVR 168

Query: 177  LPIFHLKVTVKTRDVLERTKKKAGITHYHSLDESEIHPYDKQDLLTFDSKDPQLLDYAIY 236
             P+FHLKVTVKTR  LE  KK AG++ + S+D   +H YDK+DL TFD +D +L+DYAIY
Sbjct: 169  SPLFHLKVTVKTRSQLELYKKHAGVSQFFSVDS--LHSYDKEDLGTFDPEDTRLIDYAIY 226

Query: 237  VSSDSNKLILIEIFKPEFDSDEERDAFKEESINNRYEMACNRFDSLDPTRIPTQPDCINT 296
            VSSD+NKL+LIEIF PEF++ EE ++F  + I  RY   C+R DSL+P  IP Q DC+NT
Sbjct: 227  VSSDTNKLVLIEIFHPEFNTSEEIESFTVDGIRKRYVDTCSRLDSLNPEDIPNQFDCLNT 286

Query: 297  LFKIFKGPLNRKSSEEPRKTINPNNVSLNSHIDPTWLTSKYGFELHVEKDEETGEDILEY 356
            L+K FK P+N+     P +TI  +N  LNSH++  WLT +YGF L   ++E+  +   EY
Sbjct: 287  LYKTFKNPINKTDPSAPLQTIKASNPILNSHMNANWLTERYGFTLLPGENEDDED---EY 343

Query: 357  APPDLTNYHRDWKVRRLRESFTRRCLELIFLGRVSIRLL---SQEAVNRNPKVYRIFSMM 413
             PP+ T Y  D KVR+++E + R+CL+LIF  ++ I ++    +  +  + K ++  S +
Sbjct: 344  EPPNFTTYIMDPKVRKMKECYIRKCLQLIFWAKLMIEVVDNTQRSKLAASSKSFKSLSGI 403

Query: 414  QTNFSTMFWFQLLGEYRAIF--STESSSPLDSDHHFIDLSACYNYIDRDIIRNYEAQCTL 471
                ++   +QL GE +  F  S + +   D+++HFI LSA Y+Y DRDII NYE    +
Sbjct: 404  AVQNTSKPLYQLFGESKNAFLNSNDQNYMWDTNYHFIALSASYHYNDRDIIMNYETYSVI 463

Query: 472  DPENVGVYVDALNFIANRKGAYQLIAYCGKQDFVGQEALDHALGVFQIDSKEFDPHNLND 531
            D  N+G+Y DA+ FIANRKG+YQL+AYCGKQ+ VG EAL+ A+  F++D    D + L+ 
Sbjct: 464  DKGNIGIYFDAIQFIANRKGSYQLLAYCGKQNIVGHEALEAAMRAFKLDPAAIDINKLDI 523

Query: 532  SVLLSIYKNESASTRNPNRHAELKNSLRLLAKFKKSPKLKFYADYEPYRNVTQAYEILEV 591
            S+LLS+YK+E  S +N +  ++LKN+LR+LAKFK +  +KFY D+EPY+ V+QAY  LEV
Sbjct: 524  SLLLSMYKHEQISNQNTSHLSDLKNALRVLAKFKDNRFVKFYVDHEPYKTVSQAYNELEV 583

Query: 592  DESVDDDIIQTAYTVKVNDSPGLKIDCDRALYTIAVHSRSLALFNFLVQQSEEFQEYFGP 651
            DESVDDDIIQTAY++KVNDSPGLKI+C RALYTIA++ RS+ALFN+L+++  EFQ+++GP
Sbjct: 584  DESVDDDIIQTAYSIKVNDSPGLKIECIRALYTIAINKRSMALFNYLIEECPEFQDFYGP 643

Query: 652  DQFSYQDALSVLQVNENAGDDTILEIFQRKWYKEPVFDADQFLKLKGALSKIGFERNSKL 711
            +++SY+ AL+++QVNENA D+ IL+IFQ+KW  EP+ + DQFL LK AL K+  E+NSKL
Sbjct: 644  EKYSYEQALAIIQVNENASDEMILQIFQKKWNDEPLVEYDQFLSLKAALLKLCIEKNSKL 703

Query: 712  ISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHF 771
            ISHF+ TG +D SCLP ENWP GLNNIGNTCYLNSLLQYYF+I+ LR Y+  Y++T + F
Sbjct: 704  ISHFLTTGLIDPSCLPVENWPIGLNNIGNTCYLNSLLQYYFAIAPLRNYICSYQSTTESF 763

Query: 772  --LNNQEYASRRIGGREITEAEVERSVQFVYQLRDLFDSMIHAQDRCVTPRKELAYLAFV 829
               +     +RRIGGR++  +EVERS+QF YQLRDLF+ MI +  RCV+P +ELAYLAF 
Sbjct: 764  EATDTDAKINRRIGGRQVCASEVERSIQFTYQLRDLFNGMIFSNSRCVSPTQELAYLAFS 823

Query: 830  PSGLGVEFELPNASQANANAPVEKENYVXXXXXXXXXXXXXXXXXXXXXXXXXXXHSKLN 889
            PS + VEF+  +   + +                                        LN
Sbjct: 824  PSNIEVEFDAGSGIASESGGTF-----------------------------------SLN 848

Query: 890  KNSND----DGKINE-FDNSQAGENDVDVDISM-----TDSPAEEEKVTKADSGSSSNNS 939
                D    D  +NE    ++AGE  +D D  +      D P ++ K+ K          
Sbjct: 849  GKDTDAPLTDMPLNEDVTMTEAGEPQLD-DTGLLAPVEADVPVDQMKLAKE--------- 898

Query: 940  NKAVAMNTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPISLGDDNEQND 999
                 +N+ST+VAKI SDQLENALE+GRQQDVTECIGNVL+QLESASDPI L +DNEQ D
Sbjct: 899  ----VINSSTKVAKIGSDQLENALELGRQQDVTECIGNVLYQLESASDPIKLDEDNEQYD 954

Query: 1000 LVKQLFYGNIKQNIIPLKDETQVRTKYERFLSLLVNIGDHPKDIYDALDLYFRDEYLKLE 1059
            L+K LFYG  +Q+I+PL + T VR+KYERFLSLLVN+ DHPKDIYDALD YF +EYL LE
Sbjct: 955  LIKHLFYGKTRQDIVPLSNSTDVRSKYERFLSLLVNVSDHPKDIYDALDSYFMEEYLTLE 1014

Query: 1060 EYGDVKRTVAVTDFPTILQIQIQRVYYDRERFMPFKSVAPLPFNETIYMDRYSDTNNPVL 1119
            EYGDV+RTVA+T+FPTILQIQIQRVYYDRERFMPFKS+ P+PFN T+YMDRY+ T++PV+
Sbjct: 1015 EYGDVRRTVAITEFPTILQIQIQRVYYDRERFMPFKSIEPIPFNSTLYMDRYAATDDPVM 1074

Query: 1120 INRKRETEKLVQELNGLKGRQRELLSKNELGLSRKGALIETSNFLKSDVLE-TQGIQIDN 1178
            + ++RET +L   L   K RQ+ELLS+N++GLSRK A  ET   L+SD LE    ++ ++
Sbjct: 1075 LTKRRETSELKTRLRECKVRQQELLSRNDMGLSRKEAYTETMKMLQSDFLEQVPSVRGED 1134

Query: 1179 RTGLAQELDNIVLGINDELSQLYHNITQLESKISHQFDDFKSIGYSLFAVFIHRGEASYG 1238
            +T +   L ++V  I++EL QLY  I QLE++I HQFD F+ +GYSLFAVFIHRGEASYG
Sbjct: 1135 QTAVVSGLSDMVASIDEELVQLYTEIGQLETQIDHQFDSFQKVGYSLFAVFIHRGEASYG 1194

Query: 1239 HYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPYFLVYVKQGHEQEIEPLK 1298
            HYW+Y+KD   SGIWRKYNDET++EVPE EVFNF+EGN ATPYFLV VKQ HEQ+IEPL 
Sbjct: 1195 HYWVYVKDFKNSGIWRKYNDETVSEVPEEEVFNFTEGNNATPYFLVLVKQTHEQDIEPLH 1254

Query: 1299 RVLEVT 1304
            R+++ T
Sbjct: 1255 RIIDNT 1260

>TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5.443
            YOR124C
          Length = 1283

 Score = 1305 bits (3377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 687/1278 (53%), Positives = 893/1278 (69%), Gaps = 72/1278 (5%)

Query: 42   SEISEDPGKNELLDTQDSGKVPLYPEAAARFPFKTADRLLDDILHD---LSFINSDDH-- 96
            S I  + G NEL    D G   LY       P KT++R+LDDIL +   +  INS ++  
Sbjct: 56   SVIGNEMGLNEL----DDGSKLLYQNLMNMSPLKTSERILDDILSNIPLMKVINSKENCN 111

Query: 97   SILYSD-LSNGILKSPVLSYSRKVGKTRAYNLGSLVDQVVLQTKFEYDSVSCPQHNHLQV 155
            ++ Y++  +N ILK P++ YS+        ++GS+VDQ+V+Q+KFEY SV+CP HN ++V
Sbjct: 112  TLRYNEQFNNSILKQPMIEYSKLRATVHPDSIGSIVDQIVIQSKFEYKSVTCPNHNKIEV 171

Query: 156  FMGVLIDVTQQNVATFNNLATLPIFHLKVTVKTRDVLERTKKKAGITHYHSLDESEIHPY 215
            FMGVLID TQ+   T ++L+ + I H+K+TVKTR VLERT++  G++ +H +   E+HP+
Sbjct: 172  FMGVLIDSTQK-ANTLDDLSNIIINHVKITVKTRTVLERTRRLMGLSKFHLV--KELHPF 228

Query: 216  DKQDLLTFDSKDPQLLDYAIYVSSDSNKLILIEIFKPEFDSDEERDAFKEESINNRYEMA 275
            D++DLLTFD     L+D+AIYVS D+NKLILIEIF PEFDS EER  F    IN RY  +
Sbjct: 229  DQKDLLTFDKNAANLIDHAIYVSEDTNKLILIEIFNPEFDSQEERGLFTPNVINQRYLHS 288

Query: 276  CNRFDSLDPTRIPTQPDCINTLFKIFKGPLNRKSSEEPRKTINPNNVSLNSHIDPTWLTS 335
                +      IPT  +CINTLFK+FKGPL RKSS +P K IN +N  L  H++P WL S
Sbjct: 289  LAEGEEPSTEDIPTGIECINTLFKVFKGPLTRKSSNDPIKRINSDNPILRLHMNPEWLVS 348

Query: 336  KYGFELHVEKDEETGEDILEYAPPDLTNYHRDWKVRRLRESFTRRCLELIFLGRVSIRLL 395
            KYGF + +EKD ETG++  EY PPDLT+Y  + + R++RES TR+CLELIF G++ I LL
Sbjct: 349  KYGFNMVLEKDVETGDEFTEYEPPDLTDYVSNQQTRKIRESVTRKCLELIFFGKMMINLL 408

Query: 396  SQEAVNRNPKVYRIFSMMQTNFSTMFWFQLLGEYRAIFSTESSSPLDSDHHFIDLSACYN 455
            S+E + ++ K  R F+++QT+FST F+  L+ E       E+ S  + D+HFI+LS  Y+
Sbjct: 409  SKEELEKSSKSLRTFNLLQTSFSTSFFKLLIQERGVGLPIENQSNYNIDYHFINLSVSYH 468

Query: 456  YIDRDIIRNYEAQCTLDPENVGVYVDALNFIANRKGAYQLIAYCGKQDFVGQEALDHALG 515
            Y +RDII+ +E    +DP+N+G Y D+L FIAN KG+YQLIAYC K D VGQE+L+ A+ 
Sbjct: 469  YSERDIIQMFEVISKVDPDNIGHYYDSLQFIANAKGSYQLIAYCSKLDIVGQESLETAIK 528

Query: 516  VFQIDSKEFDPHNLNDSVLLSIY----KNESASTRNPNRHAELKNSLRLLAKFKKSPKLK 571
             F +D       +L DSV++SIY    KN+S S     RH  L+N+L++LA +KKS KLK
Sbjct: 529  TFNLDLSVTALSSLEDSVIMSIYQAELKNKSLSQE---RHVNLRNALQVLASYKKSKKLK 585

Query: 572  FYADYEPYRNVTQAYEILEVDESVDDDIIQTAYTVKVNDSPGLKIDCDRALYTIAVHSRS 631
            F+ DYEPY N   AY +LE+DES+DDDIIQTAY++KVND+PGLK+DCDRALYTIA+  RS
Sbjct: 586  FFVDYEPYLNTRTAYNMLEIDESIDDDIIQTAYSIKVNDAPGLKLDCDRALYTIAIARRS 645

Query: 632  LALFNFLVQQSEEFQEYFGPDQFSYQDALSVLQVNENAGDDTILEIFQRKWYKEPVFDAD 691
            ++LFNFL++ +  FQEY+  D FSY  ALS+LQVNENA D+ ILE+FQ+KW++E +   D
Sbjct: 646  ISLFNFLLENNLIFQEYYTADTFSYTSALSLLQVNENASDENILEVFQKKWFEEAMVAFD 705

Query: 692  QFLKLKGALSKIGFERNSKLISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYY 751
              LKLK AL+KI F+RNSKLIS+F++TG +D SCLPAENWPTGLNNIGNTCYLNSLLQYY
Sbjct: 706  HLLKLKAALTKIAFQRNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYY 765

Query: 752  FSISSLRQYVLDYRNTVQHFLNNQEY--ASRRIGGREITEAEVERSVQFVYQLRDLFDSM 809
            F+IS LR  +++Y  TV    NN +    +RR+GGR     EVERSVQFVYQLRDLF  M
Sbjct: 766  FAISPLRDEIINYTKTVDDIENNLQLQGITRRVGGRVTNTIEVERSVQFVYQLRDLFSEM 825

Query: 810  IHAQDRCVTPRKELAYLAFVPSGLGVEFELPNASQANANAPVEKENYVXXXXXXXXXXXX 869
            I++  RCVTP+KELAYLAF PS + VEF+  +      N   E  +              
Sbjct: 826  IYSHSRCVTPKKELAYLAFAPSNVEVEFDSEDGKSQRDNISTETVD-------------- 871

Query: 870  XXXXXXXXXXXXXXXHSKLNKNSNDDGKINEFDNSQAGEND------VDVDISMTDSPAE 923
                              +  +  +D  + +FD S  G N       VD+D +++D   E
Sbjct: 872  ------------------VGADGKNDNLLVDFD-SNIGANGRDEKLLVDLDSNISDKIKE 912

Query: 924  EEKVTKADSGSSSNNSNKAVAMNTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLE 983
            EE V K        N+ K V   TSTRVAKIS DQLENALEMGRQQDVTECIGNVL QLE
Sbjct: 913  EE-VKKI-------NTLKPV---TSTRVAKISPDQLENALEMGRQQDVTECIGNVLNQLE 961

Query: 984  SASDPISLGDDNEQNDLVKQLFYGNIKQNIIPLKDETQVRTKYERFLSLLVNIGDHPKDI 1043
            SAS P+SL DD EQNDL+K  F    KQ+IIPL+     R K ERFLSLLVNIGDHPK+I
Sbjct: 962  SASIPLSLDDDEEQNDLLKNCFLVKTKQSIIPLEKSKPPRNKIERFLSLLVNIGDHPKNI 1021

Query: 1044 YDALDLYFRDEYLKLEEYGDVKRTVAVTDFPTILQIQIQRVYYDRERFMPFKSVAPLPFN 1103
            YDALDLYF DE L++EEYG+V++T+++T+FP+ILQIQIQRVYYDRE+F+PFKS+ PLPF 
Sbjct: 1022 YDALDLYFNDELLQMEEYGEVRKTLSITEFPSILQIQIQRVYYDREKFIPFKSIEPLPFG 1081

Query: 1104 ETIYMDRYSDTNNPVLINRKRETEKLVQELNGLKGRQRELLSKNELGLSRKGALIETSNF 1163
              +YMDRY++ +N  LI+ K +   + +EL  +K RQ+ELLS+NELGLSRK +LIET   
Sbjct: 1082 NVLYMDRYAELDNKELIDTKNKARIMKKELANMKKRQKELLSRNELGLSRKESLIETKRL 1141

Query: 1164 LKSDVLETQGIQIDNRTGLAQELDNIVLGINDELSQLYHNITQLESKISHQFDDFKSIGY 1223
            L SDVL+  GI +  +T L  +++  +L I+ EL+ L++NI  +E  IS+ F +F+SI Y
Sbjct: 1142 LMSDVLDNNGIDVPMKTSLISQIEANLLEIDRELTTLFNNIRDMELNISNMFKEFQSIKY 1201

Query: 1224 SLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPYFL 1283
            +LFAVFIHRGEASYGHYW YIKD  ++ IWRKYNDETITEVP+SEVFNF EGNTATPYFL
Sbjct: 1202 NLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTATPYFL 1261

Query: 1284 VYVKQGHEQEIEPLKRVL 1301
            VYVK  +  +IEPLKR++
Sbjct: 1262 VYVKNENIDDIEPLKRIV 1279

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
            similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 1248 bits (3228), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 660/1271 (51%), Positives = 868/1271 (68%), Gaps = 81/1271 (6%)

Query: 56   TQDSGKVPLYPEAAARFPFKTADRLLDDILHDLSFINSDDHSILYSDLSNGILKSPVLSY 115
             ++ GK  LYP  +  +PFKT+DRLLDDI   LSF+       L     NG+LKSP+L Y
Sbjct: 26   VREGGKTVLYPLVSGNYPFKTSDRLLDDIRSTLSFV-------LEGVRGNGVLKSPMLDY 78

Query: 116  SRKVGKTRAYNLGSLVDQVVLQTKFEYDSVSCP------QHNHLQVFMGVLIDVTQQNVA 169
            S++ G+ RA+++G L+DQV+LQT +EY S+         +H+ + VFMG+L D   + + 
Sbjct: 79   SKERGELRAWSIGYLLDQVLLQTSYEYASLGGSGGGGGDKHSKINVFMGLLCDPMVK-LC 137

Query: 170  TFNNLATLPIFHLKVTVKTRDVLERTKKKAGITHYHSLDESEIHPYDKQDLLTFDSKDPQ 229
            + +++     +HL+VTVKTR  LER K++ GI  YH +++  +HP DKQDL  F+  D  
Sbjct: 138  SEDDIVNYSGYHLRVTVKTRLHLERAKRQFGIAQYHLVND--LHPADKQDLCFFEDDDEC 195

Query: 230  LLDYAIYVSSDSNKLILIEIFKPEFDSDEERDAFKEESINNRYEMACNRFDSLDPTRIPT 289
            ++D A YVSS +N+L+ IEI KPEF + EE   F  +SI  RY   C ++  L+   +P 
Sbjct: 196  VIDSATYVSSGTNRLVRIEILKPEFTA-EEWSEFTPDSIRKRYLSICEKYPDLNRENVPN 254

Query: 290  QPDCINTLFKIFKGPLNRKSSEEPRKTINPNNVSLNSHIDPTWLTSKYGFELHVEKDEET 349
            Q +C+NTLFK+FK PL+R+ S++  KTI+  N  LNS +DP WL  K+GFEL  E  EE 
Sbjct: 255  QAECLNTLFKVFKNPLSRQDSDDELKTISAENKVLNSQLDPNWLVDKFGFEL-CEVQEED 313

Query: 350  GEDILEYAPPDLTNYHRDWKVRRLRESFTRRCLELIFLGRVSIRLLSQEAVNRNPKVYRI 409
            G    EY PPD TNY  DW VR LRE + R+ LEL+F+G+ SIRLL +E V  + K+ R 
Sbjct: 314  GRKEYEYKPPDFTNYVNDWNVRHLRERYIRKSLELLFVGKQSIRLLPKEVVAASSKL-RS 372

Query: 410  FSMMQTNFSTMFWFQLLGEY-RAIFSTESSSPLDSDHHFIDLSACYNYIDRDIIRNYEAQ 468
            F + QT+FS  FWFQLLGE+ R  F+ +   P D++ HFI+LS  Y Y DRDIIRNYE+Q
Sbjct: 373  FQLYQTHFSHTFWFQLLGEFDRNDFNQQQQHPYDTNPHFINLSVNYYYGDRDIIRNYESQ 432

Query: 469  CTLDPENVGVYVDALNFIANRKGAYQLIAYCGKQDFVGQEALDHALGVFQIDSKEFDPHN 528
              LDP+N G+Y D L FIAN KG++QL+ +  KQ+ VGQEAL+ AL +F ID  E DP  
Sbjct: 433  ILLDPKNAGIYYDDLTFIANVKGSHQLLTFTLKQNIVGQEALNSALRLFHIDPSETDPKQ 492

Query: 529  LNDSVLLSIYKNESASTRNPNRHAELKNSLRLLAKFKKSPKLKFYADYEPYRNVTQAYEI 588
            + D +LLS YK E     N  +HA+L+N+LRLLAK+K+S KLKFY + EP++  +QAY I
Sbjct: 493  IPDEMLLSCYK-EECKYGNTRQHADLRNALRLLAKYKQSEKLKFYVELEPFQQESQAYSI 551

Query: 589  LEVDESVDDDIIQTAYTVKVNDSPGLKIDCDRALYTIAVHSRSLALFNFLVQQSEEFQEY 648
            LE+DESVD DII+TAYT+KV+D+PGLK+DCDRALYT+A+  RS+ LFN+L+Q+   FQ++
Sbjct: 552  LEIDESVDIDIIETAYTIKVSDAPGLKVDCDRALYTLAIAKRSMDLFNYLLQRCPRFQQF 611

Query: 649  FGPDQFSYQDALSVLQVNENAGDDTILEIFQRKWYKEPVFDADQFLKLKGALSKIGFERN 708
            +    +SY  AL  LQVN NA DD ILEIF+RKW +EPV   DQFL LK AL KI  ERN
Sbjct: 612  YHISYWSYTSALQYLQVNVNATDDLILEIFRRKWAEEPVISPDQFLNLKVALMKIAHERN 671

Query: 709  SKLISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTV 768
            SKLI+HF++TG +D + L + NWPTGLNNIGNTCYLNSLLQYYF+IS LR Y+ +Y +T 
Sbjct: 672  SKLINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTA 731

Query: 769  QHFLNNQEYAS----RRIGGREITEAEVERSVQFVYQLRDLFDSMIHAQDRCVTPRKELA 824
               L N   +     RRIGGR + + EVERSVQFVYQLRDLF+ M H+++RCVTP +ELA
Sbjct: 732  SDLLLNMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLRDLFNDMAHSKERCVTPSRELA 791

Query: 825  YLAFVPSGLGVEFELPNASQANANAPVEKENYVXXXXXXXXXXXXXXXXXXXXXXXXXXX 884
            YL+F PS   VEFE      + A  P      +                           
Sbjct: 792  YLSFSPSTTNVEFE------SAAQVPFRDTTILLE------------------------- 820

Query: 885  HSKLNKNSNDDGKINEFDNSQAGENDVDVDISMTDSPAEEEKVTKAD------------- 931
                 +  N+D ++  FD S  G N V+ + +  D  A++   TK +             
Sbjct: 821  ----QEPPNEDTEV--FDISIEGSN-VETEAAAEDIIADDNIDTKDESSSLSPSTSTSSS 873

Query: 932  -SGSSSNNSNKAVAMNTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPIS 990
              G+S +N  +     TST VAKIS DQLEN LE+GRQQDVTECIGNVL+Q+ESAS P++
Sbjct: 874  QKGNSMSNIVEENEPITSTCVAKISPDQLENTLEIGRQQDVTECIGNVLYQIESASVPLN 933

Query: 991  LGDDNEQNDLVKQLFYGNIKQNIIPLKDETQVRTKYERFLSLLVNIGDHPKDIYDALDLY 1050
              + +EQ DLVKQLFYG +KQ++IP+++  + RTK+ERF+SLLVN+GDHPKDIYDALDLY
Sbjct: 934  FDEGHEQYDLVKQLFYGKLKQDLIPIENPEKRRTKFERFMSLLVNVGDHPKDIYDALDLY 993

Query: 1051 FRDEYLKL-EEYGDVKRTVAVTDFPTILQIQIQRVYYDRERFMPFKSVAPLPFNETIYMD 1109
            FRD+ L L ++   V+R+VAV + PTILQIQIQRVYYDRE+ MPFKS  PLPF E +YMD
Sbjct: 994  FRDDLLALGDDNARVRRSVAVEELPTILQIQIQRVYYDREKLMPFKSTEPLPFGEKLYMD 1053

Query: 1110 RYSDTNNPVLINRKRETEKLVQELNGLKGRQRELLSKNELGLSRKGALIETSNFLKSDVL 1169
            RY  +    L+ +K+E+ +L + L  +K R++++LSKN+ GL+ K +L ET  FL+S VL
Sbjct: 1054 RYMASTESELLAKKQESLQLHETLEAIKQRRKKILSKNDAGLTLKDSLKETKIFLESSVL 1113

Query: 1170 -ETQG-IQIDNRTGLAQELDNIVLGINDELSQLYHNITQLESKISHQFDDFKSIGYSLFA 1227
             E++G I+I+ R  L ++LD+  L I+ ELS L   I  +E+ ISH+FD F + GY+LFA
Sbjct: 1114 AESEGKIRIEKR-NLIKQLDSFSLEIDKELSNLDDKIKDMENSISHKFDQFTNFGYNLFA 1172

Query: 1228 VFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPYFLVYVK 1287
            VFIHRGEASYGHYW+YIKDR  SGIWRKYNDE++TEVPESEVF+F+E NTATPYFLVY+K
Sbjct: 1173 VFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPYFLVYIK 1232

Query: 1288 QGHEQEIEPLK 1298
             GHE EIEPLK
Sbjct: 1233 DGHEHEIEPLK 1243

>CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa]
            {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124c UBP2 ubiquitin-specific proteinase
          Length = 1267

 Score = 1186 bits (3069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 629/1281 (49%), Positives = 859/1281 (67%), Gaps = 78/1281 (6%)

Query: 52   ELLDTQDSGKVPLYPEAAARFPFKTADRLLDDILHDLSFINSDDHSILYSDLSNGILKSP 111
            ++ + +D G+  LYP      P KT+DRLLDDIL  + F+ S D+          IL S 
Sbjct: 33   DVTNIEDDGRQLLYPNIGTHLPLKTSDRLLDDILCSVGFLTSGDNK--------SILNSN 84

Query: 112  VLSYSRKVGKTRAYNLGSLVDQVVLQTKFEYDSVSCPQHNHLQVFMGVLID---VTQQNV 168
             L YS++    +   +G   DQV++QTK+EY S SCP+HN + V MG+LI    + +   
Sbjct: 85   TLEYSKQRPHIKGSAVGFFQDQVIIQTKYEYPSKSCPEHNKIFVIMGILIGTDYLEKAEK 144

Query: 169  ATFNNLATLPIFHLKVTVKTRDVLERTKKKAGITHYHSLDESEIHPYDKQDLLTFDSKDP 228
               + +  +PI+H+K++VK R +LE +KK  G++ Y+ LD+  +H YD+ D  ++D  D 
Sbjct: 145  KQISEVTEIPIYHVKISVKVRSILENSKKLVGVSRYYKLDQ--LHDYDRVDFPSYDPTDS 202

Query: 229  QLLDYAIYVSSDSNKLILIEIFKPEFDSDEERDAFKEESINNRYEMACNRFDSLDPTRIP 288
            +LLD A+Y + D+NK++LIEI+KPEFD +++  +     I NR+  A  +F  L     P
Sbjct: 203  KLLDSALYATDDTNKIVLIEIYKPEFDPEDKDLSVSSVQIKNRFAQAKEKFPQLAKEESP 262

Query: 289  TQPDCINTLFKIFKGPLNRKSSEEPRKTINPNNVSLNSHIDPTWLTSKYGFELHVEKDEE 348
            TQ D INTLFK+FKGPL RKS + P+K+I   +  L S+++P+ L + +GF         
Sbjct: 263  TQLDSINTLFKLFKGPLKRKSDDAPQKSIEAEHPLLISNMNPSALVTHFGFTY------- 315

Query: 349  TGEDIL--EYAPPDLTNYHRDWKVRRLRESFTRRCLELIFLGRVSIRLLSQEAVNRN--P 404
            T E+I   EY  PDL NY  D  +++LR++FTR+CLELI  G + I  L Q   +     
Sbjct: 316  TNENIPGGEYMAPDLVNYLGDPNIQKLRDTFTRKCLELIAYGNIIISSLPQNITSTAEFS 375

Query: 405  KVYRIFSMMQTNFSTMFWFQLLG-------------EYRAIFSTESS-----SPLDSDHH 446
            K YRI   +Q  FS   W QLLG             E++     E+      SP D D +
Sbjct: 376  KKYRILRTIQPEFSLFSWLQLLGDFKSRNIELLNVNEHKGYHLQEAQKRVYYSPFDIDSN 435

Query: 447  FIDLSACYNYIDRDIIRNYEAQCTLDPENVGVYVDALNFIANRKGAYQLIAYCGKQDFVG 506
            F +LS C +Y +RDII+NYE   TLD  N+G+Y D+L+ +ANRKG+YQL++YCGKQD +G
Sbjct: 436  FTNLSVCLHYAERDIIQNYERLITLDEPNIGIYFDSLSVVANRKGSYQLLSYCGKQDVIG 495

Query: 507  QEALDHALGVFQIDSKEFDPHNLNDSVLLSIYKNESASTRNPNRHAELKNSLRLLAKFKK 566
            QEAL ++L VF ID  +    +L++++LLS+YK+E     + NR ++LKN+LRLLAK+  
Sbjct: 496  QEALQNSLAVFGIDYTKVTLESLDENLLLSVYKHEWKENPDNNRISDLKNALRLLAKYFT 555

Query: 567  SPKLKFYADYEPYRNVTQAYEILEVDESVDDDIIQTAYTVKVNDSPGLKIDCDRALYTIA 626
            S  LKFY DYEPYR + +AY++LE+DESVD+DIIQTAYT+K+ND+PGLKIDCDRALYTIA
Sbjct: 556  SDYLKFYVDYEPYRIIQKAYDLLEIDESVDEDIIQTAYTIKINDAPGLKIDCDRALYTIA 615

Query: 627  VHSRSLALFNFLVQQSEEFQEYFGPDQFSYQDALSVLQVNENAGDDTILEIFQRKWYKEP 686
               RSL LFNFL  Q  EFQ Y+G     Y  +  +LQ+NEN  +  +L +FQ+KW    
Sbjct: 616  YSRRSLMLFNFLFDQCPEFQRYYGAQSLGYHQSFEILQINENITEPNLLHVFQQKWKNTL 675

Query: 687  VFDADQFLKLKGALSKIGFERNSKLISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNS 746
            + + DQ LK + AL+KI  ERNS L+ +F++TG ++ + LPAENWPTG+NNIGNTCYLNS
Sbjct: 676  LEEPDQLLKYRAALTKIALERNSNLLLNFLETGNINPNSLPAENWPTGINNIGNTCYLNS 735

Query: 747  LLQYYFSISSLRQYVLDYRNTVQHFLNNQE--YASRRIGGREITEAEVERSVQFVYQLRD 804
            LLQ+YF+IS LR+Y++ Y+ T+    +N +   + RRIGGR++ + E+ERSVQF+YQLRD
Sbjct: 736  LLQFYFAISPLREYIVQYQKTIADLSSNPDSIISKRRIGGRQVGKNEIERSVQFLYQLRD 795

Query: 805  LFDSMIHAQDRCVTPRKELAYLAFVPSGLGVEFELPNASQANANAPVEKENYVXXXXXXX 864
            L++ MI +  RCVTP++ELAYLAF PS + VEFE  NA   +  + +E  N         
Sbjct: 796  LYNDMIFSSQRCVTPKRELAYLAFAPSSIDVEFE--NAKTKSPISNIEGSN--------- 844

Query: 865  XXXXXXXXXXXXXXXXXXXXHSKLNKNSNDDGKINEFDNSQAGENDV---DVDISMTDSP 921
                                +  + +   ++ +IN  +N ++  ND+   + DI M D+ 
Sbjct: 845  ---STTDSQPMPSTGENIDHNMDIEQEERNNEEINSTNNIES--NDLVSNNHDIEMLDTD 899

Query: 922  AEEEKVTKADSGSSSNNSNKAVAMNTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQ 981
             E E   + +              +T+ +VAKI  +QLENALE+GRQQDVTECIGNVLFQ
Sbjct: 900  KENEGNMEIE--------------DTAIKVAKIDPEQLENALELGRQQDVTECIGNVLFQ 945

Query: 982  LESASDPISLGDDNEQNDLVKQLFYGNIKQNIIPLKDETQVRTKYERFLSLLVNIGDHPK 1041
            LES+S P SL +D+EQNDL+K+LF+G   Q+I PLK ++  RTK ERF+SLLVNI DHPK
Sbjct: 946  LESSSSPTSLSEDHEQNDLIKELFFGETNQHIKPLKADSVTRTKVERFVSLLVNIADHPK 1005

Query: 1042 DIYDALDLYFRDEYLKLEEYGDVKRTVAVTDFPTILQIQIQRVYYDRERFMPFKSVAPLP 1101
            D+YDALDLYF++EYL +EEYG+VKR +A+  FPTILQIQIQRVYYDRERFMP+KS+ PLP
Sbjct: 1006 DVYDALDLYFKEEYLTMEEYGEVKRELAIKKFPTILQIQIQRVYYDRERFMPYKSIEPLP 1065

Query: 1102 FNETIYMDRYSDTNNPVLINRKRETEKLVQELNGLKGRQRELLSKNELGLSRKGALIETS 1161
            F   IY+DRY+DT++  L+ ++ ET +L ++L   K RQ+ELLS+NELGLSR+ A  ET+
Sbjct: 1066 FESDIYLDRYADTDDVKLLQKREETAELKRQLRSFKERQKELLSRNELGLSRRDAYKETA 1125

Query: 1162 NFLKSDVLETQGIQIDNRTGLAQELDNIVLGINDELSQLYHNITQLESKISHQFDDFKSI 1221
            NFL+S+VL+   I I +   LA +L+     + DELS LY  IT LE KI+HQFDDF   
Sbjct: 1126 NFLRSEVLQNTNISISDPDLLATKLEESASKVADELSDLYVKITNLEEKINHQFDDFTEH 1185

Query: 1222 GYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPY 1281
            GY+LFAVFIHRGEASYGHYW+YIKD + + IWRKYNDET+TEVPE EV NF+EGNTATPY
Sbjct: 1186 GYTLFAVFIHRGEASYGHYWVYIKD-FVNSIWRKYNDETVTEVPEEEVMNFTEGNTATPY 1244

Query: 1282 FLVYVKQGHEQEIEPLKRVLE 1302
            F+V+VK+GHE++IEPLKR++E
Sbjct: 1245 FIVFVKKGHEKDIEPLKRMIE 1265

>ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR124C
           (UBP2)
          Length = 1389

 Score =  803 bits (2074), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/812 (50%), Positives = 552/812 (67%), Gaps = 24/812 (2%)

Query: 50  KNELLDTQDSGKVPLYPEAAARFPFKTADRLLDDILHDLSFINSDDHSILYSDLSNGILK 109
           +N  L+  D G+  LY   A + P KT+DRLLDD+   +S           S+    +L+
Sbjct: 13  QNCELEQGDDGRTVLYGNLARQGPVKTSDRLLDDVRVTVSL----------SEEGREVLR 62

Query: 110 SPVLSYSRKVGKTRAYNLGSLVDQVVLQTKFEYDSVSCPQHNHLQVFMGVLIDVTQQNVA 169
           +P+L Y+R+    R +++G L+DQVVLQT FEY S +C Q N + VFMGVL D  Q+  A
Sbjct: 63  APMLEYARQRANARTWSVGYLLDQVVLQTSFEYTSRTCAQ-NRVHVFMGVLCDPGQR-FA 120

Query: 170 TFNNLATLPIFHLKVTVKTRDVLERTKKKAGITHYHSLDESEIHPYDKQDLLTFDSKDPQ 229
           + + L    I+HL+VTVK R  LER ++  G+  YH +DE  +HP+DK D   F+  DP 
Sbjct: 121 SQDELVNYRIYHLRVTVKIRPQLERARQHYGVAQYHLVDE--LHPWDKPDFCLFEDGDPA 178

Query: 230 LLDYAIYVSSDSNKLILIEIFKPEFDSDEERDAFKEESINNRYEMACNRFDSLDPTRIPT 289
           ++D A YV+S +N+L+ IE+ +PEF  DE ++ F  E I  RY   C R   LDP+ IP+
Sbjct: 179 VVDSATYVASGTNRLVRIEVLRPEFGPDELQE-FTGERIRARYLEVCKRHPDLDPSDIPS 237

Query: 290 QPDCINTLFKIFKGPLNRKSSEEPRKTINPNNVSLNSHIDPTWLTSKYGFELHVEKDEET 349
           Q +C+NTLFK+FK PL+R+ +++  KTI+ +N  LNS ++  WL +K+GFEL   + EE 
Sbjct: 238 QAECLNTLFKVFKNPLSRQKAQDELKTISADNKVLNSQLEANWLVTKFGFELC--EIEED 295

Query: 350 GEDILEYAPPDLTNYHRDWKVRRLRESFTRRCLELIFLGRVSIRLLSQEAVNRNPKVYRI 409
           G+ I EY PPD T +  +W+VRR RES+ R+ LELIFLG+ S+RL+ ++ V  N K+ R 
Sbjct: 296 GQKIYEYKPPDFTEHVENWEVRRFRESYIRKSLELIFLGKQSLRLVPKDVVVSNSKL-RS 354

Query: 410 FSMMQTNFSTMFWFQLLGEYRAIFSTESSSPLDSDHHFIDLSACYNYIDRDIIRNYEAQC 469
           F + QT+FS  FW+ L+GEY      +   P D+++HF+ LS+ Y Y DRDII+NYEAQ 
Sbjct: 355 FQLYQTHFSHSFWYHLMGEYDHNDFNQQMHPYDTNYHFVHLSSNYYYSDRDIIKNYEAQI 414

Query: 470 TLDPENVGVYVDALNFIANRKGAYQLIAYCGKQDFVGQEALDHALGVFQIDSKEFDPHNL 529
            LDP N  +Y D L+F+AN KG+ QL+ Y  KQ+ VG EAL  AL +F +D    DP  L
Sbjct: 415 ALDPANASIYYDDLSFVANSKGSKQLLTYTYKQNVVGHEALMSALRLFHLDPSSTDPRQL 474

Query: 530 NDSVLLSIYKNESASTRNPNRHAELKNSLRLLAKFKKSPKLKFYADYEPYRNVTQAYEIL 589
           +D  LL  YK E      P +HA+L+N+LRLLA++K+S KLKFY + EP+ N  QAY++L
Sbjct: 475 SDEFLLESYK-EVCKDSGPQKHADLRNALRLLARYKESDKLKFYVEVEPFPNELQAYKLL 533

Query: 590 EVDESVDDDIIQTAYTVKVNDSPGLKIDCDRALYTIAVHSRSLALFNFLVQQSEEFQEYF 649
           E+DESVD DII+TAY++KV+D+PGLK+DC RALYT+AV  RS+ LFN L QQ  +F +++
Sbjct: 534 EIDESVDIDIIETAYSIKVSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQCPKFHQFY 593

Query: 650 GPDQFSYQDALSVLQVNENAGDDTILEIFQRKWYKEPVFDADQFLKLKGALSKIGFERNS 709
                SYQ AL  L VN NA DD ILEIFQRKW  +P+   +Q L LK AL+KIGFERNS
Sbjct: 594 HMSYLSYQSALQYLHVNVNATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTKIGFERNS 653

Query: 710 KLISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQ 769
           KLI+HF++TG VD + LPA NWPTG+NNIGNTCYLNSLLQYYF+IS LR+Y+L Y +T  
Sbjct: 654 KLINHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHTAS 713

Query: 770 HFLNNQEYAS----RRIGGREITEAEVERSVQFVYQLRDLFDSMIHAQDRCVTPRKELAY 825
           + LNN   +S    RRIGGR I++AEVERSVQFVYQLR LF  M+H+++R VTP +EL Y
Sbjct: 714 NLLNNAVSSSDMGRRRIGGRAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTRELVY 773

Query: 826 LAFVPSGLGVEFE-LPNASQANANAPVEKENY 856
           L+F PS   VEFE +P A    +NA V  E Y
Sbjct: 774 LSFSPSSTEVEFEPVPPAVGTASNALVANEVY 805

 Score =  414 bits (1063), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 228/404 (56%), Positives = 284/404 (70%), Gaps = 22/404 (5%)

Query: 901  FDNSQAGEND-VDVDISMTDSPAEEEKVTKADSGSSSNNSNKAVAMNTSTRVAKISSDQL 959
             ++ QA END    DI+M  SP  E                      TST VAKISSDQL
Sbjct: 1004 LEDRQAVENDDSGKDITMVGSPEAE-------------------GPETSTYVAKISSDQL 1044

Query: 960  ENALEMGRQQDVTECIGNVLFQLESASDPISLGDDNEQNDLVKQLFYGNIKQNIIPLKDE 1019
            EN LE+GRQQDVTECIGNVL+Q+ESAS P+SL ++ EQ DLVKQLFYG +KQ +IPL+  
Sbjct: 1045 ENTLEIGRQQDVTECIGNVLYQIESASVPLSLDEEGEQFDLVKQLFYGKLKQELIPLEFP 1104

Query: 1020 TQVRTKYERFLSLLVNIGDHPKDIYDALDLYFR-DEYLKLEEYGDVKRTVAVTDFPTILQ 1078
             + RTK ERF+SLLVNIGDHPKDIYDALD YF+ D     E+ G V+R+VAV + P +LQ
Sbjct: 1105 DRKRTKIERFMSLLVNIGDHPKDIYDALDSYFKDDLLTLDEDDGKVRRSVAVAELPIMLQ 1164

Query: 1079 IQIQRVYYDRERFMPFKSVAPLPFNETIYMDRYSDTNNPVLINRKRETEKLVQELNGLKG 1138
            IQIQRVYYDRE+FMPFKS  PLPF E +YMDRY  T+N  L  +K++   L +EL  L+ 
Sbjct: 1165 IQIQRVYYDREKFMPFKSTEPLPFGEKLYMDRYLATDNAELNAKKQQAIGLREELERLRE 1224

Query: 1139 RQRELLSKNELGLSRKGALIETSNFLKSDVLETQGIQIDNR-TGLAQELDNIVLGINDEL 1197
            R+R LL+KN+ G++   AL +T  FL +  L +   Q+  +       LD + + +++EL
Sbjct: 1225 RRRRLLAKNDHGVTLSAALADTRRFLDAAELTSGSRQLQEQYHATTSHLDALRVALDEEL 1284

Query: 1198 SQLYHNITQLESKISHQFDDFKSIGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYN 1257
            + L  +I  ++  I+H+FD F S GYSL AVFIHRGEASYGHYW+YIKD    GIWRKYN
Sbjct: 1285 AALDAHIASVQDAIAHRFDAFSSYGYSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYN 1344

Query: 1258 DETITEVPESEVFNFSEGNTATPYFLVYVKQGHEQEIEPLKRVL 1301
            DE++TEVPESEVF+FSE NTATPYFLVYVK+ HE +IEPLKR+L
Sbjct: 1345 DESVTEVPESEVFDFSEENTATPYFLVYVKEAHELDIEPLKRLL 1388

>KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa]
           {ON} uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
           carboxyl-terminal hydrolase 2
          Length = 1220

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/811 (45%), Positives = 515/811 (63%), Gaps = 27/811 (3%)

Query: 33  EQIGETMSESEISEDPGKNELLDTQDSGKVPLYPEAAARFPFKTADRLLDDILHDLSFIN 92
           EQ       +E+          D  D GK  LY + +  FPFKT DR+LDDI     F+ 
Sbjct: 14  EQRDSVSETAEVLRSKSLESFSDLVDDGKTLLYGDISKSFPFKTCDRILDDIRISPWFLK 73

Query: 93  SDDHSILYSDLSNGILKSPVLSYSRKVGKTRAYNLGSLVDQVVLQTKFEYDSVSCPQHNH 152
                       + ++K P+L YSR+  + + +NL  L+DQV L+++++YDS++CP  N 
Sbjct: 74  K---------FGSSVMKQPMLQYSRERQQLQPWNLVHLIDQVNLRSRYDYDSMTCPGKNT 124

Query: 153 LQVFMGVLIDVTQQNVATFNNLATLP--IFHLKVTVKTRDVLERTKKKAGITHYHSLDES 210
           + V   +L+D        F+++   P   FHLK+TVK R  LE   +  GITHYH L+  
Sbjct: 125 ISVMFALLVD-PNFTPNDFDDIDKFPEYFFHLKITVKRRSYLENFNRHVGITHYHVLEPE 183

Query: 211 EIHPYDKQDLLTFDSKDPQLLDYAIYVSSDSNKLILIEIFKPEFDSDEERDAFKEESINN 270
            +HP+DK+D+   + KD +L+D +I+VS+D+NKLIL+EI KPEF+S E    ++   I  
Sbjct: 184 SLHPFDKRDIFIMEEKDCRLVDQSIFVSADTNKLILVEIIKPEFNS-ENLAEYRTAKIEE 242

Query: 271 RYEMACNRFDSLDPTRIPTQPDCINTLFKIFKGPLNRKSSEEPRKTINPNNVSLNSHIDP 330
           RY+ AC  FD L+P  IP+Q +C+ TLF IFK PL RKS+    K I+ ++V+LNS I+ 
Sbjct: 243 RYKNACQEFDLLNPDDIPSQAECLKTLFMIFKNPLQRKSANSEFKIISRDSVALNSQINT 302

Query: 331 TWLTSKYGFELH---VEKDEETGEDILEYAPPDLTNYHRDWKVRRLRESFTRRCLELIFL 387
            WLT+ + F L    VE + ++GE   EY PPDL +Y  D+KVR +RE++TR+ +E++ +
Sbjct: 303 DWLTTMFDFSLQKTAVEDNVQSGE---EYKPPDLVDYITDFKVRGIREAYTRKSMEVVLI 359

Query: 388 GRVSIRLLSQEAVNRNPKVYRIFSMMQTNFSTMFWFQLLGEYRAIFSTESSSPLDSDHHF 447
           G+ S+ LL  E       V + FS    + S  +WF +L             P D ++HF
Sbjct: 360 GKQSM-LLENELGTEKKTVAKCFSNQHFSASHTWWFNILNHQHI-----EPFPYDINYHF 413

Query: 448 IDLSACYNYIDRDIIRNYEAQCTLDPENVGVYVDALNFIANRKGAYQLIAYCGKQDFVGQ 507
           I+LS  + YID+DII+NYE Q  LD EN+  Y DAL ++ N KG+YQLIAYCGKQD VG 
Sbjct: 414 INLSVAFKYIDKDIIKNYETQIALDQENISHYFDALQYVTNAKGSYQLIAYCGKQDVVGY 473

Query: 508 EALDHALGVFQIDSKEFDPHNLNDSVLLSIYKNESASTRNPNRHAELKNSLRLLAKFKKS 567
           E L++AL VF +D  + D   L+ + ++  Y N      + N+  +L+N+LR+L K+  S
Sbjct: 474 EDLNNALQVFGLDPTDIDASLLDANTMIEYY-NSHLLRSSDNQRKDLRNALRVLGKYLGS 532

Query: 568 PKLKFYADYEPYRNVTQAYEILEVDESVDDDIIQTAYTVKVNDSPGLKIDCDRALYTIAV 627
            K+ F  +YEPY NV QAY +L+VDE+VDDDIIQTAYT+ + D+PGLK D DRA++TIA+
Sbjct: 533 QKMLFLVEYEPYYNVQQAYTLLKVDETVDDDIIQTAYTINIADAPGLKKDYDRAIFTIAL 592

Query: 628 HSRSLALFNFLVQQSEEFQEYFGPDQFSYQDALSVLQVNENAGDDTILEIFQRKWYKEPV 687
             RS+ L N L  +  EF +Y+     SY +AL++++++ NA DD ILE+FQ+KW    +
Sbjct: 593 DRRSIFLLNVLTDECPEFAQYYNCTDISYDEALNIIEIDMNASDDVILEVFQKKWSHGIM 652

Query: 688 FDADQFLKLKGALSKIGFERNSKLISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSL 747
              D  LKLK AL  IGF RNSKLI+HF+DTG VD SCLP   WP G+NN+GNTCYLNSL
Sbjct: 653 TGPDYLLKLKMALQNIGFTRNSKLINHFLDTGIVDVSCLPVATWPAGINNVGNTCYLNSL 712

Query: 748 LQYYFSISSLRQYVLDYRNTVQHFLNNQEYAS-RRIGGREITEAEVERSVQFVYQLRDLF 806
           LQ++F+I  LR ++L+Y +     L+  EY S RRIGGRE+++ E  RSVQFVY LRDLF
Sbjct: 713 LQFFFTIKPLRDFILNYDDDSAKLLDASEYHSRRRIGGREVSKQEELRSVQFVYHLRDLF 772

Query: 807 DSMIHAQDRCVTPRKELAYLAFVPSGLGVEF 837
           + MIH   RCVTP KEL YLAF PS + VEF
Sbjct: 773 NDMIHTNSRCVTPTKELVYLAFAPSNVEVEF 803

 Score =  510 bits (1313), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 251/394 (63%), Positives = 307/394 (77%), Gaps = 12/394 (3%)

Query: 911  VDVDISMTDSP-AEEEKVTKADSGSSSNNSNKAVAMNTSTRVAKISSDQLENALEMGRQQ 969
             D DI M  SP A  E  T +++G+             S +VAKIS+DQLEN LE+GRQQ
Sbjct: 834  CDDDIIMCQSPVALPEHKTSSEAGTQ----------QYSVQVAKISADQLENTLEIGRQQ 883

Query: 970  DVTECIGNVLFQLESASDPISLGDDNEQNDLVKQLFYGNIKQNIIPLKDETQVRTKYERF 1029
            DVTECIGNVL QLE AS+P+SL DD EQNDLVKQLFYG IKQ++IP+ DE  VRTKYERF
Sbjct: 884  DVTECIGNVLAQLEIASEPLSLEDDLEQNDLVKQLFYGRIKQDLIPVNDEASVRTKYERF 943

Query: 1030 LSLLVNIGDHPKDIYDALDLYFRDEYLKLEEYGDVKRTVAVTDFPTILQIQIQRVYYDRE 1089
            LSLLVN GDHPKDIYDALD YF+++YL LEEYGDVKRTV++++ P +LQIQIQRVYYDRE
Sbjct: 944  LSLLVNTGDHPKDIYDALDFYFQNDYLNLEEYGDVKRTVSISELPAVLQIQIQRVYYDRE 1003

Query: 1090 RFMPFKSVAPLPFNETIYMDRYSDTNNPVLINRKRETEKLVQELNGLKGRQRELLSKNEL 1149
            +FMPFKS+ PLPF ET+YMDRY  T +P L+   ++  +L Q+L  LK RQR+LLS+NE+
Sbjct: 1004 KFMPFKSIEPLPFGETLYMDRYMATEDPKLLAEIQQNAELKQKLQDLKQRQRKLLSQNEI 1063

Query: 1150 GLSRKGALIETSNFLKSDVLETQGIQIDNRTGLAQELDNIVLGINDELSQLYHNITQLES 1209
            GL+ K +LIET  FL+S  L+   I  DN       +D ++  I++EL  L++ IT LE+
Sbjct: 1064 GLTLKSSLIETKKFLQSGTLKAHDIDADNIPSSIAYIDILINNIDEELKSLFNKITDLET 1123

Query: 1210 KISHQFDDFKSIGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEV 1269
             IS QF +FK IGYSLFAVFIHRGEASYGHYW+YIKD  K+GIWRKYND+++TEVP+SEV
Sbjct: 1124 TISQQFSEFKHIGYSLFAVFIHRGEASYGHYWVYIKDHTKNGIWRKYNDDSVTEVPQSEV 1183

Query: 1270 FNFSEGNTATPYFLVYVKQGHEQE-IEPLKRVLE 1302
            FNF+EGNTATPYFLVYV++G EQE IEPLKR+L+
Sbjct: 1184 FNFTEGNTATPYFLVYVREGQEQETIEPLKRILQ 1217

>Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340)
           [3756 nt, 1252 aa]
          Length = 1251

 Score =  431 bits (1109), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 281/782 (35%), Positives = 433/782 (55%), Gaps = 39/782 (4%)

Query: 74  FKTADRLLDDILHDLSFINSDDHSILYSDLSNGILKSPVLSYSRKVGKTRAYNLGSLVDQ 133
           FKT+DR++DDIL DLSFINS    I    L+ GIL+ P   YS+       Y + +L ++
Sbjct: 106 FKTSDRIIDDILIDLSFINSSADEIKELGLNKGILRLPTTDYSKFRSSFSEYKIINLSNK 165

Query: 134 V-VLQTKFEYDSVSCPQHNHLQVFMGVLIDVTQQNVATFNNLATL----PIFHLKVTVKT 188
             ++  +FEY+S +  Q N +  F  +L      +   + ++A        +HLKV++KT
Sbjct: 166 NNLINYRFEYESKTNHQDNKILEFFSILHKPKDASNLDYESMAKFWSQNEFYHLKVSIKT 225

Query: 189 RDVLERTKKKAGITHYHSLDESEIHPYDKQDLLTFDSKDPQLLDYAIYVSSDSNKLILIE 248
           R+ LE +KK   I H++ +DE   +  DK D + F+  +P LLDYAI++SS++NK++L+E
Sbjct: 226 RNQLELSKKHTPIQHFYVIDE--FNEEDKLDFINFNPDNPNLLDYAIFISSNTNKVVLVE 283

Query: 249 IFKPEFDSDEERDAFKEESINNRYEMACNRFDSLDPTRIPTQPDCINTLFKIFKGPLNR- 307
           IFK EF+ +++     +  + N YE   N    L   ++PTQ D +  L   F    N  
Sbjct: 284 IFKSEFNLNDKLIILDDLQVLNNYEKYKNSNHKL---KLPTQTDVLLVLMYCFNKQQNFD 340

Query: 308 --KSSEEPRKTINPNNVSLNSHIDPTWLTSKYGFELHVEKDEETGEDILEYAPPDLTNYH 365
              SSE+  K  +   + ++  ++P+WLT +  F L  ++DE      L        N +
Sbjct: 341 NIHSSEDEIKLKDSKAIKIS--LNPSWLTER--FSLKFQEDESLIFMNLR------NNLN 390

Query: 366 RDWKVRRLRESFTRRCLELIFLGRVSIRLLSQEAVNRNPK---VYRIFSMMQTNFSTMFW 422
              K +R  + FTR  LEL  L    I+   Q+ V  N K   + ++   +  N S  FW
Sbjct: 391 LIKKEKRRFDVFTRCLLELFVL----IKSAPQKLVKCNSKDTNIIKVVDTISINSSLSFW 446

Query: 423 FQLLGEYRAIFSTESSSPLDSDHHFIDLSACYNYIDRDIIRNYEAQCTLDPENVGVYVDA 482
            Q+LGEY++I S  + +       FI+LS    Y + +I++NYE    L+P+ +GVY D+
Sbjct: 447 SQILGEYKSILSQNNFNQYSKHAEFINLSILPTYTESEIVKNYEILTILNPDKIGVYFDS 506

Query: 483 LNFIANRKGAYQLIA-YCGKQDFVGQEALDHALGVFQIDSKEFDPHNLNDSVLLSIYKNE 541
           L F++     Y+ +A Y  K + +G E  + +L +F++D  EF   N +DSVL   Y   
Sbjct: 507 LKFVSQCLTQYENLADYVNKNEIIGNEEFNQSLKIFKMDKLEFT--NCSDSVLWEKYLTY 564

Query: 542 SASTRNPNRHAELKNSLRLLAKFKKSPKLKFYADYEPYRNVTQAYEILEVDESVDDDIIQ 601
                    HA L+NS++ L+  K SP LKF   YEPY+N   A+  L + ESVD D I 
Sbjct: 565 YEDKNFDYNHAILRNSIKSLSIVKNSPILKFLCKYEPYKNPDNAFVTLNIHESVDSDTII 624

Query: 602 TAYTVKVNDSPGLKIDCDRALYTIAVHSRSLALFNFLVQQSEEFQEYFGPDQFSYQDALS 661
            +YT K+ND    K   D+AL TIA+  + L+LF+ L +  ++F   +      Y+ AL 
Sbjct: 625 VSYTTKINDMKDKKQHLDKALLTIAIDRKDLSLFHTLYENCKDFVNLYHSMNIEYKTALQ 684

Query: 662 VLQVNENAGDDTILEIFQRKWYKEPVF------DADQFLKLKGALSKIGFERNSKLISHF 715
            +  +E   D+ ++  F+++WY+  V       D    L L+  +  I   RNS L++++
Sbjct: 685 AIDSSELNSDNELILSFKKRWYRIDVNNDTFGDDTVNLLTLRKVMMVISSNRNSLLLNNY 744

Query: 716 IDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQ 775
           I+ G V+   LP+++WP GLNNIGNTCYLNSLLQYYF+IS LR+Y++++ +        +
Sbjct: 745 IEYGIVNPKFLPSKSWPVGLNNIGNTCYLNSLLQYYFAISPLREYLINFNDIELDGREMK 804

Query: 776 EYASRRIGGREITEAEVERSVQFVYQLRDLFDSMIHAQDRCVTPRKELAYLAFVPSGLGV 835
               RR+GGR ++ AE  RS+QFVYQLRDL+  M+H+  R V+PR +LAYLAF PS   +
Sbjct: 805 NLEKRRVGGRNLSIAEFHRSIQFVYQLRDLYGEMVHSSSRKVSPRLQLAYLAFAPSDTPI 864

Query: 836 EF 837
           EF
Sbjct: 865 EF 866

 Score =  349 bits (895), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 177/359 (49%), Positives = 229/359 (63%), Gaps = 45/359 (12%)

Query: 941  KAVAMNTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPISLGDDNEQNDL 1000
            K    N  T + KISS QLE  LEMG QQDVTECI NVLFQ+E+AS+PIS+ +DNEQ DL
Sbjct: 928  KTSTTNLPTLIPKISSSQLETTLEMGSQQDVTECIENVLFQIEAASNPISIDEDNEQVDL 987

Query: 1001 VKQLFYGNIKQNIIPLKDETQVRTKYERFLSLLVNIGDHPKDIYDALDLYFRDEYLKLEE 1060
            VKQLF+G  +Q I P  + ++V  K ERFLSLLV++ D P+DIYDALD YF+DE   +EE
Sbjct: 988  VKQLFFGKTEQKIKPFNEVSKVHPKRERFLSLLVSVSDKPRDIYDALDTYFKDEVFDMEE 1047

Query: 1061 YGDVKRTVAVTDFPTILQIQIQRVYYDRERFMPFKSVAPLPFNETIYMDRYSDTNNPVLI 1120
            YG VK+++ ++ FPTILQ+QIQRVYYD E+ +PFK + PL F+E++Y+DRY++  +  L 
Sbjct: 1048 YGKVKKSLTISSFPTILQVQIQRVYYDIEKGVPFKDLEPLRFSESLYLDRYANDIDEKLA 1107

Query: 1121 NRKRETEKLVQELNGLKGRQRELLSKNELGLSRKGALIETSNFLKSDVLETQGIQIDNRT 1180
             +K E   L + L GL   ++EL  KN+                                
Sbjct: 1108 EKKIEVASLKKRLKGLITIKKELEKKND-------------------------------- 1135

Query: 1181 GLAQELDNIVLGINDELSQLYHNITQLESKISHQFDDFKSIGYSLFAVFIHRGEASYGHY 1240
                         N E+  +   I  +E+KI   F +F   GYSLFAVFIHRG+A++GHY
Sbjct: 1136 -------------NVEIRTISKEINDVETKIDTAFSEFHKHGYSLFAVFIHRGQATFGHY 1182

Query: 1241 WIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPYFLVYVKQGHEQEIEPLKR 1299
            WIYIKD    G WRKYND  +TE+   EVFNFSEGN++TPYFLVY+K G E ++EPLKR
Sbjct: 1183 WIYIKDFKNHGTWRKYNDHEVTEILPIEVFNFSEGNSSTPYFLVYIKNGSEFDVEPLKR 1241

>TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa]
           {ON} Anc_5.443 YOR124C
          Length = 1225

 Score =  404 bits (1037), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 262/798 (32%), Positives = 420/798 (52%), Gaps = 19/798 (2%)

Query: 58  DSGKVPLYPEAAARFPFKTADRLLDDILHDLSFINSDDHSILYSDLSNGILKSPVLSYS- 116
           D G   LY        FKT+ R+LDDIL D++F++ D       D  +G+L  P + YS 
Sbjct: 69  DDGMHLLYQNIEKEGVFKTSQRILDDILTDIAFMSLDSEKSDDIDFKDGVLNLPTIKYSL 128

Query: 117 -RKVGKTRAYNLGSLVDQVVLQTKFEYDSVSCPQHNHLQVFMGVLIDVT--QQNVATFNN 173
            RK  K     L +  + VV   K ++ SV+ P++N +    G+L+     +  + TF+ 
Sbjct: 129 WRKYIKPFKIILFNTNNPVV-DVKLQHKSVTSPKNNTITELYGLLVPKIPRRSELNTFDE 187

Query: 174 -LATLPIFHLKVTVKTRDVLERTKKKAGITHYHSLDE-SEIHPYDKQDLLTFDSKDPQLL 231
            + + P++ +++TVKTR  LE  KK   +T Y  LD+  ++H  DK D   F+     LL
Sbjct: 188 YIRSKPLYSIRITVKTRHRLEHKKKHIALTPYFLLDDFDKLHEVDKSDFPKFNKDSKDLL 247

Query: 232 DYAIYVSSDSNKLILIEIFKPEFDSDEERDAFKEESINNRYEMACNRFDSLDP----TRI 287
           D++IY+SSD+NK+ILIEIFKP F+  E        S+ NR     N  + L P      +
Sbjct: 248 DFSIYISSDTNKIILIEIFKPAFNQTELDYLLSSASVLNRSNELDNLHEELQPDYNDAIV 307

Query: 288 PTQPDCINTLFKI----FKGPLNRKSSEEPRKTINPNNVSLNSHIDPTWLTSKYGFELHV 343
             Q D I  L        KG   R+  ++    +  ++V L +++D  WL   +  ++  
Sbjct: 308 EEQIDTIEILLHCIMQNLKGSPERELEKQKTSFLLSDDVKLGTYVDIKWLEENFDIKVKE 367

Query: 344 EKDEETGEDILEYAPPDLTNYHRDWKVRRLRESFTRRCLELIFLGRVSIRLLSQEAVNRN 403
           +K ++     L+ A   L+    + K +   +  TR  +EL++LG+V     S E     
Sbjct: 368 QKRKDHVSITLDEALK-LSFDDPNPKNQAKFDKITRYAMELMYLGKVLQSFYSNEEEIEE 426

Query: 404 PKVYRIFSMMQTNFSTMFWFQLLGEYRAIFSTESSSPLDSDHHFIDLSACYNYIDRDIIR 463
                IF  ++ + +T FW Q+L EY++IFS++ +S    D HFI+L    N  ++DII 
Sbjct: 427 YMEDTIFKQVKVHHTTSFWTQILNEYQSIFSSQKTSTRCVDEHFINLCIDSNVSEKDIIT 486

Query: 464 NYEAQCTLDPENVGVYVDALNFIANRKGAYQLI-AYCGKQDFVGQEALDHALGVFQIDSK 522
           NYE Q   DP+N   Y ++L +++ +   Y ++  YC +   + + A  HAL +F+   +
Sbjct: 487 NYEIQLRTDPDNDSKYFESLKYVSRKFPDYIVLEKYCKENVIISKAAYLHALEIFKYSEE 546

Query: 523 EFDPHNLNDSVLLSIYKNESASTRNPNRH-AELKNSLRLLAKFKKSPKLKFYADYEPYRN 581
            F+       +     +   ++  N +++  +L +S   LA  KKS  L +   YEP+ +
Sbjct: 547 YFNAIEHVSEIWDKYTELVQSNNNNDDQYRVDLVDSFYSLATVKKSSPLIYITKYEPFFH 606

Query: 582 VTQAYEILEVDESVDDDIIQTAYTVKVNDSPGLKIDCDRALYTIAVHSRSLALFNFLVQQ 641
              AY  L VD  +D + I  AYT+++ + P  KI  DRAL+ IA+    L+L   L Q 
Sbjct: 607 PVTAYLKLNVDAKLDSENIVLAYTMQIREVPEHKIQFDRALFAIAIQRHDLSLLYVLKQN 666

Query: 642 SEEFQEYFGPDQFSYQDALSVLQVNENAGDDTILEIFQRKWYKEPVFDADQFLKLKGALS 701
              F E       +  DA  ++ + + + + +I+  F + W +    +   F+    AL 
Sbjct: 667 CSAFNECISNIILTSDDAFEIIGMPKTSSELSIINTFTKYWKETDDSNPVNFILASAALR 726

Query: 702 KIGFERNSKLISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYV 761
           ++   R S L+ HF + G V+   + +E WPTG+NNIGNTCYLNSLLQYYFSI+  R+++
Sbjct: 727 EVSKHRASALLRHFYEFGKVNPKMIDSELWPTGINNIGNTCYLNSLLQYYFSITLFREFI 786

Query: 762 LDYRNTVQHFLN-NQEYASRRIGGREITEAEVERSVQFVYQLRDLFDSMIHAQDRCVTPR 820
            +Y++     LN N E + RR+GGREI   E+ RSVQF+YQ++DLF  M+H + R VTP 
Sbjct: 787 ENYQSIESDLLNSNAEMSKRRVGGREIQNNEINRSVQFIYQVQDLFKLMVHTKSRKVTPS 846

Query: 821 KELAYLAFVPSGLGVEFE 838
            +LAYLAF P+   ++F+
Sbjct: 847 NQLAYLAFAPNNAEIKFK 864

 Score =  281 bits (720), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 158/371 (42%), Positives = 213/371 (57%), Gaps = 58/371 (15%)

Query: 932  SGSSSNNSNKAVAMNTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPISL 991
            S +S++ SN+ VAM        ++ D LE  LE+G QQDVTECI  VL+Q+E+ S P+ L
Sbjct: 904  SLNSTSYSNRLVAM--------VTRDDLETTLEIGNQQDVTECINTVLYQVETGSMPLYL 955

Query: 992  GDDNEQNDLVKQLFYGNIKQNIIPLKDETQVRTKYERFLSLLVNIGDHPKDIYDALDLYF 1051
              DNEQ DLVK+LFYG   Q I P+K   +   K E + SLLVNI D P D+Y+ LD YF
Sbjct: 956  DADNEQMDLVKELFYGETIQEICPIKKFIKGHEKRELYSSLLVNILDSPTDLYEVLDEYF 1015

Query: 1052 RDEYLKLEEYGDVKRTVAVTDFPTILQIQIQRVYYDRERFMPFKSVAPLPFNETIYMDRY 1111
             DEY+ +EEYG+VK+T+++T  PTIL IQIQRVYYD+E+ +P+K    LPF   I++DRY
Sbjct: 1016 ADEYMSMEEYGEVKKTLSITKLPTILNIQIQRVYYDKEKLVPYKCGTALPFKNEIFLDRY 1075

Query: 1112 SDTN---NPVLINRKRETEKLVQELNGLKGRQRELLSKNELGLSRKGALIETSNFLKSDV 1168
               N   N VL       EK   EL   K + REL+S                       
Sbjct: 1076 IKGNKKENDVL-------EKARLELKLAKVKYRELVS----------------------- 1105

Query: 1169 LETQGIQIDNRTGLAQELDNIVLGINDELSQLYHNITQLESKISHQFDDFKSIGYSLFAV 1228
                            E +++   I+D +   Y  I +L + I  +      I YSLFAV
Sbjct: 1106 ----------------EYNSVNKSISDRIITTYDRIEELNAVIEEEVTKDAKIRYSLFAV 1149

Query: 1229 FIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPYFLVYVKQ 1288
            FIHRG+AS+GHYW+YI+D +++GIWRKYND  +T   E E+F   +G+ +TPYFL YV  
Sbjct: 1150 FIHRGQASFGHYWVYIRD-FENGIWRKYNDHQVTGAHEDEIFKCVDGDISTPYFLAYVDS 1208

Query: 1289 GHEQEIEPLKR 1299
              +  ++PL R
Sbjct: 1209 SKKSIVKPLVR 1219

>NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.369
           YFR010W
          Length = 493

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 34/55 (61%)

Query: 710 KLISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDY 764
           K  +HFI+  T D      ++ P GL N+GNTCY+N+ LQ  F + S+R  +L+Y
Sbjct: 84  KGTNHFIEDLTPDQQMQKFDSNPIGLQNMGNTCYMNATLQALFRVDSIRDLILNY 138

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 1223 YSLFAVFIHRGEAS-YGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPY 1281
            Y+L  +  H+G  S  GHY  +I+D      W K+ND+ ++ V + ++   + G  +   
Sbjct: 424  YNLVGIITHQGANSESGHYQAFIRDETDENKWYKFNDDKVSVVEKEKIEALAGGGESDSA 483

Query: 1282 FLVYVK 1287
             ++  K
Sbjct: 484  LILMYK 489

>NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {ON}
           Anc_1.369 YFR010W
          Length = 502

 Score = 52.0 bits (123), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 35/64 (54%)

Query: 713 SHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFL 772
           +HFI+  + D      ++ P G  N+GNTCY+N+ LQ  +    +RQ +LDY+   Q   
Sbjct: 91  NHFIEDLSPDQQLQKMDSTPIGFQNMGNTCYMNATLQALYRTDDIRQMILDYKPPAQSST 150

Query: 773 NNQE 776
            N E
Sbjct: 151 YNPE 154

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 34/69 (49%), Gaps = 1/69 (1%)

Query: 1220 SIGYSLFAVFIHRGEAS-YGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTA 1278
            S  Y+L  +  H+G  S  GHY  +++D      W K+ND+ +T V + ++   + G  +
Sbjct: 430  SCVYNLIGIITHQGANSESGHYQAFMRDENDENKWYKFNDDKVTVVEKEKIEALAGGGES 489

Query: 1279 TPYFLVYVK 1287
                ++  K
Sbjct: 490  DSALILMYK 498

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
           bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 55/118 (46%), Gaps = 24/118 (20%)

Query: 708 NSKLISHFIDTGTVDASCLPAENW------PTGLNNIGNTCYLNSLLQYYFSISSLRQYV 761
           ++ L+S      T     LP + +      P GL N+GNTCYLN+ LQ  F I  LR+ +
Sbjct: 78  DADLVSKPKKKSTFIEDLLPGQQFQQFNQTPIGLKNLGNTCYLNATLQCLFRIEPLREMI 137

Query: 762 LDYRNTVQHFLNNQEYASRRIGGREITEAEVERSVQFVYQLRDLFDSMIHAQDRCVTP 819
           L+Y+ +                   ++ A+ E   + V +LR+ FDS+   + + V P
Sbjct: 138 LNYKQS-----------------SSVSPAD-EVHQKIVLELRNCFDSLDKKKFQAVMP 177

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 1/66 (1%)

Query: 1223 YSLFAVFIHRGEAS-YGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPY 1281
            Y+L  +  H+G  S  GHY  +I+DR    IW K+ND+ +T V + ++   + G  +   
Sbjct: 434  YNLIGIITHQGANSESGHYQAFIRDREDEEIWYKFNDDKVTIVDKEKIETLAGGGESDSA 493

Query: 1282 FLVYVK 1287
             ++  K
Sbjct: 494  LILLYK 499

>KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {ON}
           Anc_1.369 YFR010W
          Length = 499

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 31/55 (56%)

Query: 710 KLISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDY 764
           K  SHFI+  + D         P G  N+GNTCYLN+ LQ  F +  LR+ +L+Y
Sbjct: 85  KTASHFIEDLSPDQQVSRFNELPIGFKNMGNTCYLNATLQSLFRMDQLRELILNY 139

 Score = 39.3 bits (90), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 2/71 (2%)

Query: 1220 SIGYSLFAVFIHRGEAS-YGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTA 1278
            S  Y+L  V  H+G  S  GHY  +I+D     +W K+ND+ ++ V +  V   + G  +
Sbjct: 427  SCVYNLVGVITHQGANSDSGHYQAFIRDENDENVWYKFNDDKVSIVEKERVEALAGGGES 486

Query: 1279 TPYFLVYVKQG 1289
                L+ + QG
Sbjct: 487  DSA-LILMYQG 496

>KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500
           bp, 499 aa] {ON} Anc_1.369 YFR010W
          Length = 499

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 49/107 (45%), Gaps = 16/107 (14%)

Query: 713 SHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFL 772
           +HFI+  T +       + P G  N+GNTCYLN+ LQ  + I  LR  VL++  ++ +  
Sbjct: 87  NHFIEDLTPEQQVQQFNDIPIGFKNMGNTCYLNATLQALYRIDDLRDAVLNFDVSINNDK 146

Query: 773 NNQEYASRRIGGREITEAEVERSVQFVYQLRDLFDSMIHAQDRCVTP 819
           N                 E E  ++ V +L+  F+ + +   + V P
Sbjct: 147 N----------------GENETHIKLVTELKRCFEGLKNKSFKSVMP 177

 Score = 38.9 bits (89), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 1223 YSLFAVFIHRGEAS-YGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEG 1275
            Y L  +  H+G  S  GHY  +I+D     IW K+ND+ ++ + + ++ + + G
Sbjct: 430  YDLVGIITHQGANSESGHYQAFIRDENDENIWYKFNDDKVSIIEKEKIESLAGG 483

>TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 aa]
           {ON} Anc_1.369 YFR010W
          Length = 494

 Score = 48.9 bits (115), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 31/61 (50%)

Query: 704 GFERNSKLISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLD 763
           G     K  S FI+    +     A + P G  N+GNTCYLN+ LQ  + I  LR  +LD
Sbjct: 80  GLISKPKEKSQFIEDLAPEQQFQHANDLPIGFQNMGNTCYLNATLQALYRIEPLRDMILD 139

Query: 764 Y 764
           Y
Sbjct: 140 Y 140

 Score = 39.3 bits (90), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 2/65 (3%)

Query: 1223 YSLFAVFIHRGEAS-YGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTA-TP 1280
            Y L  V  H+G  S  GHY  +I+D      W  +ND+ ++ VP+ ++   + G  + + 
Sbjct: 425  YELIGVITHQGANSESGHYQSFIRDDMDEDKWYNFNDDKVSVVPKEKIEGLAGGGESDSA 484

Query: 1281 YFLVY 1285
              L+Y
Sbjct: 485  LILIY 489

>Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010W
           (UBP6) - (putative) ubiquitin-specific protease [contig
           710] FULL
          Length = 449

 Score = 48.9 bits (115), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 40/95 (42%), Gaps = 19/95 (20%)

Query: 732 PTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQEYASRRIGGREITEAE 791
           P GL N+GNTCY+NS LQ  + I  LR  VL+Y+   +     Q +              
Sbjct: 59  PVGLKNLGNTCYMNSTLQALYQIKPLRDEVLNYKVPREKPSEEQHH-------------- 104

Query: 792 VERSVQFVYQLRDLFDSMIHAQDRCVTPRKELAYL 826
                Q V +LR  F  +       VTP   LA L
Sbjct: 105 -----QLVSELRRCFQQLKDKPQESVTPMLLLAML 134

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 36/68 (52%), Gaps = 2/68 (2%)

Query: 1220 SIGYSLFAVFIHRGEAS-YGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTA 1278
            S  Y+L  V  H+G  S  GHY  +I+D      W ++ND+ ++ + + ++ + + G  +
Sbjct: 377  SCVYNLIGVITHQGANSESGHYQSFIRDEVDENKWYRFNDDKVSIIEKEKIESLAGGGES 436

Query: 1279 -TPYFLVY 1285
             +   L+Y
Sbjct: 437  DSALILIY 444

>ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa]
           {ON} highly similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 500

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 13/92 (14%)

Query: 728 AENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQEYASRRIGGREI 787
           + + P G  N+GNTCYLNS LQ  + I  LR+ +L Y        N  E A+        
Sbjct: 103 SSDLPIGFQNMGNTCYLNSTLQALYRIKPLRELILSY--------NGSETATSSAA---- 150

Query: 788 TEAEVERSVQFVYQLRDLFDSMIHAQDRCVTP 819
            ++ VE   + V +L+  F ++ +   + V P
Sbjct: 151 -DSTVESHKKIVLELQRCFQNLKNKSFKSVMP 181

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 1223 YSLFAVFIHRGEAS-YGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTA-TP 1280
            Y L  V  H+G  S  GHY  +I+D Y    W K+ND+ ++ V + ++ + S G  + + 
Sbjct: 431  YELVGVITHQGANSESGHYQSFIRDDYDEDKWYKFNDDKVSVVDKEKIESLSGGGESDSA 490

Query: 1281 YFLVY 1285
              L+Y
Sbjct: 491  LILIY 495

>KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {ON}
            Anc_3.270 YBR058C
          Length = 765

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 102/255 (40%), Gaps = 64/255 (25%)

Query: 1064 VKRTVAVTDFPTILQIQIQRVYYDRERFMPFKSVAPLPFNETIYMDRYSDTNNPVLINRK 1123
            +K+T   T  P +L +   R+  DR  + P K+ A L FNET       ++ +P +  R 
Sbjct: 503  IKKTFIETS-PDVLILNPIRIGIDRTTWQPVKTSAELTFNET-------ESLSPFVFERP 554

Query: 1124 RETEKLVQELN----GLKGRQRELLSKNELGLSRKGA---LIETSNFLKSDV-------- 1168
             + EKL+ E          R+  +    E+G S   A   L  T N    +V        
Sbjct: 555  TDGEKLLPEEEDDAVAFTPREDTMAQLMEMGFSSNAAIRSLYHTGNVPDGEVALSWLFEH 614

Query: 1169 LETQGI-------QIDNRTGLAQE---LDNIV-LGINDELSQ------LYHNITQLESKI 1211
            +E   I         D++ GL  +   L+ +V +G++ +L +      L    + +E   
Sbjct: 615  VEDADINEPFTPPSKDDKGGLTVDPAALEQMVSMGLDAKLCRKALLQYLNDVASSVEWVF 674

Query: 1212 SHQFDD------------------FKSIG---YSLFAVFIHRGEASY-GHYWIYIKDRYK 1249
            SH  DD                  F   G   Y L+ +  H+G ++  GHY  YI+ R  
Sbjct: 675  SHPDDDGSLETETAPQDTANAARKFGHPGGSIYKLYGIVCHKGNSTQSGHYVAYIRQR-- 732

Query: 1250 SGIWRKYNDETITEV 1264
             G W  YNDE I  V
Sbjct: 733  DGQWTLYNDEKIVCV 747

 Score = 35.0 bits (79), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 727 PAENWPTGLNNIGNTCYLNSLLQYYF 752
           P++    GL N+GN+CYLNS+LQ  F
Sbjct: 314 PSKEVGCGLINMGNSCYLNSVLQCLF 339

>KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035)
           [1488 bp, 495 aa] {ON} similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 495

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 42/95 (44%), Gaps = 19/95 (20%)

Query: 732 PTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQEYASRRIGGREITEAE 791
           P GL N+GNTCY+NS LQ  + I  LR+ +L++          Q     R G        
Sbjct: 105 PVGLKNLGNTCYMNSTLQALYQIRPLREEILNF----------QPPKENRSG-------- 146

Query: 792 VERSVQFVYQLRDLFDSMIHAQDRCVTPRKELAYL 826
            E+ +Q V +L+  F  +        TP   LA L
Sbjct: 147 -EQHIQLVAELKRCFQQLRDRPQESTTPILLLATL 180

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 37/72 (51%), Gaps = 2/72 (2%)

Query: 1220 SIGYSLFAVFIHRGEAS-YGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTA 1278
            S  Y+L  V  H+G  S  GHY  +I+D      W ++ND+ ++ + + ++ + + G  +
Sbjct: 423  SCVYNLIGVITHQGANSESGHYQSFIRDEADENKWYRFNDDKVSVIEKEKIESLAGGGES 482

Query: 1279 -TPYFLVYVKQG 1289
             +   L+Y   G
Sbjct: 483  DSALILIYKGLG 494

>TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 aa]
           {ON} Anc_1.369 YFR010W
          Length = 505

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%)

Query: 713 SHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYR 765
           S FI+    D       + P G  N+GNTCY+NS LQ  F +  L+  +L+Y+
Sbjct: 89  SSFIEDLAPDQQMQKLNDLPIGFQNMGNTCYMNSTLQALFRVDVLKDMILNYK 141

 Score = 39.3 bits (90), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 2/72 (2%)

Query: 1220 SIGYSLFAVFIHRGEAS-YGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTA 1278
            S  Y L  +  H+G  S  GHY  +I+D      W K+ND+ ++E  + ++   + G  +
Sbjct: 433  SCVYDLIGIITHQGANSESGHYQSFIRDENDEDKWYKFNDDKVSEYEKDKIEQLAGGGES 492

Query: 1279 -TPYFLVYVKQG 1289
             +   L+Y   G
Sbjct: 493  DSALILIYKGMG 504

>KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [1455
           bp, 484 aa] {ON} similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 484

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 45/107 (42%), Gaps = 23/107 (21%)

Query: 713 SHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFL 772
           + F++  T     +  +  P GL N+GNTCY N+ LQ  + I  LR+ VL Y        
Sbjct: 86  TKFLEDLTDKERLMQEDTIPMGLRNMGNTCYFNASLQALYRIKPLREKVLAY-------- 137

Query: 773 NNQEYASRRIGGREITEAEVERSVQFVYQLRDLFDSMIHAQDRCVTP 819
                           E   +   Q V QLR+ F++    +++  TP
Sbjct: 138 ---------------NEPNPDLHGQLVIQLRNCFNAFAQRKEKEFTP 169

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 2/65 (3%)

Query: 1223 YSLFAVFIHRGEAS-YGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTA-TP 1280
            Y+L  V  H+G  S  GHY  +++D      W KYND+ +  V   +V   + G  + + 
Sbjct: 415  YNLIGVVTHQGANSDSGHYQAFVRDDADENKWYKYNDDKVYVVTREKVEQLAGGGESDSA 474

Query: 1281 YFLVY 1285
              L+Y
Sbjct: 475  LILIY 479

>Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W
           (REAL)
          Length = 499

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 45/88 (51%), Gaps = 14/88 (15%)

Query: 732 PTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQEYASRRIGGREITEAE 791
           P G  N+GNTCYLN+ LQ  + ++ LR+ +L+Y N  Q   NN            + + E
Sbjct: 108 PVGFKNMGNTCYLNATLQALYRVNDLREMILNY-NPSQGVSNNG-----------VQDEE 155

Query: 792 VERSVQFVYQLRDLFDSMIHAQDRCVTP 819
             +  Q V +++  F+++ +   + V P
Sbjct: 156 THK--QIVIEMKRCFENLQNKSFKSVLP 181

 Score = 39.3 bits (90), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 35/69 (50%), Gaps = 1/69 (1%)

Query: 1220 SIGYSLFAVFIHRGEAS-YGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTA 1278
            S  Y+L  V  H+G  S  GHY  +I+D      W K+ND+ ++ V + ++ + + G  +
Sbjct: 427  SCVYNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKIESLAGGGES 486

Query: 1279 TPYFLVYVK 1287
                ++  K
Sbjct: 487  DSALILMYK 495

>SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [1479
           bp, 492 aa] {ON} highly similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 492

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 27/40 (67%)

Query: 732 PTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHF 771
           P GL N+GNTCY+N+ LQ  + I+ LR+ +L++     +F
Sbjct: 103 PIGLKNMGNTCYMNATLQALYQITPLREAILNFDKKSGNF 142

 Score = 40.0 bits (92), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 2/68 (2%)

Query: 1220 SIGYSLFAVFIHRGEAS-YGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTA 1278
            S  Y L  V  H+G  S  GHY  +I+D      W K+ND+ ++ + + ++ + + G  +
Sbjct: 420  SCVYDLIGVITHQGANSESGHYQAFIRDEMDENKWYKFNDDKVSVIEKEKIESLAGGGES 479

Query: 1279 -TPYFLVY 1285
             +   LVY
Sbjct: 480  DSALILVY 487

>Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W
            (REAL)
          Length = 790

 Score = 46.2 bits (108), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 47/84 (55%), Gaps = 11/84 (13%)

Query: 1221 IGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATP 1280
            + YSL +V +H G  +YGHY  + K R   G W + +DET+  V E+EV        +TP
Sbjct: 680  LTYSLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETVYVVDEAEVL-------STP 729

Query: 1281 -YFLVYVKQGHEQEIEPLKRVLEV 1303
              F+++ +  +++E   +K  LE+
Sbjct: 730  GVFMLFYEYDYDEETGQMKDDLEL 753

>Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W
            (REAL)
          Length = 787

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 46/84 (54%), Gaps = 11/84 (13%)

Query: 1221 IGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATP 1280
            + YSL +V +H G  +YGHY  + K R   G W + +DET+  V E+EV        +TP
Sbjct: 681  LTYSLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETVYVVDEAEVL-------STP 730

Query: 1281 -YFLVYVKQGHEQEIEPLKRVLEV 1303
              F+++ +  +++E   +K  LE 
Sbjct: 731  GVFMLFYEYDYDKETGEMKDDLEA 754

>Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W
            (REAL)
          Length = 793

 Score = 45.4 bits (106), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 46/84 (54%), Gaps = 11/84 (13%)

Query: 1221 IGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATP 1280
            + YSL +V +H G  +YGHY  + K R   G W + +DET+  V E+EV        +TP
Sbjct: 683  LTYSLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETVYVVDEAEVL-------STP 732

Query: 1281 -YFLVYVKQGHEQEIEPLKRVLEV 1303
              F+++ +  +++E   +K  LE 
Sbjct: 733  GVFMLFYEYDYDEETGEMKDDLEA 756

>Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar to
           Ashbya gossypii AEL029W
          Length = 483

 Score = 45.4 bits (106), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 24/33 (72%)

Query: 732 PTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDY 764
           P G+ N+GNTCY+N+ LQ  F I  LR+ VL++
Sbjct: 101 PMGIANLGNTCYMNATLQGLFRIDPLREQVLEF 133

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
           (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 45.4 bits (106), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 23/34 (67%)

Query: 732 PTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYR 765
           P GL N+GNTCY+NS LQ  + +  LR  VL Y+
Sbjct: 108 PIGLLNMGNTCYMNSTLQALYRVDGLRDMVLKYK 141

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 2/72 (2%)

Query: 1220 SIGYSLFAVFIHRGEAS-YGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTA 1278
            S  Y L  V  H+G  S  GHY  +I+D      W K+ND+ ++ V   ++   + G  +
Sbjct: 424  SCVYDLIGVITHQGANSESGHYQSFIRDEKDENKWYKFNDDKVSVVEREKIEALAGGGES 483

Query: 1279 -TPYFLVYVKQG 1289
             +   L+Y   G
Sbjct: 484  DSALILIYKGLG 495

>TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7.390
            YBL067C
          Length = 727

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 42/79 (53%), Gaps = 7/79 (8%)

Query: 1211 ISHQFDDFKSIGYSLFAVFIHRGEA-SYGHYWIYIKDRYKSGIWRKYNDETITEVPE--- 1266
            IS  FDD  S  Y L ++ +H GE+   GHY    K  +KS  W  Y+DET+  V +   
Sbjct: 575  ISSVFDDSISKKYELNSIVVHIGESPQLGHYVTLCK--HKSYGWLIYDDETVQAVSDELV 632

Query: 1267 SEVFNFSEGNTATPYFLVY 1285
            S + N +E  +AT Y L Y
Sbjct: 633  SRILN-NEQRSATAYLLFY 650

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVL 762
           G  N G TCY NS+LQ  F+I S R  ++
Sbjct: 107 GFQNFGYTCYCNSILQALFNIGSFRDGII 135

>Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {ON}
            YDL122W (UBP1) - Ubiquitin-specific protease [contig 27]
            FULL
          Length = 757

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 46/83 (55%), Gaps = 11/83 (13%)

Query: 1221 IGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATP 1280
            + Y+L +V +H G  +YGHY  + K R   G+W + +DET+  V E+EV        +TP
Sbjct: 676  LTYALRSVIVHYGSHNYGHYIAFRKFR---GLWWRISDETVYVVDEAEVL-------STP 725

Query: 1281 -YFLVYVKQGHEQEIEPLKRVLE 1302
              F+++ +  + Q ++ +   LE
Sbjct: 726  GVFMLFYEHDYNQTLQKMNDDLE 748

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 49/93 (52%), Gaps = 8/93 (8%)

Query: 673 TILEIFQRKWYKEPVFDADQFLKLKGALSKIGFERNSKLISHFIDTGT----VDASCLPA 728
           T L I++ + Y   + DA     + G L++ GF RNS   S F   G+     +A+ L  
Sbjct: 38  TGLLIYKNRRYIRNIMDA--LGTVGGDLTR-GF-RNSYKGSVFNKWGSRNPAQEATMLKR 93

Query: 729 ENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYV 761
             +  GL N GNTC++NS++Q   S  SL Q++
Sbjct: 94  GGYVGGLINDGNTCFMNSVIQSLASSKSLMQFL 126

>YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}
           UBP13Putative ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 747

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 35/63 (55%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQEYASRRIGGREITEAEVE 793
           G  N GNTCY NS+LQ  +++SSLR+ +L +    +     ++   R    R  TEA  E
Sbjct: 141 GYENFGNTCYCNSVLQCLYNLSSLRENILQFPKKSRESDQPRKKEMRGKKPRIFTEASFE 200

Query: 794 RSV 796
           +S+
Sbjct: 201 KSI 203

>Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON}
           YBL067C (REAL)
          Length = 748

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 34/61 (55%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQEYASRRIGGREITEAEVE 793
           G  N GNTCY NS+LQ  +++SS+R+ +L +        + ++Y  +    R  TEA  E
Sbjct: 142 GYENFGNTCYCNSVLQCLYNLSSVRENILQFPEKPNESTHPRKYEVKGNKPRIFTEASFE 201

Query: 794 R 794
           R
Sbjct: 202 R 202

>AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR010W (UBP6)
          Length = 446

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%)

Query: 715 FIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDY 764
           FI+    DA        P G+ N+GNTCY+N+ LQ  + I  LR+ +L +
Sbjct: 42  FIEDLGADAQSGQLSRVPMGIVNMGNTCYMNATLQGLYGIVPLREQILAF 91

 Score = 40.4 bits (93), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 1223 YSLFAVFIHRGEAS-YGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTA-TP 1280
            Y L  V  H+G  S  GHY  +++D +    W K+ND+ +T + + ++ + + G  + + 
Sbjct: 377  YDLIGVITHQGANSESGHYQAFMRDEFDDDKWYKFNDDKVTAIEKEKIESLAGGGESDSA 436

Query: 1281 YFLVY 1285
              L+Y
Sbjct: 437  LILIY 441

>NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}
          Length = 856

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 36/63 (57%), Gaps = 5/63 (7%)

Query: 1211 ISHQFDD--FKSIGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESE 1268
            I  +FD      + YSL +V +H G  +YGHY  + K R   G+W + +DET+  V E+E
Sbjct: 708  IRKKFDSTPIGPLTYSLRSVIVHYGTHNYGHYIAFRKYR---GVWWRISDETVYIVDEAE 764

Query: 1269 VFN 1271
            V +
Sbjct: 765  VLS 767

>YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}
            UBP1Ubiquitin-specific protease that removes ubiquitin
            from ubiquitinated proteins; cleaves at the C terminus of
            ubiquitin fusions irrespective of their size; capable of
            cleaving polyubiquitin chains
          Length = 809

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 45/84 (53%), Gaps = 11/84 (13%)

Query: 1221 IGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATP 1280
            + YSL +V +H G  +YGHY  + K R   G W + +DET+  V E+EV        +TP
Sbjct: 679  LTYSLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETVYVVDEAEVL-------STP 728

Query: 1281 -YFLVYVKQGHEQEIEPLKRVLEV 1303
              F+++ +   ++E   +K  LE 
Sbjct: 729  GVFMLFYEYDFDEETGKMKDDLEA 752

>Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W
            (REAL)
          Length = 754

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 1211 ISHQFDDFKSIGYSLFAVFIHRGEA-SYGHYWIYIKDRYKSGIWRKYNDETITEVPESEV 1269
            +S  FD   S  Y L  V IH G    +GHY    K+  K G W  Y+DET+  V E  V
Sbjct: 592  VSSTFDTSVSKRYELSGVVIHMGSGPQHGHYVCICKNE-KFG-WLLYDDETVESVSEETV 649

Query: 1270 FNFS--EGNTATPYFLVY 1285
              F+   G+  T Y L Y
Sbjct: 650  LKFTGHSGDQTTAYVLFY 667

 Score = 37.0 bits (84), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVLDY 764
           G  N GNTCY NS+LQ  ++I   R  VL Y
Sbjct: 137 GYENFGNTCYCNSVLQCLYNIPEFRCNVLRY 167

>SAKL0E07106g Chr5 complement(584164..586539) [2376 bp, 791 aa] {ON}
            similar to uniprot|P25037 Saccharomyces cerevisiae
            YDL122W UBP1 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions irrespective of their size
            capable of cleaving polyubiquitin chains
          Length = 791

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 47/84 (55%), Gaps = 11/84 (13%)

Query: 1221 IGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATP 1280
            + YSL +V +H G  +YGHY  + K R   G W + +DET+  V E+EV        +TP
Sbjct: 706  LTYSLRSVIVHYGTHNYGHYIAFRKHR---GFWWRISDETVYIVDEAEVL-------STP 755

Query: 1281 -YFLVYVKQGHEQEIEPLKRVLEV 1303
              F+++ +  ++++   LK  L++
Sbjct: 756  GVFMLFYEYDYDEQTGKLKDDLQL 779

>Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON}
            (121699..124065) [2367 nt, 789 aa]
          Length = 788

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 32/51 (62%), Gaps = 3/51 (5%)

Query: 1221 IGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFN 1271
            + YSL +V +H G  +YGHY  + K R   G W + +DE++T V E+EV +
Sbjct: 685  LTYSLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDESVTIVDEAEVLS 732

>Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}
           YFR010W (REAL)
          Length = 499

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%)

Query: 732 PTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDY 764
           P G  N+GNTCYLN+ LQ  + +  LR  +L+Y
Sbjct: 108 PVGFKNMGNTCYLNATLQALYRVDDLRDMILNY 140

 Score = 39.7 bits (91), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 35/69 (50%), Gaps = 1/69 (1%)

Query: 1220 SIGYSLFAVFIHRGEAS-YGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTA 1278
            S  Y+L  V  H+G  S  GHY  +I+D      W K+ND+ ++ V + ++ + + G  +
Sbjct: 427  SCVYNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKIESLAGGGES 486

Query: 1279 TPYFLVYVK 1287
                ++  K
Sbjct: 487  DSALILMYK 495

>YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}
           UBP6Ubiquitin-specific protease situated in the base
           subcomplex of the 26S proteasome, releases free
           ubiquitin from branched polyubiquitin chains; works in
           opposition to Hul5p polyubiquitin elongation activity;
           mutant has aneuploidy tolerance
          Length = 499

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 23/33 (69%)

Query: 732 PTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDY 764
           P G  N+GNTCYLN+ LQ  + ++ LR  +L+Y
Sbjct: 108 PVGFKNMGNTCYLNATLQALYRVNDLRDMILNY 140

 Score = 39.3 bits (90), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 35/69 (50%), Gaps = 1/69 (1%)

Query: 1220 SIGYSLFAVFIHRGEAS-YGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTA 1278
            S  Y+L  V  H+G  S  GHY  +I+D      W K+ND+ ++ V + ++ + + G  +
Sbjct: 427  SCVYNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKIESLAGGGES 486

Query: 1279 TPYFLVYVK 1287
                ++  K
Sbjct: 487  DSALILMYK 495

>NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {ON}
            Anc_7.390
          Length = 717

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 74/158 (46%), Gaps = 15/158 (9%)

Query: 1140 QRELLS-KNELGLSRKGALIETSNFLKSDVL-ETQGIQIDNRTGLAQELDNIVLGINDEL 1197
            QRE+L+  N+   S+  AL E    ++   L +T  + +       Q+L NI L      
Sbjct: 488  QREMLNGSNKFNCSQCCALQEAERAVELKKLPDTLILHLKRFKYSEQQLSNIKL-----F 542

Query: 1198 SQLYHNITQLESKISHQFDDFKSIGYSLFAVFIHRGEA-SYGHYWIYIKDRYKSGIWRKY 1256
            S++Y+ +  LE   +++  D  +I Y L  + IH G+    GHY    K   K G W  Y
Sbjct: 543  SKVYYPLI-LEVNSNYKCTD--TIKYELSGIVIHVGDGPQMGHYVALCKTE-KYG-WLFY 597

Query: 1257 NDETITEVPESEVFNF--SEGNTATPYFLVYVKQGHEQ 1292
            +DET+  V E  V  F   E   +T Y L Y K G ++
Sbjct: 598  DDETVESVSEETVLKFIGDEKTQSTAYVLFYKKLGDKE 635

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 4/63 (6%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVLDY--RNTVQHFLNNQEYASRRIGGREITEAE 791
           G  N GNTCY NS+LQ  +++   R  +L Y  RN +   +   E    +   R  +EA 
Sbjct: 127 GYENFGNTCYCNSVLQCLYNLPEFRLNILQYPERNLMDQRVRKLEMPGYK--PRCFSEAS 184

Query: 792 VER 794
            E+
Sbjct: 185 FEK 187

>Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W
            (REAL)
          Length = 748

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 42/88 (47%), Gaps = 6/88 (6%)

Query: 1211 ISHQFDDFKSIGYSLFAVFIHRGEA-SYGHYWIYIKDRYKSGIWRKYNDETITEVPESEV 1269
            +S  FD   S  Y L  V IH G    +GHY    K+  K G W  Y+DET+  + E  V
Sbjct: 581  VSSTFDSSISKKYELSGVVIHMGSGPQHGHYVCICKNE-KFG-WLLYDDETVESIREETV 638

Query: 1270 FNFS--EGNTATPYFLVYVKQGHEQEIE 1295
              F+   G+  T Y L Y K+ H  E +
Sbjct: 639  LKFTGHPGDQTTAYVLFY-KETHVNEAD 665

 Score = 38.9 bits (89), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 20/31 (64%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVLDY 764
           G  N GNTCY NS+LQ  ++IS  R  VL Y
Sbjct: 127 GYENFGNTCYCNSVLQCLYNISEFRCNVLRY 157

>KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7.390
            YBL067C
          Length = 701

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 44/93 (47%), Gaps = 3/93 (3%)

Query: 1211 ISHQFDDFKSIGYSLFAVFIHRGEA-SYGHYWIYIKDRYKSGIWRKYNDETITEVPESEV 1269
            +S  FD   S  Y L +  IH G+   YGHY    K   ++  W  ++DET+  V E  V
Sbjct: 547  VSSTFDSKLSKRYELASAVIHLGDGPQYGHYISLCKT--ETFGWLLFDDETVEAVDEQTV 604

Query: 1270 FNFSEGNTATPYFLVYVKQGHEQEIEPLKRVLE 1302
             +F+  N+ T Y L Y +     E++   +  E
Sbjct: 605  LSFTGENSDTAYVLFYNEVSEYDEVKSSTQAYE 637

 Score = 37.0 bits (84), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVLDY 764
           G  N GNTCY NS+LQ +F+ S  R  +L +
Sbjct: 128 GYENFGNTCYCNSILQCFFNHSVFRTSMLSF 158

>Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR304W
            (REAL)
          Length = 1231

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 48/106 (45%), Gaps = 26/106 (24%)

Query: 1223 YSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATP-- 1280
            Y+L  V +H G+ S GHY+  IK   +   W +++DE +  V + +VF  + G    P  
Sbjct: 449  YNLHGVLVHSGDISTGHYYTLIKPGVEDQ-WYRFDDERVWRVTKKQVFQENFGCDRLPDE 507

Query: 1281 ---------------------YFLVYVKQGHEQEIEPLKRVLEVTV 1305
                                 Y LVY++Q  EQ++  L+ VLE  V
Sbjct: 508  KVRTMTRDDYQNYIIQRHTSAYMLVYIRQEQEQDL--LRPVLESDV 551

 Score = 35.8 bits (81), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 17/29 (58%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYV 761
            G  N G TCYLNSLLQ YF     R+ V
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 233

>Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W
            (REAL)
          Length = 749

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 1211 ISHQFDDFKSIGYSLFAVFIHRGEA-SYGHYWIYIKDRYKSGIWRKYNDETITEVPESEV 1269
            +S  FD   S  Y L  V IH G    +GHY    K+  K G W  Y+DET+  + E  V
Sbjct: 587  VSSTFDTSVSKKYELSGVVIHMGSGPQHGHYVCICKNE-KFG-WLLYDDETVESIREETV 644

Query: 1270 FNFS--EGNTATPYFLVY 1285
              F+   G+  T Y L Y
Sbjct: 645  LQFTGHPGDQTTAYVLFY 662

 Score = 37.0 bits (84), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVLDY 764
           G  N GNTCY NS+LQ  ++I   R  +L Y
Sbjct: 135 GYENFGNTCYCNSVLQCLYNIPEFRCNILQY 165

>Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR296C
          Length = 1517

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 733  TGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQE 776
            TGL N+ NTCY+NS+LQ  FS S+ R   L   N   H+L + E
Sbjct: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLS--NKYAHYLKSPE 1146

>Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON}
           YBL067C (REAL)
          Length = 750

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 36/63 (57%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQEYASRRIGGREITEAEVE 793
           G  N GNTCY NS+LQ  +++SSLR+ +L +         ++++  +    R  TEA  E
Sbjct: 142 GYENFGNTCYCNSVLQCLYNLSSLRENILQFPEKPIESNQSRKHDMKGNKPRIFTEASFE 201

Query: 794 RSV 796
           +SV
Sbjct: 202 KSV 204

>KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.307
            YDL122W
          Length = 764

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (60%), Gaps = 3/51 (5%)

Query: 1221 IGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFN 1271
            + YSL +V +H G  +YGHY  + K R   G W + +DET+  V E+EV +
Sbjct: 622  LTYSLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETVGIVTEAEVLS 669

 Score = 33.5 bits (75), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 29/55 (52%)

Query: 709 SKLISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLD 763
           +K ++ +    ++D   L    +  GL N GNTC++NS+LQ   S   L  ++ D
Sbjct: 42  AKRMTSYYSAPSMDDVILKRGGFVAGLVNDGNTCFMNSVLQSLASSRELAHFLDD 96

>CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} highly
           similar to uniprot|P43593 Saccharomyces cerevisiae
           YFR010w UBP6 ubiquitin-specific protease
          Length = 495

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%)

Query: 714 HFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDY 764
            F++  + D       + P GL N+GNTCYLN+ LQ  F    L+  +L Y
Sbjct: 90  RFVEDLSPDQQVQQFNSTPLGLQNMGNTCYLNATLQALFRADELKDLILQY 140

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 32/66 (48%), Gaps = 1/66 (1%)

Query: 1223 YSLFAVFIHRGEAS-YGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPY 1281
            Y L  V  H+G  S  GHY  +I+D      W K+ND+ ++ + + ++   + G  +   
Sbjct: 426  YDLIGVITHQGANSESGHYQAFIRDESDENKWYKFNDDKVSPIEKEKIEALAGGGESDSA 485

Query: 1282 FLVYVK 1287
             ++  K
Sbjct: 486  LILLYK 491

>Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR304W
            (REAL)
          Length = 1230

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 48/106 (45%), Gaps = 26/106 (24%)

Query: 1223 YSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATP-- 1280
            Y+L  V +H G+ S GHY+  IK   +   W +++DE +  V + +VF  + G    P  
Sbjct: 448  YNLHGVLVHSGDISTGHYYTLIKPGVEDQ-WYRFDDERVWRVTKKQVFQENFGCDRLPDE 506

Query: 1281 ---------------------YFLVYVKQGHEQEIEPLKRVLEVTV 1305
                                 Y LVY++Q  EQ++  L+ V+E  V
Sbjct: 507  KVRTMTRDDYQNYIIQRHTSAYMLVYIRQDQEQDL--LRPVVESDV 550

 Score = 35.8 bits (81), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 17/29 (58%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYV 761
            G  N G TCYLNSLLQ YF     R+ V
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 233

>CAGL0H10582g Chr8 complement(1029876..1032248) [2373 bp, 790 aa] {ON}
            similar to uniprot|P25037 Saccharomyces cerevisiae
            YDL122w UBP1 ubiquitin-specific protease
          Length = 790

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 32/51 (62%), Gaps = 3/51 (5%)

Query: 1221 IGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFN 1271
            + Y+L +V +H G  +YGHY  Y K R   G+W + +DE++  V E+EV +
Sbjct: 687  LTYALRSVIVHYGTHNYGHYIAYRKFR---GVWWRISDESVYVVDEAEVLS 734

>Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR304W
            (REAL)
          Length = 1231

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 48/106 (45%), Gaps = 26/106 (24%)

Query: 1223 YSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATP-- 1280
            Y+L  V +H G+ S GHY+  IK   +   W +++DE +  V + +VF  + G    P  
Sbjct: 449  YNLHGVLVHSGDISTGHYYTLIKPGVEDQ-WYRFDDERVWRVTKKQVFQENFGCDRLPDE 507

Query: 1281 ---------------------YFLVYVKQGHEQEIEPLKRVLEVTV 1305
                                 Y LVY++Q  EQE + L+ VLE  V
Sbjct: 508  KVRTMTREDYQNYIIQRHTSAYMLVYIRQ--EQEEDLLRPVLESDV 551

 Score = 35.8 bits (81), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 17/29 (58%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYV 761
            G  N G TCYLNSLLQ YF     R+ V
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 233

>YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}
            UBP15Ubiquitin-specific protease involved in protein
            deubiquitination; catalytic activity regulated by an
            N-terminal TRAF-like domain and and C-terminal sequences;
            physically interacts with anaphase-promoting
            complex/cyclosome (APC/C) activator, Cdh1p
          Length = 1230

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 48/106 (45%), Gaps = 26/106 (24%)

Query: 1223 YSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATP-- 1280
            Y+L  V +H G+ S GHY+  IK   +   W +++DE +  V + +VF  + G    P  
Sbjct: 449  YNLHGVLVHSGDISTGHYYTLIKPGVEDQ-WYRFDDERVWRVTKKQVFQENFGCDRLPDE 507

Query: 1281 ---------------------YFLVYVKQGHEQEIEPLKRVLEVTV 1305
                                 Y LVY++Q  EQE + L+ VLE  V
Sbjct: 508  KVRTMTRGEYQNYIIQRHTSAYMLVYIRQ--EQEEDLLRPVLESDV 551

 Score = 35.8 bits (81), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 17/29 (58%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYV 761
            G  N G TCYLNSLLQ YF     R+ V
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 233

>NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON} 
          Length = 486

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 38/66 (57%), Gaps = 9/66 (13%)

Query: 1223 YSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPYF 1282
            YSL ++ +H G   YGHY  Y   R++   WR  +DE++ +V E EVF      +A+  F
Sbjct: 428  YSLKSIVVHYGSHDYGHYISY--RRFEDQWWR-ISDESVLKVDEDEVF------SASGIF 478

Query: 1283 LVYVKQ 1288
            +V+ +Q
Sbjct: 479  IVFYEQ 484

>Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W
           (REAL)
          Length = 1060

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 34/53 (64%), Gaps = 2/53 (3%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVL--DYRNTVQHFLNNQEYASRRIG 783
           TGL N+GNTCY+NS++Q  F+  + R   +  +Y+N ++   +N+ + S ++ 
Sbjct: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLS 650

>KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 758

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 32/51 (62%), Gaps = 3/51 (5%)

Query: 1221 IGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFN 1271
            + Y+L +V +H G  +YGHY  + K R   G+W + +DET+  V E+EV +
Sbjct: 677  LTYALRSVIVHYGTHNYGHYIAFRKFR---GLWWRISDETVYVVDEAEVLS 724

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 707 RNSKLISHFIDTGTVD----ASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYV 761
           RN+   S F   G+ D    A+ L    +  GL N GNTC++NS+LQ   S  +L Q++
Sbjct: 69  RNNYKGSMFNKWGSKDPEQEAAMLKRGGYVGGLVNDGNTCFMNSVLQSLASSKTLLQFL 127

>Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}
           YFR010W (REAL)
          Length = 500

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 22/33 (66%)

Query: 732 PTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDY 764
           P G  N+GNTCYLN+ LQ  + +  +R  +L+Y
Sbjct: 108 PVGFKNMGNTCYLNATLQALYRVDDVRDMILNY 140

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 1/69 (1%)

Query: 1220 SIGYSLFAVFIHRGEAS-YGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTA 1278
            S  Y+L  V  H+G  S  GHY  +I+D      W K+ND+ +T V + ++ + + G  +
Sbjct: 428  SCVYNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVTAVEKEKIESLAGGGES 487

Query: 1279 TPYFLVYVK 1287
                ++  K
Sbjct: 488  DSALILMYK 496

>NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] {ON}
            Anc_2.307 YDL122W
          Length = 770

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (60%), Gaps = 3/51 (5%)

Query: 1221 IGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFN 1271
            + YSL +V +H G  +YGHY  + K R   G W + +DET+  V E+EV +
Sbjct: 642  LTYSLRSVIVHYGTHNYGHYIAFRKFR---GCWWRISDETVYIVDEAEVLS 689

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 34/72 (47%)

Query: 692 QFLKLKGALSKIGFERNSKLISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYY 751
           QF+K K +     F+ N+         G +D   L    +  GL N GNTC++NS+LQ  
Sbjct: 50  QFIKYKMSDLTNKFKNNNMFRRWIPRAGNIDDKILKKGGFVGGLVNDGNTCFMNSVLQSL 109

Query: 752 FSISSLRQYVLD 763
            S   L  ++ D
Sbjct: 110 ASSKELNAFLDD 121

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
           similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 26/42 (61%), Gaps = 3/42 (7%)

Query: 726 LPAENWPT---GLNNIGNTCYLNSLLQYYFSISSLRQYVLDY 764
           LP  +  T   GL N GNTCY NS+LQ  F++S LR  +L Y
Sbjct: 123 LPCGDGSTKVFGLENFGNTCYCNSVLQCLFNLSELRTNILMY 164

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 42/94 (44%), Gaps = 13/94 (13%)

Query: 1207 LESKISHQFDDFKSIGYSLFAVFIHRGEA-SYGHYWIYIK-DRYKSGIWRKYNDETITEV 1264
            L+ K+  + D      Y L  + IH G    +GHY    K D +    W  Y+DET+  +
Sbjct: 621  LKLKVCTKSDTIVCKNYELNGIVIHMGGGPQHGHYVAICKHDMFG---WLLYDDETVESI 677

Query: 1265 PESEVFNF--SEGNTATPYFLVYVKQGHEQEIEP 1296
             E  VF F   E +  T Y L +      +E++P
Sbjct: 678  DEETVFKFVGDEKDMTTAYVLFF------KEVDP 705

>KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.69
            YNL186W
          Length = 784

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 35/72 (48%), Gaps = 8/72 (11%)

Query: 1217 DFKSIGYSLFAVFIHRGEA-SYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEG 1275
            D   + Y L +V +H G + S GHY  + K     G W  Y+DE I ++ E +V   S  
Sbjct: 639  DVLPVKYQLISVVVHEGRSLSSGHYIAHCKQ--PDGSWSTYDDEYINKITERDVLRESNA 696

Query: 1276 NTATPYFLVYVK 1287
                 Y+LVY +
Sbjct: 697  -----YYLVYTR 703

>NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {ON}
            Anc_5.18
          Length = 1211

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 44/99 (44%), Gaps = 24/99 (24%)

Query: 1219 KSIGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTA 1278
            +S  Y+L  V +H G+ S GHY+  IK   +   W +++DE + +V + +VF  + G   
Sbjct: 440  ESCKYTLHGVLVHTGDISTGHYYAMIKPDLQDQ-WYRFDDEKVWKVTKKQVFEENFGMNK 498

Query: 1279 TP-----------------------YFLVYVKQGHEQEI 1294
             P                       Y LVY+++  E E+
Sbjct: 499  LPEEEIRGMTREQYQNYLITRHTSAYMLVYIREDKEPEV 537

 Score = 35.8 bits (81), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 17/29 (58%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYV 761
            G  N G TCYLNSLLQ YF     R+ V
Sbjct: 207 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 235

>TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON} Anc_2.307
            YDL122W
          Length = 824

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 8/65 (12%)

Query: 1221 IGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATP 1280
            + Y L +V +H G  +YGHY  + K R   G W + +DET+  V E+EV      +T + 
Sbjct: 670  LTYELRSVIVHYGTHNYGHYIAFRKYR---GTWWRISDETVHMVDEAEVL-----STPSV 721

Query: 1281 YFLVY 1285
            + L Y
Sbjct: 722  FMLFY 726

>CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P50101 Saccharomyces cerevisiae YMR304w UBP15
          Length = 1196

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 49/106 (46%), Gaps = 26/106 (24%)

Query: 1223 YSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATP-- 1280
            Y+L  V +H G+ S GHY+  IK   +   W +++DE + +V +++VF  + G  A P  
Sbjct: 439  YNLHGVLVHAGDISTGHYYTLIKPGLEDQ-WYRFDDERVWKVTKNQVFEENYGLDALPDD 497

Query: 1281 ---------------------YFLVYVKQGHEQEIEPLKRVLEVTV 1305
                                 Y LVY++   E ++  L+ VLE  V
Sbjct: 498  KLRTMTREQYQEYVLARHTSAYMLVYIRSDREDQL--LQPVLESEV 541

 Score = 35.4 bits (80), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 17/29 (58%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYV 761
            G  N G TCYLNSLLQ YF     R+ V
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLV 231

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 101/229 (44%), Gaps = 34/229 (14%)

Query: 927  VTKADSGSSSNNSNKAVAMNTS---TRVAKISSDQLE-------NALEMGRQQDVTECIG 976
            V +  + + S N++  +A+  S    +V+K   D LE       ++ E   Q DV E   
Sbjct: 231  VYQIPTENESPNNSVPLALQRSFYQLQVSKFPLDTLELTRSFGWDSAEAFTQHDVQELNR 290

Query: 977  NVLFQLESASDPISLGDDNEQNDLVKQLFYGNIKQNIIPLKDETQVRTKYERFLSLLVNI 1036
             ++ +LE+     S+        ++ ++F G +K + I   D     ++ E F  L +N+
Sbjct: 291  ILMDRLENRMKGTSV------EGMLNEIFVGKMK-SYIKCIDVDYESSRVEDFWDLQLNV 343

Query: 1037 GDHPKDIYDALDLYFRDEYL------KLEEYG--DVKRTVAVTDFPTILQIQIQRVYYDR 1088
             +  K + ++ D Y   E L      + ++YG  D ++ V    FP +L +Q++R  YD 
Sbjct: 344  KNM-KGLKESFDNYIEIELLNGENQYQAQDYGLQDAEKGVIFESFPPVLHLQLKRFEYDF 402

Query: 1089 ERFMPFKSVAPLPFNETIYMDRYSDTNNPVLINRKRETE-KLVQELNGL 1136
                  K      F ETI +       +P L + K+E E   V  L+G+
Sbjct: 403  NYDQMIKVNDRYEFPETIDL-------SPYLEDSKKEKENNCVYNLHGV 444

>AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDL122W
            (UBP1)
          Length = 775

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 30/49 (61%), Gaps = 3/49 (6%)

Query: 1223 YSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFN 1271
            YSL +V +H G  +YGHY  + K R   G+W + +DET   V E+EV +
Sbjct: 674  YSLRSVIVHYGTHNYGHYIAFRKFR---GVWWRISDETAYIVDEAEVLS 719

>KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] {ON}
            Anc_2.307 YDL122W
          Length = 678

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 1223 YSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVF 1270
            YSL +V +H G  +YGHY  + K R   G W + +DET+  V E+EV 
Sbjct: 577  YSLRSVIVHYGTHNYGHYIAFRKYR---GYWWRISDETVYIVDETEVL 621

>KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa] {ON}
            Anc_2.69 YNL186W
          Length = 802

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 8/68 (11%)

Query: 1221 IGYSLFAVFIHRGEA-SYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTAT 1279
            + Y L +V +H G + S GHY  + K     G+W  Y+DE I ++ + EV   +      
Sbjct: 671  VKYQLISVVVHEGRSLSSGHYVAHCKQ--PDGLWATYDDEYINKISDKEVLRETNA---- 724

Query: 1280 PYFLVYVK 1287
             Y+LVY +
Sbjct: 725  -YYLVYSR 731

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 9/55 (16%)

Query: 717 DTGTVDASCLPAENW--------PTGLNNIGNTCYLNSLLQYYFSISSLRQYVLD 763
           D GT+ +S +  +NW        P GL N G TCY N+ +Q    I +++ Y+ D
Sbjct: 345 DQGTLKSSRI-LKNWGPELSELKPRGLLNHGVTCYTNAAVQAMLHIPAVQHYLFD 398

>Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]
           {ON} complement(144924..148595) [3672 nt, 1224 aa]
          Length = 1223

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 20/29 (68%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVL 762
           GLNN+GNTCY+NS LQ    I  LR Y L
Sbjct: 343 GLNNLGNTCYMNSALQCLVHIPQLRDYFL 371

>TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.307
            YDL122W
          Length = 747

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 3/53 (5%)

Query: 1221 IGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFS 1273
            + Y L +V +H G  +YGHY  + K R   G W + +DET+  V E+EV + S
Sbjct: 656  LTYVLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETVYVVEEAEVLSTS 705

 Score = 36.2 bits (82), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%)

Query: 719 GTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLD 763
           G VD   L    +  GL N GNTC++NS++Q   S + L +++ D
Sbjct: 78  GQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFLDD 122

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 465

 Score = 41.2 bits (95), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 32/71 (45%), Gaps = 8/71 (11%)

Query: 1216 DDFKSIGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEG 1275
            DD   I + L  +  HRG  + GHY  + K    +G W K+ND  ++ + E E+      
Sbjct: 398  DDVPDIIFELIGIIAHRGTVNEGHYIAFTK--VTTGHWFKFNDSMVSSITEEELLQ---- 451

Query: 1276 NTATPYFLVYV 1286
                 Y L YV
Sbjct: 452  --EQAYLLFYV 460

>TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {ON}
           Anc_5.712 YIL156W
          Length = 1212

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 23/33 (69%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYR 765
           TGL N+GNTCY+NS+LQ  F+ +  R   L ++
Sbjct: 753 TGLRNLGNTCYINSMLQCLFATTEFRNIFLSHK 785

>TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]
           {ON} Anc_1.137 YJL197W
          Length = 1178

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 20/30 (66%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVL 762
           TGL N+GNTCY+NS LQ    I  LR Y L
Sbjct: 302 TGLTNLGNTCYMNSALQCLVHIPELRDYFL 331

 Score = 33.9 bits (76), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 33/73 (45%), Gaps = 11/73 (15%)

Query: 1223 YSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEV-PESEVFNFSEGNTATPY 1281
            Y L AV  H G    GHY  Y+K   K   W  ++D  +TE  PES +         + Y
Sbjct: 959  YDLIAVDNHFGGLGGGHYTAYVKTNDK---WFYFDDSRVTETKPESSI-------AGSAY 1008

Query: 1282 FLVYVKQGHEQEI 1294
             L Y+++    +I
Sbjct: 1009 LLFYLRRTESGKI 1021

>TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.69
            YNL186W
          Length = 661

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 8/77 (10%)

Query: 1212 SHQFDDFKSIGYSLFAVFIHRGEA-SYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVF 1270
            S++ D    + Y L  V +H G + S GHY ++ K     G W  Y+DE I ++ E +V 
Sbjct: 538  SNEKDHVVPVKYQLTTVVVHEGRSLSSGHYIVHCKQ--PDGTWATYDDEYINKITERDVL 595

Query: 1271 NFSEGNTATPYFLVYVK 1287
               E N    Y+L+Y +
Sbjct: 596  K--EPNA---YYLLYTR 607

>KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 750

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 35/68 (51%), Gaps = 8/68 (11%)

Query: 1221 IGYSLFAVFIHRGEA-SYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTAT 1279
            + Y L +V +H G + S GHY  + K     G W  Y+DE I ++ E ++    E N   
Sbjct: 637  VRYQLISVVVHEGRSLSSGHYIAHCKQ--PDGSWATYDDEYINKISEKQLLK--EPNA-- 690

Query: 1280 PYFLVYVK 1287
             YFLVY +
Sbjct: 691  -YFLVYTR 697

>ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 745

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 32/51 (62%), Gaps = 3/51 (5%)

Query: 1221 IGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFN 1271
            + YSL +V +H G  +YGHY  +   RY+ G W + +DET+  V E+EV +
Sbjct: 652  LTYSLRSVVVHYGTHNYGHYIAF--RRYR-GYWWRISDETVYIVDETEVLS 699

>Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON}
           YBL067C (REAL)
          Length = 745

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 33/62 (53%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQEYASRRIGGREITEAEVE 793
           G  N GNTCY NS+LQ  +++S LR+ +L +        + ++   R    R  TEA  E
Sbjct: 141 GYENFGNTCYCNSVLQCLYNLSPLRENILQFPEKPIESGHPRKNEMRGNRPRIFTEASFE 200

Query: 794 RS 795
           RS
Sbjct: 201 RS 202

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
           YIL156W
          Length = 1025

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 30/48 (62%), Gaps = 3/48 (6%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQEYASR 780
           TGL N+GNTCY+NS+LQ  F+ +  R   +  +   + F  NQ Y++R
Sbjct: 608 TGLRNLGNTCYINSMLQCLFATTKFRDLFVSGK--FEEFF-NQNYSNR 652

>TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {ON}
            Anc_8.742 YMR223W
          Length = 483

 Score = 40.8 bits (94), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 8/64 (12%)

Query: 1223 YSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPYF 1282
            Y L  +  HRG  + GHY  Y K     G+W ++ND  + +VP  ++           Y 
Sbjct: 423  YELTGIVTHRGTVNEGHYITYTKT--ADGVWYQFNDSVVMKVPLEQMLK------EQAYL 474

Query: 1283 LVYV 1286
            L+Y 
Sbjct: 475  LIYT 478

>ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa]
           {ON} similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304W UBP15 Ubiquitin-specific protease that may play
           a role in ubiquitin precursor processing
          Length = 1193

 Score = 41.2 bits (95), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 69/181 (38%), Gaps = 36/181 (19%)

Query: 611 SPGLKI---DCDRALYTIAVHSRSLALFNFLVQQSEEF-------QEYFGPDQFSYQDAL 660
           SP  KI   + D  L+    HS+SLA++  L   +EE         EY  PD +      
Sbjct: 57  SPRFKIGEFEWDILLFPQGNHSKSLAIY--LEPHAEEKVNEETGETEYVDPDWYCCAQFT 114

Query: 661 SVLQVNENAGDDTILEIFQRKWYKEPVFDADQFLKLKGALSKIGFERNSKLISHFIDTGT 720
            VL      GDD  L +     ++    D D        L+++ +   SK +S  ++ G 
Sbjct: 115 IVLS---RPGDDNRLHVINSSHHRFNAIDTDWGFASFIDLNQLKYPSKSK-VSGLLNQGQ 170

Query: 721 VDASCL-------PAENWP-------------TGLNNIGNTCYLNSLLQYYFSISSLRQY 760
           ++ +             W               G  N G TCYLNSLLQ YF     R+ 
Sbjct: 171 LNVTTFVRILKDPTGVLWHNFVNYDSKKMTGYVGFRNQGATCYLNSLLQSYFFTKYFRRL 230

Query: 761 V 761
           V
Sbjct: 231 V 231

 Score = 37.0 bits (84), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 1223 YSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATP 1280
            Y L  V +H G+ S GHY+  IK   +   W +++DE + +V + + F+ + G    P
Sbjct: 440  YGLHGVLVHTGDISTGHYYALIKPGLEDQ-WYRFDDERVWKVSKKQAFDENFGFDRLP 496

>Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 40.4 bits (93), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 1221 IGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVF 1270
            I Y L  +  HRG  + GHY  + K     G W K+ND  +T + + EV 
Sbjct: 409  IIYELIGIVSHRGTVNEGHYIAFCK--ISGGQWFKFNDSVVTSIAQGEVL 456

>TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.307
            YDL122W
          Length = 782

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 32/51 (62%), Gaps = 3/51 (5%)

Query: 1221 IGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFN 1271
            + YSL +V +H G  +YGHY  +   RY+ G W + +DE++  V E+EV +
Sbjct: 672  LTYSLRSVIVHYGTHNYGHYIAF--RRYR-GCWWRISDESVYIVEEAEVLS 719

 Score = 34.3 bits (77), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 707 RNSKLISHFIDT-GTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYV 761
           RN+  ++ F+ +  ++D + L       GL N GNTC++NS+LQ   S  +L +++
Sbjct: 59  RNNSTLNRFLPSYNSMDDTILKRGGHIAGLVNDGNTCFMNSVLQSLASSRTLVEFL 114

>KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1012

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 20/30 (66%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVL 762
           TGL N+GNTCY+NS+LQ  F  S  R   L
Sbjct: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFL 617

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
           (REAL)
          Length = 1247

 Score = 40.8 bits (94), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 20/30 (66%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVL 762
           TGL N+GNTCY+NS LQ    I  LR Y L
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFL 393

 Score = 33.9 bits (76), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 46/93 (49%), Gaps = 12/93 (12%)

Query: 1216 DDFKSIGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITE-VPESEVFNFSE 1274
            DD +   Y L+AV  H G    GHY  Y+K+ + +  W  ++D  +TE VPE+ +     
Sbjct: 1041 DDPRGSIYDLYAVDNHYGGLGGGHYTAYVKN-FANNKWYYFDDSRVTETVPENSI----- 1094

Query: 1275 GNTATPYFLVYV---KQGHEQEIEPLKRVLEVT 1304
                + Y L Y+   K G E     L+ +++++
Sbjct: 1095 --AGSAYLLFYIRRPKDGDELGGPKLQEIIKIS 1125

>YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}
           UBP12Ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1254

 Score = 40.8 bits (94), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 20/30 (66%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVL 762
           TGL N+GNTCY+NS LQ    I  LR Y L
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFL 393

 Score = 33.1 bits (74), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 37/74 (50%), Gaps = 9/74 (12%)

Query: 1216 DDFKSIGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITE-VPESEVFNFSE 1274
            DD + + Y L+AV  H G    GHY  Y+K+ +    W  ++D  +TE  PE+ +     
Sbjct: 1045 DDPRGLIYDLYAVDNHYGGLGGGHYTAYVKN-FADNKWYYFDDSRVTETAPENSI----- 1098

Query: 1275 GNTATPYFLVYVKQ 1288
                + Y L Y+++
Sbjct: 1099 --AGSAYLLFYIRR 1110

>NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69
          Length = 875

 Score = 40.4 bits (93), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 8/68 (11%)

Query: 1221 IGYSLFAVFIHRGEA-SYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTAT 1279
            + Y L +V +H G + S GHY  +   R   G W  Y+DE I ++ E  V        A 
Sbjct: 689  VKYELLSVVVHEGRSLSSGHYIAHC--RQPDGSWATYDDEYINKISELNVL-----KEAN 741

Query: 1280 PYFLVYVK 1287
             Y+L+Y +
Sbjct: 742  AYYLLYTR 749

>ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P39538 Saccharomyces cerevisiae
           YJL197W UBP12 Ubiquitin-specific protease present in the
           nucleus and cytoplasm that cleaves ubiquitin from
           ubiquitinated proteins
          Length = 1204

 Score = 40.4 bits (93), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 20/30 (66%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVL 762
           TGL N+GNTCY+NS LQ    I  LR Y L
Sbjct: 293 TGLYNLGNTCYMNSALQCLVHIPELRDYFL 322

>Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W
           (REAL)
          Length = 1255

 Score = 40.4 bits (93), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 20/30 (66%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVL 762
           TGL N+GNTCY+NS LQ    I  LR Y L
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFL 393

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 43/86 (50%), Gaps = 10/86 (11%)

Query: 1207 LESKISHQFDDFKSIGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITE-VP 1265
            L   + H+ D   SI Y L+AV  H G    GHY  Y+K+ +    W  ++D  +TE VP
Sbjct: 1039 LSKHVVHKDDPRGSI-YDLYAVDNHYGGLGGGHYTAYVKN-FADSKWYYFDDSRVTETVP 1096

Query: 1266 ESEVFNFSEGNTATPYFLVYVKQGHE 1291
            E+ +       + + Y L Y+++  +
Sbjct: 1097 ENSI-------SGSAYLLFYIRRAKD 1115

>Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186W
            (REAL)
          Length = 788

 Score = 40.4 bits (93), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 8/68 (11%)

Query: 1221 IGYSLFAVFIHRGEA-SYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTAT 1279
            + Y L +V +H G + S GHY  + K     G W  Y+DE I ++ E +V    E N   
Sbjct: 667  VKYQLLSVVVHEGRSLSSGHYIAHCKQ--PDGTWATYDDEYINKISERDVLK--EPNA-- 720

Query: 1280 PYFLVYVK 1287
             Y+L+Y +
Sbjct: 721  -YYLLYTR 727

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 9/55 (16%)

Query: 717 DTGTVDASCLPAENW--------PTGLNNIGNTCYLNSLLQYYFSISSLRQYVLD 763
           D G++++S +  +NW        P GL N G TCY N+ +Q    I S++ Y+ D
Sbjct: 336 DHGSLNSSRI-IKNWGDQFTNLKPRGLLNHGVTCYTNAAVQAMLHIPSIQHYLFD 389

>NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {ON}
            Anc_2.69 YNL186W
          Length = 870

 Score = 40.4 bits (93), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 8/66 (12%)

Query: 1223 YSLFAVFIHRGEA-SYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPY 1281
            Y L +V +H G + S GHY  +   R   G W  Y+DE I ++  SE+   +E N    Y
Sbjct: 761  YQLLSVVVHEGRSLSSGHYIAHC--RQPDGTWATYDDELINKI--SELKLLTEPNA---Y 813

Query: 1282 FLVYVK 1287
            +LVY +
Sbjct: 814  YLVYTR 819

 Score = 33.1 bits (74), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 11/61 (18%)

Query: 714 HFIDTGTVDASCLPA---ENW--------PTGLNNIGNTCYLNSLLQYYFSISSLRQYVL 762
            F +  T + S +P+   +NW        P GL N G TCY N+ +Q    I +++ Y+ 
Sbjct: 412 QFNEIITDEGSIIPSNIIKNWGPVFANLRPKGLINHGVTCYTNAAVQAMVHIPAVQHYLF 471

Query: 763 D 763
           D
Sbjct: 472 D 472

>TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] {ON}
            Anc_2.69 YNL186W
          Length = 898

 Score = 40.4 bits (93), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 36/73 (49%), Gaps = 8/73 (10%)

Query: 1216 DDFKSIGYSLFAVFIHRGEA-SYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSE 1274
            D    + Y L +V +H G + S GHY  + K     G W  Y+DE I ++ E E+    E
Sbjct: 748  DSILPVKYQLLSVVVHEGRSLSSGHYIAHCKQ--PDGSWATYDDEYINKISEREM--LKE 803

Query: 1275 GNTATPYFLVYVK 1287
             N    Y+L+Y +
Sbjct: 804  PNA---YYLLYTR 813

>ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YNL186W (UBP10)
          Length = 749

 Score = 40.4 bits (93), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 8/68 (11%)

Query: 1221 IGYSLFAVFIHRGEA-SYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTAT 1279
            + Y L +V +H G + S GHY  + K     G W  Y+DE I ++ E  V          
Sbjct: 636  VKYQLISVVVHEGRSLSSGHYIAHCKQ--PDGTWATYDDEYINKITERNVL-----KEVN 688

Query: 1280 PYFLVYVK 1287
             Y+LVY +
Sbjct: 689  AYYLVYTR 696

>YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}
           UBP7Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1071

 Score = 40.4 bits (93), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVLD--YRNTVQHFLNNQEYASRRIG 783
           TGL N+GNTCY+NS++Q  F+  + R   +   Y++ +Q   +N  + S ++ 
Sbjct: 609 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSKYKSYLQPIRSNGSHYSPKLS 661

>NCAS0G03680 Chr7 complement(682617..684065) [1449 bp, 482 aa] {ON}
            Anc_2.307 YDL122W
          Length = 482

 Score = 40.0 bits (92), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 29/56 (51%), Gaps = 3/56 (5%)

Query: 1215 FDDFKSIGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVF 1270
             +D   I Y L AV IH G  +YGHY  Y   R     W + +DE++ EV E EV 
Sbjct: 414  LEDPDKIIYDLKAVIIHYGTHNYGHYISY---RKFMNQWWRISDESVIEVDEMEVL 466

>TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5.18
            YMR304W
          Length = 1193

 Score = 40.4 bits (93), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 45/106 (42%), Gaps = 26/106 (24%)

Query: 1223 YSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATP-- 1280
            Y L  V +H G+ S GHY+  IK       W +++DE + +V   +VF+ + G    P  
Sbjct: 448  YKLHGVLVHTGDISTGHYYTMIKPDLGDQ-WYRFDDERVWKVDRKQVFDENFGLDKLPDS 506

Query: 1281 ---------------------YFLVYVKQGHEQEIEPLKRVLEVTV 1305
                                 Y LVYVK   E+EI  L+ V E  V
Sbjct: 507  ELRGMTKEEYQSYLITRHTSAYMLVYVKDEVEEEI--LQPVTETDV 550

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 17/29 (58%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYV 761
            G  N G TCYLNSLLQ YF     R+ V
Sbjct: 209 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 237

>CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa]
            {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
            YNL186w UBP10
          Length = 771

 Score = 40.0 bits (92), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 8/68 (11%)

Query: 1221 IGYSLFAVFIHRGEA-SYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTAT 1279
            + Y L +V +H G + S GHY  + K     G W  Y+DE I ++ E EV    E N   
Sbjct: 660  VKYELLSVVVHEGRSLSSGHYIAHCKQ--PDGSWATYDDEYINKITEREVLK--ERNA-- 713

Query: 1280 PYFLVYVK 1287
             Y+++Y +
Sbjct: 714  -YYVLYTR 720

>Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186W
            (REAL)
          Length = 763

 Score = 40.0 bits (92), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 8/68 (11%)

Query: 1221 IGYSLFAVFIHRGEA-SYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTAT 1279
            + Y L +V +H G + S GHY  + K     G W  Y+DE I ++ E +V   +      
Sbjct: 642  VKYQLLSVVVHEGRSLSSGHYIAHCKQ--PDGSWATYDDEYINKISERDVLKETNA---- 695

Query: 1280 PYFLVYVK 1287
             Y+L+Y +
Sbjct: 696  -YYLLYTR 702

>NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712
          Length = 1030

 Score = 40.0 bits (92), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 39/84 (46%), Gaps = 12/84 (14%)

Query: 706 ERNSKLISHFIDTGTVD--ASCLPAENWP--------TGLNNIGNTCYLNSLLQYYFSIS 755
           ERN ++  H   T T+    S    E  P        TGL N+GNTCY+NS+LQ  F+  
Sbjct: 571 ERNYQIPPHLQQTTTLTRRPSIPTIERSPNLYVSLSITGLRNLGNTCYINSMLQCLFATR 630

Query: 756 SLRQYVLDYRNTVQHFLNNQEYAS 779
             R   L  +     FLN  ++ +
Sbjct: 631 RFRDLFLTSK--YSSFLNGSKFPN 652

>KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.712
           YIL156W
          Length = 846

 Score = 40.0 bits (92), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 23/33 (69%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYR 765
           +GL N+GNTCY+NS+LQ  F+ ++ R   L  R
Sbjct: 446 SGLRNLGNTCYINSMLQCLFATTAFRNLFLSNR 478

>KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1161

 Score = 40.0 bits (92), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 20/26 (76%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLR 758
           TGL N+GNTCY+NS++Q  F+  S R
Sbjct: 691 TGLRNLGNTCYINSMIQCLFATKSFR 716

>TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1045

 Score = 40.0 bits (92), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 32/50 (64%), Gaps = 2/50 (4%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVL--DYRNTVQHFLNNQEYASR 780
           TGL N+GNTCY++S+LQ  F+ ++LR   +   Y + + H + ++   SR
Sbjct: 625 TGLRNLGNTCYISSMLQCLFATTTLRDLFITTKYESYINHKVTDKINLSR 674

>KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1.137
           YJL197W
          Length = 1171

 Score = 39.7 bits (91), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 17/29 (58%), Positives = 20/29 (68%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVL 762
           GL+N+GNTCY+NS LQ    I  LR Y L
Sbjct: 324 GLSNLGNTCYMNSALQCLVHIPQLRDYFL 352

>NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5.18
            YMR304W
          Length = 1197

 Score = 39.7 bits (91), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 52/106 (49%), Gaps = 26/106 (24%)

Query: 1223 YSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVF--NF-----SEG 1275
            Y+L  V +H G+ S GHY+  IK   +   W +++DE + +V + +VF  NF     SE 
Sbjct: 438  YNLHGVLVHTGDISTGHYYAMIKPDLEDQ-WYRFDDEKVWKVTKKQVFEENFGLDRRSED 496

Query: 1276 NT----------------ATPYFLVYVKQGHEQEIEPLKRVLEVTV 1305
            +                  + Y LVY+++  E+E+  L+ V E+ V
Sbjct: 497  DLKCMTREQYEDYLITRHTSAYMLVYIRKDKEEEL--LQPVTELDV 540

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 77/179 (43%), Gaps = 32/179 (17%)

Query: 611 SPGLKI---DCDRALYTIAVHSRSLALFNFLVQ------QSEEFQEYFGPDQFSYQDALS 661
           SP +KI   + D  L+    H++ LA++   V+      Q+EE  E    D   Y  A  
Sbjct: 55  SPRVKIGDFEWDILLFPQGNHNKGLAVY---VEPHPKQIQNEETGELENADADWYCCAQF 111

Query: 662 VLQVNENAGDDTILEIFQRKWYKEPVFDAD---------QFLKLKGALSKIGFERNSKL- 711
            + V    G+DT + +  R  ++    D D           LK     SK G+ ++ KL 
Sbjct: 112 AV-VLSKPGEDTAINLVNRSHHRFNSVDTDWGFANLLDLNHLKYPSRNSKSGYLKDGKLH 170

Query: 712 ISHFI-----DTGTVDASCLPAENWPT----GLNNIGNTCYLNSLLQYYFSISSLRQYV 761
           IS ++      TG +  + +  ++       G  N G TCYLNSLLQ YF     R+ V
Sbjct: 171 ISAYVRILKDTTGVLWHNFMNYDSKKVTGYVGFRNQGATCYLNSLLQSYFFTKYFRKLV 229

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 100/219 (45%), Gaps = 32/219 (14%)

Query: 927  VTKADSGSSSNNSNKAVAMNTS---TRVAKISSDQLE-------NALEMGRQQDVTECIG 976
            V K  + S + NS+  +A+  +    +V++I  D LE       ++ E   Q DV E   
Sbjct: 229  VYKIPTESETPNSSVPLALQRAFYQLQVSQIPLDTLELTRSFGWDSAEAFTQHDVQELNR 288

Query: 977  NVLFQLESASDPISLGDDNEQNDLVKQLFYGNIKQNIIPLKDETQVRTKYERFLSLLVNI 1036
             ++ +LE+      LG   E    + +LF G +K  I  +  E +  ++ E F  L +N+
Sbjct: 289  ILMDRLENRM----LGTPVEGK--LSELFVGKMKSYIKCVNVEYE-SSRVEDFWDLQLNV 341

Query: 1037 GDHPKDIYDALDLYFRDEYLKLE------EYG--DVKRTVAVTDFPTILQIQIQRVYYD- 1087
             +  K + D+ + Y   E +  E      ++G  D ++ V    FP IL +Q++R  YD 
Sbjct: 342  KNL-KCLKDSFENYIEIELMNGENQYAAQDFGLQDAEKGVIFESFPPILHLQLKRFEYDF 400

Query: 1088 -RERFMPFKSVAPLP--FNETIYMDRYSDTNN--PVLIN 1121
              ++ +        P  F+ + YM++  D +N  P + N
Sbjct: 401  NFDQLIKINDRYEFPESFDTSPYMEKKEDGSNNEPCIYN 439

>NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712
          Length = 1105

 Score = 39.7 bits (91), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 29/47 (61%), Gaps = 2/47 (4%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQEYAS 779
           TGL N+GNTCY+NS+LQ  F+    R   +  +   Q F+N+ ++ +
Sbjct: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSK--FQSFINDSKFPN 722

>Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {ON}
           YJL197W (REAL)
          Length = 1256

 Score = 39.7 bits (91), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query: 714 HFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVL 762
           H++    V     PA    TGL N+GNTCY+NS LQ    +  LR Y L
Sbjct: 343 HWVSNHFVYNKLEPASG-TTGLVNLGNTCYMNSALQCLVHLPQLRDYFL 390

 Score = 33.1 bits (74), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 37/74 (50%), Gaps = 9/74 (12%)

Query: 1216 DDFKSIGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITE-VPESEVFNFSE 1274
            DD +   Y L+AV  H G    GHY  Y+K+ +    W  ++D  +TE VPE+ V     
Sbjct: 1044 DDPRGSIYDLYAVDNHYGGLGGGHYTAYVKN-FMDNKWYYFDDSRVTETVPENSV----- 1097

Query: 1275 GNTATPYFLVYVKQ 1288
                + Y L Y+++
Sbjct: 1098 --AGSAYLLFYIRR 1109

>KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5.18
            YMR304W
          Length = 1213

 Score = 39.7 bits (91), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 42/95 (44%), Gaps = 24/95 (25%)

Query: 1223 YSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVF------------ 1270
            Y L  V +H G+ S GHY+  IK   +   W +++DE + +V +++VF            
Sbjct: 431  YKLHGVLVHAGDISTGHYYAMIKPSTEDQ-WYRFDDEKVWKVTKTQVFDENFGLDRIPDD 489

Query: 1271 -----------NFSEGNTATPYFLVYVKQGHEQEI 1294
                       N+      + Y LVY+++  E ++
Sbjct: 490  EVRLMSREQYQNYLLARHTSAYMLVYIREDQEADL 524

 Score = 35.8 bits (81), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 17/29 (58%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYV 761
            G  N G TCYLNSLLQ YF     R+ V
Sbjct: 193 VGFKNQGATCYLNSLLQSYFFTKYFRRLV 221

>AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER098W (UBP9) and
           YBL067C (UBP13)
          Length = 740

 Score = 39.7 bits (91), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 21/31 (67%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVLDY 764
           GL N GNTCY NS+LQ  +++  LR  VL Y
Sbjct: 100 GLENYGNTCYCNSVLQCLYNLKELRVNVLKY 130

 Score = 36.6 bits (83), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 38/92 (41%), Gaps = 4/92 (4%)

Query: 1207 LESKISHQFDDFKSIGYSLFAVFIHRGEA-SYGHYWIYIKDRYKSGIWRKYNDETITEVP 1265
            L  ++   FD      Y L  + IH G    +GHY    K       W  Y+DET+  V 
Sbjct: 576  LNLRVCSTFDHAVCKDYELNGIVIHMGGGPQHGHYVAICKHELFG--WLLYDDETVESVG 633

Query: 1266 ESEVFNF-SEGNTATPYFLVYVKQGHEQEIEP 1296
            E  V  F  + N  T  ++++ K   E +  P
Sbjct: 634  EDAVLRFIGDVNDMTTAYVLFYKSKREDDDTP 665

>Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186W
            (REAL)
          Length = 776

 Score = 39.7 bits (91), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 8/68 (11%)

Query: 1221 IGYSLFAVFIHRGEA-SYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTAT 1279
            + Y L +V +H G + S GHY  + K     G W  Y+DE I ++ E +V    E N   
Sbjct: 655  VKYQLLSVVVHEGRSLSSGHYIAHCKQ--PDGNWATYDDEYINKISERDV--LKEPNA-- 708

Query: 1280 PYFLVYVK 1287
             Y+L+Y +
Sbjct: 709  -YYLLYTR 715

>ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 702

 Score = 39.3 bits (90), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 8/68 (11%)

Query: 1221 IGYSLFAVFIHRGEA-SYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTAT 1279
            + Y L  V +H G + S GHY ++ K     G W  Y+DE I  + E +V    E N   
Sbjct: 585  LKYQLITVVVHEGRSLSSGHYIVHCKQ--PEGHWATYDDEYINNINEKDVLR--EPNA-- 638

Query: 1280 PYFLVYVK 1287
             Y+LVY +
Sbjct: 639  -YYLVYTR 645

>KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1198

 Score = 39.7 bits (91), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 21/30 (70%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVL 762
           TGL+N+GN+CY+NS LQ    I  L+ Y L
Sbjct: 334 TGLSNLGNSCYMNSALQCLVHIPELKDYFL 363

>Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {ON}
            similar to Ashbya gossypii AGL357W
          Length = 1176

 Score = 39.7 bits (91), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 46/104 (44%), Gaps = 28/104 (26%)

Query: 1219 KSIGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVF-------- 1270
            +S+ Y+L  V +H G+ S GHY+  IK       W +++D+ + +V + +VF        
Sbjct: 432  ESMMYNLHGVLVHTGDISTGHYYAMIKPGLDDK-WYRFDDDKVWQVTKKQVFEQNFGFDR 490

Query: 1271 ---------------NFSEGNTATPYFLVYVKQGHE----QEIE 1295
                           N+      + Y LVY+K+  E    QE+E
Sbjct: 491  LPEYELRSLSKEQYQNYLIARQTSAYMLVYIKEDMEPTILQEVE 534

 Score = 35.8 bits (81), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 18/29 (62%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYV 761
            GL N G TCYLNSLLQ Y+     R+ V
Sbjct: 199 VGLKNQGATCYLNSLLQSYYFTKYFRKLV 227

>SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 765

 Score = 39.3 bits (90), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 699 ALSKIGFERNSKLISHFIDTGTVDASCLPA-ENWPTGLNNIGNTCYLNSLLQYYFS 753
            L ++  E+N       +D+   +   LPA + +  GLNN+GN+CY+NS+LQ  F+
Sbjct: 278 TLVELQVEQNMNWDFQMVDSKGNELKHLPASKEYGCGLNNLGNSCYMNSVLQVLFN 333

>Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {ON}
           YIL156W (REAL)
          Length = 1062

 Score = 39.3 bits (90), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVLD--YRNTVQHFLNNQEYASR 780
           TGL N+GNTCY+NS++Q  F+    R   +   Y++ +Q    N+ ++ R
Sbjct: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPR 651

>Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186W
            (UBP10) - predicted to encode a ubiquitin-processing
            protease [contig 103] PARTIAL
          Length = 511

 Score = 39.3 bits (90), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 8/68 (11%)

Query: 1221 IGYSLFAVFIHRGEA-SYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTAT 1279
            + Y L +V +H G + S GHY  + K     G W  Y+DE I ++ E ++          
Sbjct: 393  VKYQLISVVVHEGRSLSSGHYIAHCKQ--PDGSWSTYDDEYINKISEKQML-----KEPG 445

Query: 1280 PYFLVYVK 1287
             Y+LVY +
Sbjct: 446  AYYLVYTR 453

>Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON}
            (71125..74697) [3573 nt, 1191 aa]
          Length = 1190

 Score = 39.3 bits (90), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 41/93 (44%), Gaps = 24/93 (25%)

Query: 1223 YSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATP-- 1280
            Y L  V +H G+ S GHY+  IK   +   W +++DE + +V + +VF+ + G    P  
Sbjct: 441  YKLHGVLVHTGDISTGHYYAMIKPTLEDQ-WYRFDDEKVWKVDKKQVFDENFGLDRLPDS 499

Query: 1281 ---------------------YFLVYVKQGHEQ 1292
                                 Y LVY+ +G E+
Sbjct: 500  KLRSMTREEYQSYLITRHTNAYMLVYICEGMEE 532

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 17/29 (58%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYV 761
            G  N G TCYLNSLLQ YF     R+ V
Sbjct: 204 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 232

>SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar to
            uniprot|P50101 Saccharomyces cerevisiae YMR304W UBP15
            Ubiquitin-specific protease that may play a role in
            ubiquitin precursor processing
          Length = 1190

 Score = 39.3 bits (90), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 42/95 (44%), Gaps = 24/95 (25%)

Query: 1223 YSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATP-- 1280
            Y L  V +H G+ S GHY+  IK   +   W +++D+ +  V +++VF  + G+   P  
Sbjct: 443  YDLHGVLVHTGDISTGHYYTMIKPSIEDQ-WYRFDDDKVWRVTKNQVFEENFGHVRLPDE 501

Query: 1281 ---------------------YFLVYVKQGHEQEI 1294
                                 Y LVYV++  E +I
Sbjct: 502  KLRTFTREQYQNYLISRQTSAYMLVYVRKDMEDKI 536

 Score = 35.8 bits (81), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 17/29 (58%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYV 761
            G  N G TCYLNSLLQ YF     R+ V
Sbjct: 206 VGFKNQGATCYLNSLLQSYFFTKYFRKLV 234

>Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W
           (REAL)
          Length = 1064

 Score = 39.3 bits (90), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 26/39 (66%), Gaps = 2/39 (5%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVL--DYRNTVQ 769
           TGL N+GNTCY+NS++Q  F+    R   +  +Y+N +Q
Sbjct: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQ 639

>Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W
           (UBP7) - Ubiquitin-specific protease [contig 159] FULL
          Length = 970

 Score = 39.3 bits (90), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVL 762
           TGL N+GNTCY+NS+LQ  F+    R   L
Sbjct: 556 TGLRNMGNTCYINSMLQCLFATRKFRDLFL 585

>Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON}
            (56564..58738) [2175 nt, 725 aa]
          Length = 724

 Score = 39.3 bits (90), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 8/68 (11%)

Query: 1221 IGYSLFAVFIHRGEA-SYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTAT 1279
            + Y L +V +H G + S GHY  +   R   G W  Y+DE I ++ E  V    E N   
Sbjct: 605  VKYQLISVVVHEGRSLSSGHYIAHC--RQPDGSWAIYDDEYINKISERNV--LKEPNA-- 658

Query: 1280 PYFLVYVK 1287
             Y+L+Y +
Sbjct: 659  -YYLIYTR 665

 Score = 37.0 bits (84), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 14/66 (21%)

Query: 717 DTGTVDASCLPAENW--------PTGLNNIGNTCYLNSLLQYYFSISSLRQYVLD----- 763
           D G++ +S +  +NW        P GL N G TCY N+ +Q    I +++ Y+ D     
Sbjct: 288 DAGSIISSPI-VKNWGPVLTNLKPCGLLNHGVTCYTNAAVQAMLHIPAIQHYLFDVLRGS 346

Query: 764 YRNTVQ 769
           ++NT++
Sbjct: 347 HKNTIK 352

>Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {ON}
           YER098W (UBP9) - ubiquitin carboxyl-terminal hydrolase
           [contig 33] FULL
          Length = 711

 Score = 38.9 bits (89), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (70%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVLDY 764
           G  N GNTCY NS+LQ  +++  LR ++L+Y
Sbjct: 144 GYENFGNTCYCNSVLQVLYNLPELRVHLLEY 174

>Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL197W
           (UBP12) - ubiquitin carboxyl-terminal hydrolase [contig
           114] FULL
          Length = 1160

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVL 762
            GL+N+GN+CY+NS LQ    I  LR Y L
Sbjct: 298 VGLSNLGNSCYMNSALQCLVHIPELRDYFL 327

>YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiquitin
            carboxyl-terminal hydrolase, ubiquitin-specific protease
            that cleaves ubiquitin-protein fusions
          Length = 754

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 32/66 (48%), Gaps = 5/66 (7%)

Query: 1223 YSLFAVFIHRGEA-SYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFS--EGNTAT 1279
            Y L  V IH G    +GHY    ++  K G W  Y+DET+  + E  V  F+   G+  T
Sbjct: 601  YELSGVVIHMGSGPQHGHYVCICRNE-KFG-WLLYDDETVESIKEETVLQFTGHPGDQTT 658

Query: 1280 PYFLVY 1285
             Y L Y
Sbjct: 659  AYVLFY 664

 Score = 37.0 bits (84), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVLDY 764
           G  N GNTCY NS+LQ  ++I   R  VL Y
Sbjct: 135 GYENFGNTCYCNSVLQCLYNIPEFRCNVLRY 165

>TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1.137
           YJL197W
          Length = 1286

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 19/28 (67%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQY 760
            GLNN+GNTCY+NS LQ    I  +R Y
Sbjct: 398 VGLNNLGNTCYMNSALQCLAHIPPIRDY 425

>Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa] {ON}
            YMR304W (UBP15) - putative deubiquitinating enzyme
            [contig 363] FULL
          Length = 1191

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 44/95 (46%), Gaps = 24/95 (25%)

Query: 1223 YSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVF--NFSEGN---- 1276
            Y+L  V +H G+ S GHY+  IK    +  W +++D+ + +V +++ F  NF   N    
Sbjct: 439  YNLHCVLVHSGDISAGHYYAMIKPNV-TDQWFRFDDDKVWKVTKTQAFDENFGHDNLPDE 497

Query: 1277 -----------------TATPYFLVYVKQGHEQEI 1294
                               + Y LVY+++  E+++
Sbjct: 498  KLRTFTREQYQNYLIARQTSAYMLVYIREDMEEKV 532

 Score = 35.8 bits (81), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 17/28 (60%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYV 761
           G  N G TCYLNSLLQ YF     R+ V
Sbjct: 203 GFKNQGATCYLNSLLQSYFFTKLFRKMV 230

>SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa] {ON}
            similar to uniprot|P53874 Saccharomyces cerevisiae
            YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 739

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 8/68 (11%)

Query: 1221 IGYSLFAVFIHRGEA-SYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTAT 1279
            + Y L +V +H G + S GHY  + K     G W  Y+DE I ++ E ++          
Sbjct: 625  VKYQLISVVVHEGRSLSSGHYIAHCKQ--PDGSWATYDDEYINKITEKQML-----KEPG 677

Query: 1280 PYFLVYVK 1287
             Y+L+Y +
Sbjct: 678  AYYLIYTR 685

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 9/55 (16%)

Query: 717 DTGTVDASCLPAENW--------PTGLNNIGNTCYLNSLLQYYFSISSLRQYVLD 763
           D GT  +S +  +NW        P GL N G TCY N+ +Q    I S++ Y+ D
Sbjct: 339 DHGTNSSSRI-VKNWGPQLSQLKPKGLLNHGVTCYTNAAVQAMLHIPSIQHYLFD 392

>NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1201

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 20/30 (66%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVL 762
           TGL N+GNTCY+NS LQ    I   R+Y L
Sbjct: 321 TGLVNLGNTCYMNSALQCITHIPVFREYFL 350

>CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223w UBP8
          Length = 461

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 34/71 (47%), Gaps = 8/71 (11%)

Query: 1216 DDFKSIGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEG 1275
            D+  SI Y L  +  H G  + GHY  + K   ++G W K+ND  +T++ E +V      
Sbjct: 394  DEDPSILYELIGIISHTGSVNEGHYVAFCK--IENGEWFKFNDSMVTKILEKDVLK---- 447

Query: 1276 NTATPYFLVYV 1286
                 Y L Y+
Sbjct: 448  --EQAYLLFYI 456

>TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_5.18
            YMR304W
          Length = 1247

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 1223 YSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATP 1280
            Y+L  V +H G+ S GHY+  IK       W +++DE +  V + +VF+ + G    P
Sbjct: 496  YNLHGVLVHTGDISTGHYYAMIKPTTDDK-WYRFDDEKVWRVTKKQVFDENFGLNRLP 552

 Score = 35.0 bits (79), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 16/29 (55%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYV 761
            G  N G TCYLNSLLQ YF     R  V
Sbjct: 259 VGFRNQGATCYLNSLLQSYFFTKYFRDLV 287

>KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1252

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 20/29 (68%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVL 762
           GL+N+GNTCY+NS LQ    I  L +Y L
Sbjct: 340 GLSNLGNTCYMNSALQCLLHIPELNEYFL 368

>AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL156W
           (UBP7) and YKR098C (UBP11)
          Length = 1169

 Score = 38.5 bits (88), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVL 762
           TGL N+ NTCY+NS+LQ  FS +  R   L
Sbjct: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFL 775

>NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON}
           Anc_7.390
          Length = 729

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (70%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVLDY 764
           G  N GNTCY NS+LQ  ++++ LR  +L+Y
Sbjct: 138 GYENFGNTCYCNSVLQCLYNLTELRLNLLEY 168

>KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1196

 Score = 38.5 bits (88), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 48/108 (44%), Gaps = 24/108 (22%)

Query: 1210 KISHQFDDFKSIGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEV 1269
            K S Q  + ++  Y+L  V +H G+ S GHY+  I+    S  W +++D+ +  V + + 
Sbjct: 428  KGSEQLSNKEACIYNLHGVLVHAGDISTGHYYTMIRPGV-SDEWYRFDDDKVWRVTKKQA 486

Query: 1270 FNFSEG-----------------------NTATPYFLVYVKQGHEQEI 1294
            F+ + G                          + Y LVY+++  EQE+
Sbjct: 487  FDENFGLDRLIDDQIRNMTREQYQDYILARHTSAYMLVYLRKDKEQEL 534

 Score = 35.8 bits (81), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 17/29 (58%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYV 761
            G  N G TCYLNSLLQ YF     R+ V
Sbjct: 203 VGFKNQGATCYLNSLLQSYFFTKYFRRLV 231

>KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 861

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 2/41 (4%)

Query: 730 NWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLD--YRNTV 768
           N+  GL N+GN+CY+N ++Q       L Q  LD  Y+N V
Sbjct: 492 NFTVGLTNLGNSCYMNCIIQCLLGTHELTQIFLDDSYKNHV 532

>NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {ON}
           Anc_7.390 YBL067C
          Length = 846

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQEYASRRI 782
           G  N GNTCY NS+LQ  +++   R  +L+Y + + H   N E  +RRI
Sbjct: 173 GYENFGNTCYCNSVLQCLYNLYEFRLNMLEYSDHLPHNYANIE--NRRI 219

>KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 974

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVL 762
           TGL NIG TCY+NS+LQ  F+  + R   L
Sbjct: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFL 585

>KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 756

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 8/68 (11%)

Query: 1221 IGYSLFAVFIHRGEA-SYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTAT 1279
            + Y L +V +H G + + GHY  + K     G W  Y+DE I ++ E ++          
Sbjct: 646  VKYQLISVVVHEGRSLTSGHYIAHCKQ--PDGSWSTYDDEYINKISERQML-----KEPG 698

Query: 1280 PYFLVYVK 1287
             Y+LVY +
Sbjct: 699  AYYLVYTR 706

>Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [3501
            bp, 1166 aa] {ON} ANNOTATED BY YGOB -
          Length = 1166

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 40/95 (42%), Gaps = 24/95 (25%)

Query: 1223 YSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATP-- 1280
            Y L  V +H G+ S GHY+  I+     G W +++D+ + +  + +VF  + G    P  
Sbjct: 431  YILHGVLVHSGDISTGHYYAMIQPD-AHGSWYRFDDDRVIKATDKQVFEENFGKAKLPDD 489

Query: 1281 ---------------------YFLVYVKQGHEQEI 1294
                                 Y LVY+++  E+ I
Sbjct: 490  EIQGFTKDEYQNYLLARQTSAYMLVYIRKDMEESI 524

>CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {ON}
            some similarities with uniprot|P39967 Saccharomyces
            cerevisiae YER098w UBP9 or uniprot|P38187 Saccharomyces
            cerevisiae YBL067c UBP13
          Length = 724

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 44/92 (47%), Gaps = 6/92 (6%)

Query: 1198 SQLYHNIT-QLESKISHQFDDFKSIGYSLFAVFIHRGEA-SYGHYWIYIKDRYKSGIWRK 1255
            S+L++ I   L   +   FD+     Y L  V +H G + ++GHY + I    K G W  
Sbjct: 557  SKLFNKIEYPLTLTVCSCFDNSLCKTYELTGVVLHVGASPTHGHY-VSICKHEKYG-WLM 614

Query: 1256 YNDETITEVPESEVFNF--SEGNTATPYFLVY 1285
            Y+DETI  +PE  V +      N  T Y L Y
Sbjct: 615  YDDETIESIPEEAVTSHVGEPNNPITAYVLFY 646

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 10/73 (13%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVLDY--------RNTVQHF--LNNQEYASRRIG 783
           G  N G+TCY NS+LQ  +++   R+ +L +        R  V+ F  L+ + Y +  +G
Sbjct: 122 GYENFGHTCYCNSVLQCIYNLPEFRKSILQFPQRYPLKSRVRVEEFHSLHERNYINEVVG 181

Query: 784 GREITEAEVERSV 796
            +E     +  SV
Sbjct: 182 QQEQEAISINESV 194

>KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {ON}
           Anc_7.390 YBL067C
          Length = 753

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVLDY 764
           G  N GNTCY NS+LQ  F+++  R  +L +
Sbjct: 115 GYENFGNTCYCNSILQCLFNLTEFRNSILQF 145

 Score = 36.2 bits (82), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 6/77 (7%)

Query: 1199 QLYHNIT-QLESKISHQFDDFKSIGYSLFAVFIHRGEA-SYGHYWIYIK-DRYKSGIWRK 1255
            +L++ IT  L  +++ +FD   S  Y L  V +H G    +GHY    K D +    W  
Sbjct: 570  KLFNKITYPLFLEVASKFDPSVSKKYELTGVVLHMGGGPQHGHYVSVCKTDNFG---WLF 626

Query: 1256 YNDETITEVPESEVFNF 1272
            ++DET+  + E +V NF
Sbjct: 627  FDDETVETLDEPQVLNF 643

>TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {ON}
           Anc_7.390 YBL067C
          Length = 715

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVLDY 764
           G  N GNTCY NS+LQ  ++I  LR  V+ Y
Sbjct: 113 GYENFGNTCYCNSVLQCLYNIPELRDNVIKY 143

>AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL197W
           (UBP12)
          Length = 1287

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 19/29 (65%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVL 762
           GL+N+GNTCY+NS LQ    I   + Y L
Sbjct: 347 GLSNLGNTCYMNSALQCLLHIPEFKDYFL 375

>YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}
            UBP10Ubiquitin-specific protease that deubiquitinates
            ubiquitin-protein moieties; may regulate silencing by
            acting on Sir4p; involved in posttranscriptionally
            regulating Gap1p and possibly other transporters;
            primarily located in the nucleus
          Length = 792

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 8/68 (11%)

Query: 1221 IGYSLFAVFIHRGEA-SYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTAT 1279
            + Y L +V +H G + S GHY  + K     G W  Y+DE I  + E +V    E N   
Sbjct: 672  VKYQLLSVVVHEGRSLSSGHYIAHCKQ--PDGSWATYDDEYINIISERDV--LKEPNA-- 725

Query: 1280 PYFLVYVK 1287
             Y+L+Y +
Sbjct: 726  -YYLLYTR 732

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 9/55 (16%)

Query: 717 DTGTVDASCLPAENW--------PTGLNNIGNTCYLNSLLQYYFSISSLRQYVLD 763
           D G+++++ +  +NW        P GL N G TCY N+ +Q    I S++ Y+ D
Sbjct: 339 DRGSLNSTRI-VKNWGDKFTNLKPRGLLNHGVTCYTNAAVQAMLHIPSIQHYLFD 392

>Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {ON}
           YKR098C (REAL)
          Length = 724

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 38/87 (43%), Gaps = 17/87 (19%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQEYASRRIGGREITEAEV 792
           TGL N  NTCY+NS++Q  FS +  R   L  +  +  FL N++Y               
Sbjct: 296 TGLRNPCNTCYINSMVQCLFSTTLFRDLFLTKKYKL--FLENEKYP-------------- 339

Query: 793 ERSVQFVYQLRDLFDSMIHAQDRCVTP 819
            + +Q  + +  LF  M     R + P
Sbjct: 340 -KGLQLSHSIYVLFKKMYLNGGRAIIP 365

>KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 446

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 29/67 (43%), Gaps = 8/67 (11%)

Query: 1220 SIGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTAT 1279
            +I Y L  V  H+G    GHY    K   + G W K+ND  +T V E +V          
Sbjct: 386  NIAYDLLNVVSHQGTVDQGHYTTVSKT--EDGQWFKFNDSVVTSVTEEQVLE------QQ 437

Query: 1280 PYFLVYV 1286
             Y L Y+
Sbjct: 438  AYLLFYI 444

>Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {ON}
           complement(95235..97373) [2139 nt, 713 aa]
          Length = 712

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 21/29 (72%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVL 762
           GL N GNTCY NS+LQ  ++++  R+ +L
Sbjct: 132 GLENFGNTCYCNSILQCLYNMNEFRENIL 160

 Score = 36.6 bits (83), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 42/89 (47%), Gaps = 5/89 (5%)

Query: 1210 KISHQFDDFKSIGYSLFAVFIHRG-EASYGHYWIYIKDRYKSGIWRKYNDETITEVPESE 1268
            K+S  FD+  S  Y L  + +H G    +GHY    K       W  ++DET+  + E  
Sbjct: 561  KVSSTFDESVSKDYELGGLVVHIGIGPQHGHYISVCKTSDYG--WLLFDDETVECISEDT 618

Query: 1269 VFNF-SEGNTA-TPYFLVYVKQGHEQEIE 1295
            V +F  + N+A T Y L Y +    + +E
Sbjct: 619  VLSFVGDSNSAGTAYVLFYKEINSSRNVE 647

>KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {ON}
            Anc_7.390 YBL067C
          Length = 776

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 44/94 (46%), Gaps = 4/94 (4%)

Query: 1212 SHQFDDFKSIGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFN 1271
            S  FD   S  Y L  V +H G   +  +++ +      G W  ++DET+  V ES V +
Sbjct: 600  SSTFDSSVSKSYRLQGVVVHMGNGPHHGHYVSLCHTELFG-WLLFDDETVESVDESYVLD 658

Query: 1272 F--SEGNTATPYFLVYVK-QGHEQEIEPLKRVLE 1302
            F  S  +  T Y L Y +  G E+ ++ +  V E
Sbjct: 659  FVGSHESPTTAYVLFYSEIDGSERAVQEIPAVYE 692

 Score = 37.0 bits (84), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVLDY 764
           G  N GNTCY NS+LQ  + +   R  VL+Y
Sbjct: 162 GYENFGNTCYCNSVLQCLYHLPEFRLRVLEY 192

>KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.742
            YMR223W
          Length = 440

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 29/61 (47%), Gaps = 2/61 (3%)

Query: 1210 KISHQFDDFKSIGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEV 1269
            K  H  ++  SI Y L  V  H G  + GHY   +K    S  W K+ND  +T + E EV
Sbjct: 367  KYCHTEENNSSIIYELNGVISHIGTVNEGHYIATLK--LDSNNWFKFNDSMVTSISEEEV 424

Query: 1270 F 1270
             
Sbjct: 425  L 425

>KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1189

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 1223 YSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATP 1280
            Y+L  V +H GE S GHY+  IK       W +++D+ +  V + + F+ + G+   P
Sbjct: 439  YNLHGVLVHSGEISVGHYYAMIKPDVGDQ-WFRFDDDKVWRVTKEQAFDENFGHEPLP 495

 Score = 37.0 bits (84), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 18/28 (64%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYV 761
           GL N G TCYLNSLLQ YF     R+ V
Sbjct: 203 GLKNQGATCYLNSLLQSYFFTKLFRKIV 230

 Score = 33.9 bits (76), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 89/206 (43%), Gaps = 28/206 (13%)

Query: 927  VTKADSGSSSNNSNKAVAMNTSTRVAKISSDQLENALEMGR-----------QQDVTECI 975
            V K  S + S N +  +A+  S  + + S++ L + LE+ R           Q DV E  
Sbjct: 230  VYKIPSENESPNDSVLLALQRSFYLLQKSNETL-DTLELTRSFGWDTGDAFTQHDVQELN 288

Query: 976  GNVLFQLESASDPISLGDDNEQNDLVKQLFYGNIKQNIIPLKDETQVRTKYERFLSLLVN 1035
              ++ +LE+           E    + +LF G +K  I  +  + +  ++ E F  + +N
Sbjct: 289  RILMDRLETRMK------GTEVEGALNELFVGKMKSYIRCINVDYE-SSRVEDFWDIQLN 341

Query: 1036 IGDHPKDIYDALDLYFRDEYLKLE------EYG--DVKRTVAVTDFPTILQIQIQRVYYD 1087
            + +  K + ++ D Y   E +  E      +YG  D K+ V    FP++L +Q++R  YD
Sbjct: 342  VKN-LKGVQESFDNYVEVEIMDGENQYAAQDYGLQDAKKGVVFESFPSVLHLQLKRFEYD 400

Query: 1088 RERFMPFKSVAPLPFNETIYMDRYSD 1113
                   K      F ETI +  Y D
Sbjct: 401  FNYDQLVKINDRYEFPETIDLSPYLD 426

>CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} similar to
            uniprot|P38187 Saccharomyces cerevisiae YBL067c UBP13 or
            uniprot|P39967 Saccharomyces cerevisiae YER098w UBP9
            ubiquitin carboxyl-terminal hydrolase
          Length = 770

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 47/90 (52%), Gaps = 4/90 (4%)

Query: 1207 LESKISHQFDDFKSIGYSLFAVFIHRGEA-SYGHYWIYIKDRYKSGIWRKYNDETITEVP 1265
            L+ K+S  F+   S  Y L  + +H G    +GHY    K+  K G W  ++DET+  + 
Sbjct: 597  LDLKVSSTFNPSISKNYELSGIVVHMGGGPQHGHYISLCKNE-KFG-WLLFDDETVEAIS 654

Query: 1266 ESEVFNFS-EGNTATPYFLVYVKQGHEQEI 1294
            E  V  ++ + +T T  ++++ ++  ++ I
Sbjct: 655  EQAVLQYTGDKDTMTTAYVLFYQESQKEGI 684

 Score = 35.0 bits (79), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVLDY 764
           G  N GNTCY NS+LQ  +++   R  +L Y
Sbjct: 151 GYENFGNTCYCNSVLQCLYNLPEFRNDMLRY 181

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156w UBP7
          Length = 1081

 Score = 37.7 bits (86), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 20/26 (76%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLR 758
           TGL N+GNTCY+N +LQ  F+ + L+
Sbjct: 648 TGLRNLGNTCYINCMLQSLFATNELK 673

>YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON}
           UBP11Ubiquitin-specific protease that cleaves ubiquitin
           from ubiquitinated proteins
          Length = 717

 Score = 37.4 bits (85), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 45/102 (44%), Gaps = 17/102 (16%)

Query: 722 DASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQEYASRR 781
           D++ L +E   TGL N  NTCY+NS++Q  F  +  R   L  +  +  FLN  +Y    
Sbjct: 287 DSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRL--FLNTNKYPK-- 342

Query: 782 IGGREITEAEVERSVQFVYQLRDLFDSMIHAQDRCVTPRKEL 823
                  E ++ RS+        LF  M     R + P + L
Sbjct: 343 -------EVQLSRSIYV------LFKKMYLNGGRAIIPNRFL 371

>TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {ON}
           Anc_7.390 YBL067C
          Length = 1171

 Score = 37.4 bits (85), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 22/31 (70%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVLDY 764
           G  N GNTCY NS+LQ  +++++LR  +L +
Sbjct: 517 GYENFGNTCYCNSVLQCLYNMTNLRTNILQF 547

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 37.4 bits (85), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 1/67 (1%)

Query: 688 FDADQFLKLKGALSKIGFERNSKLISHFIDTGTVDASCL-PAENWPTGLNNIGNTCYLNS 746
           FD    L  +  L+++  E+N        D+   +   L P  N+  GL N+GN+CYLNS
Sbjct: 273 FDLHNKLATEKTLTELQVEQNLNWDFKMTDSAGHELIKLEPNGNFGCGLINLGNSCYLNS 332

Query: 747 LLQYYFS 753
           +LQ  F+
Sbjct: 333 ILQALFA 339

>AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YMR304W (UBP15)
          Length = 1166

 Score = 37.4 bits (85), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 40/95 (42%), Gaps = 24/95 (25%)

Query: 1223 YSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVF------------ 1270
            Y+L  V +H G+ S GHY+  IK   +   W +++D+ +  V + +VF            
Sbjct: 427  YNLHGVLVHTGDISTGHYYAMIKPGLEDA-WYRFDDDKVWRVTKKQVFEQNFGFDKLSEY 485

Query: 1271 -----------NFSEGNTATPYFLVYVKQGHEQEI 1294
                       N+      + Y LVY+++  E  I
Sbjct: 486  DLRSLTKEQYQNYLIARQTSAYMLVYIREDMESTI 520

 Score = 35.8 bits (81), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 18/29 (62%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYV 761
            GL N G TCYLNSLLQ Y+     R+ V
Sbjct: 190 VGLKNQGATCYLNSLLQSYYFTKYFRKLV 218

>TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1186

 Score = 37.4 bits (85), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 45/106 (42%), Gaps = 26/106 (24%)

Query: 1223 YSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATP-- 1280
            Y L  V +H G+ S GHY+  IK   K   W +++D+ +    + ++F+ + G    P  
Sbjct: 440  YKLHGVLVHTGDISTGHYYTLIKPSTKDE-WYRFDDDRVWRATKKQIFDDNFGFDRLPDE 498

Query: 1281 ---------------------YFLVYVKQGHEQEIEPLKRVLEVTV 1305
                                 Y LVY+ +  E+EI  L+ V E  V
Sbjct: 499  KIRTMTREQYQDYLIQRHTNAYMLVYIAEEKEEEI--LQPVTEADV 542

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 17/29 (58%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYV 761
            G  N G TCYLNSLLQ Y+     R+ V
Sbjct: 203 VGFRNQGATCYLNSLLQSYYFTKYFRRLV 231

>YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}
            UBP8Ubiquitin-specific protease that is a component of
            the SAGA (Spt-Ada-Gcn5-Acetyltransferase) acetylation
            complex; required for SAGA-mediated deubiquitination of
            histone H2B
          Length = 471

 Score = 37.4 bits (85), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 1221 IGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVF 1270
            I Y L  +  H+G  + GHY  + K     G W K+ND  ++ + + EV 
Sbjct: 409  IIYELIGIVSHKGTVNEGHYIAFCK--ISGGQWFKFNDSMVSSISQEEVL 456

>KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 771

 Score = 37.4 bits (85), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 41/79 (51%), Gaps = 11/79 (13%)

Query: 1221 IGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATP 1280
            + Y L +V +H G  +YGHY  + + R   G W + +DE++  V E EV        +TP
Sbjct: 679  LTYVLRSVIVHYGTHNYGHYIAFRRFR---GCWWRISDESVYIVDEQEVL-------STP 728

Query: 1281 -YFLVYVKQGHEQEIEPLK 1298
              F+++ +  ++ E   +K
Sbjct: 729  GVFMLFYEYDYDTETGKMK 747

 Score = 32.3 bits (72), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 44/108 (40%), Gaps = 32/108 (29%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQY----VLDYRNTVQHFLN---------------- 773
           GL N GNTC++NS+LQ   S   L ++    +LD  +  Q+ ++                
Sbjct: 85  GLVNDGNTCFMNSVLQCLASSKELHKFMDTIILDSNDDSQNTIDENGEESDLPNEQSTVE 144

Query: 774 -------NQEYASR-----RIGGREITEAEVERSVQFVYQLRDLFDSM 809
                  N+ Y  R     R    E+ +   E ++ F   L+DLF  +
Sbjct: 145 KKPKATKNKTYGKRKKIAVRQADNELLKNSTEPNMHFTLALQDLFSKL 192

>Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223W
            (REAL)
          Length = 473

 Score = 37.0 bits (84), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 1221 IGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVF 1270
            I Y L  +  H+G  + GHY  + K     G W K+ND  ++ + + EV 
Sbjct: 411  IIYELIGIVSHKGTVNEGHYIAFCK--ISGGQWFKFNDSMVSSISQEEVL 458

>NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742
          Length = 466

 Score = 37.0 bits (84), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 78/188 (41%), Gaps = 36/188 (19%)

Query: 968  QQDVTECIGNVLFQLESASDPISLGDDNEQND--LVKQLFYGNIKQNIIPLKDETQVRTK 1025
            QQD  E +   L QL       S  ++ E N   +   +F G +K +I+  + +   +T 
Sbjct: 241  QQDAHEFLQYFLNQLHQDYKRDSSHNEQENNCPCVAHSIFQGELKSSIVCPECQNDSKTI 300

Query: 1026 YERFLSLLVNIGDHPKDIYDALDLYFRDEYLKLEEYG----------DVKRTVAVTDFPT 1075
             + F+ L ++I D   D+Y  LD + + E  KL ++           D  +   +   P 
Sbjct: 301  IDPFMDLSLDIKD-KTDLYQCLDSFHKKE--KLHDFNYHCSRCNTSLDPIKQFTINKLPP 357

Query: 1076 ILQIQIQRVYYDRERFMPFKSVA-------PLPFNETIYMDRYSDTNNPVLINRKRETEK 1128
            +L +Q++R     E F+   +V        PL  N   Y DR          N  +ET  
Sbjct: 358  MLVLQLKRF----EHFVNGTNVKLNEFVQYPLYLNMRDYCDR----------NTNQETPD 403

Query: 1129 LVQELNGL 1136
            ++ EL G+
Sbjct: 404  IIYELTGI 411

 Score = 33.9 bits (76), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 1221 IGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVF 1270
            I Y L  +  H G  + GHY + +K     G W K+ND  I+ + E E  
Sbjct: 404  IIYELTGILSHIGSINEGHYVVVLK--INDGRWFKFNDSMISVIKEDEAL 451

>KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 697

 Score = 37.4 bits (85), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVLDY 764
           G  N GNTCY NS+LQ  ++++  R  +L Y
Sbjct: 116 GYENFGNTCYCNSVLQCLYNLTEFRTEILKY 146

>Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON}
           similar to Ashbya gossypii AFR627C
          Length = 1264

 Score = 37.4 bits (85), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%)

Query: 726 LPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVL 762
           +   N   GL N+GNTCY+NS LQ    I   + Y L
Sbjct: 342 MTPSNGTVGLGNLGNTCYMNSALQCLVHIPEFKDYFL 378

>SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa]
           {ON} uniprot|Q875P1 Saccharomyces kluyveri UBP7
          Length = 1037

 Score = 37.4 bits (85), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVL 762
           TGL N+G+TCY+NS+LQ  F+    R   L
Sbjct: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFL 642

>Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 37.4 bits (85), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 36/67 (53%), Gaps = 2/67 (2%)

Query: 699 ALSKIGFERNSKLISHFIDTGTVDASCLPAEN-WPTGLNNIGNTCYLNSLLQYYFSISSL 757
            L ++  E+N       +D+   +   LPA N +  GL N+GN+CYLNS++Q   +   +
Sbjct: 288 TLVQLQIEQNENWQFKMVDSSGKELKKLPASNEYGCGLINLGNSCYLNSVMQSLLN-GGV 346

Query: 758 RQYVLDY 764
             + LD+
Sbjct: 347 PSWSLDF 353

>CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197w UBP12
           ubiquitin C-terminal hydrolase
          Length = 1147

 Score = 37.4 bits (85), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQY 760
           GL+N+GNTCY+NS LQ    I  LR Y
Sbjct: 290 GLSNLGNTCYMNSGLQCLVHIPKLRDY 316

>NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {ON}
            Anc_8.742
          Length = 493

 Score = 37.0 bits (84), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 1223 YSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVF 1270
            Y L ++  H+G  + GHY + +K     G W K+ND  ++ + E E  
Sbjct: 433  YELTSIISHKGTVNEGHYIVVVK--VNDGQWFKFNDSMVSAITEEEAL 478

>NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1253

 Score = 37.4 bits (85), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 18/29 (62%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVL 762
           GL N+GNTCY+NS LQ    I   R Y L
Sbjct: 331 GLTNLGNTCYMNSALQCITHIPIFRDYFL 359

>Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 37.0 bits (84), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 1221 IGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVF 1270
            I Y L  +  H+G  + GHY  + K     G W K+ND  ++ + + EV 
Sbjct: 409  IIYELIGIVSHKGTVNEGHYIAFCK--ISGGQWFKFNDSMVSSISQEEVL 456

>Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON}
            (248094..250361) [2268 nt, 756 aa]
          Length = 755

 Score = 37.0 bits (84), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 41/91 (45%), Gaps = 6/91 (6%)

Query: 1199 QLYHNIT-QLESKISHQFDDFKSIGYSLFAVFIHRGEA-SYGHYWIYIKDRYKSGIWRKY 1256
            +L++ IT   E  +   FD   S  Y L  + IH G    +GHY    K   K G W  Y
Sbjct: 571  KLFNKITYPSELHVRSTFDRSISKKYELSGIIIHLGAGPQHGHYVAMCKTE-KFG-WLLY 628

Query: 1257 NDETITEVPESEVFNF--SEGNTATPYFLVY 1285
            +DET+  V E +V        + AT Y L Y
Sbjct: 629  DDETVEAVLEKDVLRHVGDSNDLATAYILFY 659

 Score = 36.2 bits (82), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVLDY 764
           G  N GNTCY NS+LQ  ++ S LR  ++ Y
Sbjct: 128 GFENFGNTCYCNSVLQCLYNFSELRDNLILY 158

>SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 754

 Score = 37.0 bits (84), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVLDY 764
           G  N GNTCY NS+LQ  ++++  R  VL Y
Sbjct: 147 GYENFGNTCYCNSVLQCLYNLTEFRLNVLQY 177

>CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {ON}
           similar to uniprot|P32571 Saccharomyces cerevisiae
           YDR069c DOA4 ubiquitin-specific protease
          Length = 947

 Score = 37.0 bits (84), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 730 NWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLN-NQEYASRRIGGR 785
           N+  GL N+GN+CY+N +LQ     + L Q  L+  N+ +  +N N +  S+ +  R
Sbjct: 580 NFTVGLENMGNSCYMNCILQCIMGTNELSQIFLN--NSYEKHININSKLGSKGVLAR 634

>KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1.137
           YJL197W
          Length = 1231

 Score = 37.0 bits (84), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 20/29 (68%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVL 762
           GL+N+GNTCY+NS LQ    I  +R Y +
Sbjct: 322 GLSNLGNTCYMNSGLQCLVHIPQIRDYFV 350

>ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156W UBP7 Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1044

 Score = 37.0 bits (84), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLR 758
           TGL N+G TCY+NS+LQ  F+ +  R
Sbjct: 599 TGLRNLGATCYINSMLQCLFATNMFR 624

>SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1297

 Score = 36.6 bits (83), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 21/29 (72%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVL 762
           GL N+G+TC++NS+LQ    I+ LR Y L
Sbjct: 352 GLANLGSTCHINSVLQCLTHITELRDYFL 380

>YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}
           DOA4Ubiquitin isopeptidase, required for recycling
           ubiquitin from proteasome-bound ubiquitinated
           intermediates, acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 926

 Score = 36.6 bits (83), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 42/108 (38%), Gaps = 26/108 (24%)

Query: 714 HFIDTGTVDASCLPAEN--------------------WPTGLNNIGNTCYLNSLLQYYFS 753
           H   T T+  SCL   N                    +  GL N+GN+CY+N ++Q    
Sbjct: 523 HSSATSTIQPSCLSLSNNDSLDHTDVTPTSSHNYDLDFAVGLENLGNSCYMNCIIQCILG 582

Query: 754 ISSLRQYVLDYRNTVQHFLNNQEYASRRIGGREITEAEVERSVQFVYQ 801
              L Q  LD  ++    +N     + ++G + I      R V  +Y+
Sbjct: 583 THELTQIFLD--DSYAKHIN----INSKLGSKGILAKYFARLVHMMYK 624

>Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {ON}
           YKR098C (REAL)
          Length = 712

 Score = 36.6 bits (83), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 12/97 (12%)

Query: 706 ERNSKLISHFIDTGTV-DASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDY 764
           E  S  IS   +  T+ D+  L ++   TGL N  NTCY+NS++Q  F  +  R   L  
Sbjct: 264 EAASSFISETFEPPTIEDSKGLLSKLSITGLQNPCNTCYINSIIQCLFGSTPFRDLFLTK 323

Query: 765 RNTVQHFLNNQEYASRRIGGREITEAEVERSVQFVYQ 801
           +  +  FL  +EY           E ++ RS+  +++
Sbjct: 324 KYRL--FLKTEEYPK---------EVQLSRSIYSLFK 349

>SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 454

 Score = 36.2 bits (82), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 1220 SIGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVF 1270
            +I Y L  +  H+G  + GHY    K     G W K+ND  +T V E +V 
Sbjct: 391  AIVYELIGLISHQGSVNQGHYTSICK--IPGGQWFKFNDSMVTAVAEIDVL 439

>NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON} 
          Length = 1116

 Score = 36.2 bits (82), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 16/67 (23%), Positives = 35/67 (52%), Gaps = 6/67 (8%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQEYASRRIGGREITEAEVE 793
           GL N+GN+CYLN ++Q       L +  L+Y  + + ++N     + ++G + +    + 
Sbjct: 748 GLQNMGNSCYLNCIIQCLLGTHELTKIFLNY--SFERYIN----LNSKLGSKGVLAKNLS 801

Query: 794 RSVQFVY 800
           + +  +Y
Sbjct: 802 KLIHLMY 808

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
           weakly similar to uniprot|P36026 Saccharomyces
           cerevisiae YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score = 36.2 bits (82), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (65%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVL 762
           G+ N+GNTCY+NS+LQ  F  +  R   L
Sbjct: 214 GIRNMGNTCYMNSMLQCLFGSTQFRDLFL 242

>YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}
           UBP5Putative ubiquitin-specific protease, closest
           paralog of Doa4p but has no functional overlap;
           concentrates at the bud neck
          Length = 805

 Score = 35.8 bits (81), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 2/41 (4%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLN 773
            GL NIGN CY+N +LQ       L +  LD  NT  +F+N
Sbjct: 446 VGLENIGNCCYMNCILQCLVGTHDLVRMFLD--NTYLNFIN 484

>Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {ON}
           complement(57514..60162) [2649 nt, 883 aa]
          Length = 882

 Score = 35.8 bits (81), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 35/68 (51%), Gaps = 6/68 (8%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQEYASRRIGGREITEAEVE 793
           GL N+GN+CY+N ++Q   S   L Q  L+  N+ +  +N     + ++G + +      
Sbjct: 520 GLENMGNSCYMNCIIQCLLSTHELSQIFLN--NSYEKHIN----LNSKLGSKGVLAKYFA 573

Query: 794 RSVQFVYQ 801
           R V  +Y+
Sbjct: 574 RLVHTMYR 581

>KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {ON}
           some similarities with uniprot|P39967 Saccharomyces
           cerevisiae YER098W UBP9 Ubiquitin-specific protease that
           cleaves ubiquitin-protein fusions
          Length = 714

 Score = 35.4 bits (80), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVLDY 764
           G  N GNTCY NS+LQ  +++  LR  +L++
Sbjct: 144 GYENFGNTCYCNSVLQVIYNLPELRVNLLEF 174

>KLTH0E10626g Chr5 (957868..959472) [1605 bp, 534 aa] {ON} similar to
            uniprot|Q03776 Saccharomyces cerevisiae YDR235W PRP42 U1
            snRNP protein involved in splicing required for U1 snRNP
            biogenesis contains multiple tetriatricopeptide repeats
          Length = 534

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 53/114 (46%), Gaps = 14/114 (12%)

Query: 1149 LGLSRKGALIETSNFLKSDVLETQGIQIDNRTG-LAQELDNIVLGIN--DELSQLYHNIT 1205
            + L     L++  +F+ +  +  QG++I ++   + + L  I+L I    EL QLY+ I 
Sbjct: 312  IWLKYASWLVQHQDFVSAKTVLLQGLRISHKKAKIIERLSTIMLKIGHYSELIQLYNEIQ 371

Query: 1206 QLESKISHQFDDFK-SIGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYND 1258
             +  +   + DD++    Y LF  F+ +           I D +K+G  R + D
Sbjct: 372  NVYGEKIEELDDYELFFDYFLFTAFLEKS----------INDNFKAGCVRSHID 415

>Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON}
           YER144C (REAL)
          Length = 788

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLN 773
            GL N+GN CY+N +LQ       L +  LD  NT  +F+N
Sbjct: 429 VGLENMGNCCYMNCILQCLVGTHDLTRMFLD--NTYLNFIN 467

>Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON}
           YDR069C (REAL)
          Length = 926

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 35/72 (48%), Gaps = 6/72 (8%)

Query: 730 NWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQEYASRRIGGREITE 789
           ++  GL N+GN+CY+N ++Q       L Q  LD  ++    +N     + ++G + I  
Sbjct: 559 DFAVGLENLGNSCYMNCIIQCILGTHELTQIFLD--DSYAKHIN----INSKLGSKGILA 612

Query: 790 AEVERSVQFVYQ 801
               R V  +Y+
Sbjct: 613 KYFARLVHMMYK 624

>Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 26/39 (66%), Gaps = 1/39 (2%)

Query: 726 LPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDY 764
           LP +++  GL N+GN+CYLNS+LQ   +   +  + LD+
Sbjct: 316 LPNKDYGCGLINLGNSCYLNSVLQSLLN-GGVPNWSLDF 353

>Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] {ON}
            YMR223W (UBP8) - putative deubiquitinating enzyme [contig
            70] FULL
          Length = 454

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 25/64 (39%), Gaps = 8/64 (12%)

Query: 1223 YSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPYF 1282
            Y L AV  H G  + GHY    K     G W ++ND  I  + E E            Y 
Sbjct: 394  YELVAVISHEGSVNQGHYTSMCK--IPGGQWFRFNDSMIVSISEEEALR------QQAYL 445

Query: 1283 LVYV 1286
            L YV
Sbjct: 446  LFYV 449

>Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar to
            Ashbya gossypii AFR551W
          Length = 466

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 26/64 (40%), Gaps = 8/64 (12%)

Query: 1223 YSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPYF 1282
            Y L A+  H G    GHY      R    IW K+ND  +T + E ++           Y 
Sbjct: 409  YKLSAIISHHGTVHQGHYTTIC--RINGDIWAKFNDSMVTVISEEDMLK------EQAYL 460

Query: 1283 LVYV 1286
            L YV
Sbjct: 461  LYYV 464

>Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON}
           YDR069C (REAL)
          Length = 927

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 35/72 (48%), Gaps = 6/72 (8%)

Query: 730 NWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQEYASRRIGGREITE 789
           ++  GL N+GN+CY+N ++Q       L Q  LD  ++    +N     + ++G + I  
Sbjct: 560 DFAVGLENLGNSCYMNCIIQCILGTHELTQIFLD--DSYAKHIN----INSKLGSKGILA 613

Query: 790 AEVERSVQFVYQ 801
               R V  +Y+
Sbjct: 614 KYFARLVHMMYK 625

>Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON}
           YER144C (REAL)
          Length = 823

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLN 773
            GL N+GN CY+N +LQ       L +  LD  NT  +F+N
Sbjct: 464 VGLENMGNCCYMNCILQCLVGTHDLTRMFLD--NTYLNFIN 502

>Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {ON}
           YBR058C (UBP14) - Ubiquitin-specific protease [contig
           183] FULL
          Length = 762

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 65/161 (40%), Gaps = 31/161 (19%)

Query: 616 IDCDRALYTIAVHSRSLALF------------NFLVQQSEEFQEYFGPDQFSYQDALSVL 663
           + C R    I  HS +L  F              L   S +   YF  D+  +QD     
Sbjct: 196 VGCGRQQVGIEGHSHALTHFEENPEHPLAVKLGSLSNTSADIYCYFCDDEVQFQDLDKWH 255

Query: 664 QVNENAGDDTILEIFQRKWYKEPVFDADQFLKLKGALSKIGFERNSKLISHFIDTGTVDA 723
            V E+ G +   ++ Q K                 +L ++  E+N+      +D+   + 
Sbjct: 256 NVLEHWGINIRDKVAQEK-----------------SLVELQVEQNASWDFQMVDSQGHEL 298

Query: 724 SCL-PAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLD 763
             L  ++ +  GL N+GN+CY+N++LQ  F+   +  + LD
Sbjct: 299 HHLRSSKRYGCGLLNLGNSCYMNAVLQVLFN-GGVSSWSLD 338

>Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON}
           YDR069C (REAL)
          Length = 929

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 35/72 (48%), Gaps = 6/72 (8%)

Query: 730 NWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQEYASRRIGGREITE 789
           ++  GL N+GN+CY+N ++Q       L Q  LD  ++    +N     + ++G + I  
Sbjct: 562 DFAVGLENLGNSCYMNCIIQCILGTHELTQIFLD--DSYAKHIN----INSKLGSKGILA 615

Query: 790 AEVERSVQFVYQ 801
               R V  +Y+
Sbjct: 616 KYFARLVHMMYK 627

>TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8.188
           YDR069C
          Length = 1144

 Score = 35.4 bits (80), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 6/68 (8%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQEYASRRIGGREITEAEVE 793
           GL N+GN+CYLN ++Q   +   L +  L+  N+ +  +N     + ++G + I      
Sbjct: 736 GLENMGNSCYLNCIIQCLLNNHELTKMFLN--NSYEKHIN----INSKLGSKGILAKSFA 789

Query: 794 RSVQFVYQ 801
           R V  +YQ
Sbjct: 790 RLVHSMYQ 797

>ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 813

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVLDY 764
           G  N GNTCY NS+LQ  ++++  R  +L +
Sbjct: 132 GFENFGNTCYCNSVLQCLYNMTEFRIQMLQH 162

>NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {ON}
            Anc_7.390 YBL067C
          Length = 827

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 7/67 (10%)

Query: 1223 YSLFAVFIHRGEA-SYGHYWIYIK-DRYKSGIWRKYNDETITEVPESEVFNF--SEGNTA 1278
            Y L  + +H G +   GHY    K D+Y    W  ++DET + + E EV +F   E +  
Sbjct: 672  YKLQGIVVHMGSSPQQGHYVAICKTDKYG---WLLFDDETASWINEEEVLSFIGDEKSQN 728

Query: 1279 TPYFLVY 1285
            T Y L Y
Sbjct: 729  TAYVLFY 735

 Score = 33.9 bits (76), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 56/140 (40%), Gaps = 18/140 (12%)

Query: 980  FQLESASDPISLGDDNEQND-LVKQLFYGNIKQNIIPLKDETQVRTKYERFLSLLVNIGD 1038
            F +   SD I     N Q+D  + + F G I  N I       V ++ E FL   + + +
Sbjct: 521  FLINQLSDYIQTDCANPQDDNFINESFQG-ILTNRIKCLSCDNVTSRDEPFLDFPIEVQE 579

Query: 1039 HPK--DIYDALDLYFRDEYL---------KLEEYGDVKRTVAVTDFPTILQIQIQRVYYD 1087
            H +  DI   L  Y + E L         +     + +RTV +   P  L + ++R  Y 
Sbjct: 580  HKEFTDISTILKSYHQKEMLGGHNKFYCSQCCTLQEAQRTVGLKKLPNTLALHLKRFKYS 639

Query: 1088 RERFMPFKSVAPLPFNETIY 1107
             E F   K      FN+ +Y
Sbjct: 640  EEHFTNIKL-----FNKIVY 654

>TPHA0O01640 Chr15 complement(325844..328084) [2241 bp, 746 aa] {ON}
           Anc_2.69 YNL186W
          Length = 746

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 40/85 (47%), Gaps = 22/85 (25%)

Query: 708 NSKLISHFI-------DTGTVDASCLPAENW--------PTGLNNIGNTCYLNSLLQYYF 752
           NS+++S+F        D GT   S +  +NW        P GL N G TCY N+ +Q   
Sbjct: 264 NSEILSNFYQFNEDVDDIGTNKDSRI-IKNWGPILSGLKPCGLLNHGVTCYTNAAVQAML 322

Query: 753 SISSLRQYVLDYRNTVQHFLNNQEY 777
            I +++ Y+ D         NN++Y
Sbjct: 323 HIPAIQHYLFDI------LRNNKDY 341

>CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069c DOA4
           ubiquitin-specific protease
          Length = 887

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 12/75 (16%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQEYASRRIGGREITEAEV 792
            GL N+GN+CY+N ++Q  F+ + L +  L+   T    +N Q     ++G + +     
Sbjct: 525 VGLENMGNSCYINCIIQCIFATTELIKIFLN--GTYAKHINKQS----KLGSKGVL---- 574

Query: 793 ERSVQFVYQLRDLFD 807
             S  F   L+D+++
Sbjct: 575 --SHNFAKLLKDMYE 587

>TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1462

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVL 762
           GL N+GNTCY+NS LQ    +    +Y L
Sbjct: 415 GLVNLGNTCYMNSALQCLIHLPKFNEYFL 443

>YBR136W Chr2 (505668..512774) [7107 bp, 2368 aa] {ON}  MEC1Genome
           integrity checkpoint protein and PI kinase superfamily
           member; signal transducer required for cell cycle arrest
           and transcriptional responses prompted by damaged or
           unreplicated DNA; monitors and participates in meiotic
           recombination; associates with shortened, dysfunctional
           telomeres
          Length = 2368

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 47/113 (41%), Gaps = 11/113 (9%)

Query: 286 RIPTQPDCINTLFKIFK--GPLNRKSSEEPRKTINPNNVSLNSHIDPTWLTSKYGFELHV 343
           ++PT P       K  K    L R   ++ R  I  N+   +  +    L  +Y   L V
Sbjct: 30  KVPTDPSSSQEYAKSLKILNTLIRNLKDQRRNNIMKNDTIFSKTVSALALLLEYNPFLLV 89

Query: 344 EKD-------EETGEDILEYAPPDLTNYHRDWKVRRLRESFTRRCLELIFLGR 389
            KD       +   +D L  +  +  NYHR W +RR   S+ + C+E  F G+
Sbjct: 90  MKDSNGNFEIQRLIDDFLNISVLNYDNYHRIWFMRRKLGSWCKACVE--FYGK 140

>TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {ON}
           Anc_7.390 YBL067C
          Length = 765

 Score = 34.3 bits (77), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVLDY 764
           G  N GNTCY NS+LQ  ++++  R  +L +
Sbjct: 125 GYENFGNTCYCNSVLQCLYNLTEFRLLLLQH 155

>Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 26/38 (68%), Gaps = 1/38 (2%)

Query: 727 PAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDY 764
           P++++  GL N+GN+CYLNS++Q   +   +  + LD+
Sbjct: 317 PSKDYGCGLINLGNSCYLNSVMQSLLN-GGIPNWSLDF 353

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
           YIL156W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 656

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 17/26 (65%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLR 758
            GL N GNTCY+NS++Q  F    LR
Sbjct: 238 VGLRNQGNTCYINSMVQCLFGTKVLR 263

>KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {ON}
           Anc_8.188 YDR069C
          Length = 978

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 33/67 (49%), Gaps = 6/67 (8%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQEYASRRIGGREITEAEVE 793
           GL N+GN+CY+N ++Q       L +  L+  N+ +  +N     S R+G + +      
Sbjct: 606 GLENMGNSCYMNCIIQCILGTHDLIKIFLN--NSYEKHIN----LSSRLGSKGVLAKNFA 659

Query: 794 RSVQFVY 800
           R +  +Y
Sbjct: 660 RLIHTMY 666

>Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C
           (DOA4) - ubiquitin isopeptidase [contig 424] PARTIAL
          Length = 424

 Score = 33.9 bits (76), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVLD--YRNTV 768
           GL N+GN+CY+N ++Q       L Q  LD  Y+N V
Sbjct: 57  GLVNLGNSCYMNCIIQCLLGTRELVQIFLDDSYKNHV 93

>YKL155C Chr11 complement(159456..161342) [1887 bp, 628 aa] {ON}
           RSM22Mitochondrial ribosomal protein of the small
           subunit; also predicted to be an
           S-adenosylmethionine-dependent methyltransferase
          Length = 628

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 68/154 (44%), Gaps = 11/154 (7%)

Query: 513 ALGVFQIDSKEFDPHNLNDSVLLSIYKNESASTRNPNRHAELKNSLRLLAKFKKSPKLKF 572
           +L + ++D  +F   N     +L  Y++E+AST       E    LRLL+K  +    + 
Sbjct: 21  SLNLPKLDLADFIDSNKRGINVLPSYRDETASTTQATNSKE----LRLLSKTLQGQSYRD 76

Query: 573 YADYEPYRNVTQAY--EILEVDESVDDDIIQTAYTVKVNDSPGLKIDCDRALYTIAVHSR 630
             +  P  +V++A    I+ V    +   + T Y  ++ +   L   C R    +  H  
Sbjct: 77  QLELNP--DVSKAINNNIMAVHIPNNLRRVATNYYKEIQEPNSLHRPC-RTKMEVDAHIA 133

Query: 631 SLALFNF--LVQQSEEFQEYFGPDQFSYQDALSV 662
           S+ L N+  + Q  +E Q+  GPD F  Q  L V
Sbjct: 134 SIFLQNYGSIFQSLKELQKRVGPDNFKPQRILDV 167

>KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.188
           YDR069C
          Length = 986

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 31/53 (58%), Gaps = 3/53 (5%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLN-NQEYASRRIGGR 785
           GL N+GN+CYLN ++Q     + L +  LD  N+ + ++N N +  S+ +  R
Sbjct: 621 GLENMGNSCYLNCIIQCLLGNNELIKIFLD--NSFEKYVNLNSKLGSKGVLAR 671

>KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.742
            YMR223W
          Length = 459

 Score = 33.9 bits (76), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 1220 SIGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVF 1270
            SI Y L  V  H G  + GHY   ++    SG W K+ND  I+ V   +V 
Sbjct: 393  SIVYRLSGVVSHSGTVNEGHYTAVLQ--LNSGEWFKFNDSMISVVSAEDVL 441

>Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {ON}
           YKR098C (REAL)
          Length = 721

 Score = 33.9 bits (76), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 39/80 (48%), Gaps = 11/80 (13%)

Query: 722 DASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQEYASRR 781
           D++ L ++   TGL N  NTCY+NS++Q  F  +  R   L  +  +  FL   +Y    
Sbjct: 292 DSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRL--FLQTDKYPR-- 347

Query: 782 IGGREITEAEVERSVQFVYQ 801
                  E ++ RS+  +++
Sbjct: 348 -------EVQLSRSIYVLFK 360

>ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 776

 Score = 33.9 bits (76), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 4/52 (7%)

Query: 727 PAENWPTGLNNIGNTCYLNSLLQYYFSIS----SLRQYVLDYRNTVQHFLNN 774
           P +    GL N+GN+CYLNS+LQ  F+      SL+    D+   V +  NN
Sbjct: 317 PDQEHGCGLINLGNSCYLNSVLQCLFNGGVKGWSLKGLGQDFPQDVLYPTNN 368

>TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {ON}
           Anc_3.270 YBR058C
          Length = 785

 Score = 33.9 bits (76), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 699 ALSKIGFERNSKLISHFIDTGTVDASCLPA-ENWPTGLNNIGNTCYLNSLLQYYFS 753
            L ++  E+N       +D+   +   L A +++  GL N+GN+CYLNS+LQ +++
Sbjct: 291 TLVELQVEQNMNWNFQMVDSEGKELKSLKAGDDFGVGLINLGNSCYLNSILQCFYN 346

>Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON}
           YER144C (REAL)
          Length = 805

 Score = 33.9 bits (76), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 2/41 (4%)

Query: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLN 773
            GL N GN CY+N +LQ       L +  LD  NT  +F+N
Sbjct: 446 VGLENTGNCCYMNCILQCLVGTHDLVRMFLD--NTYLNFIN 484

>TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {ON}
            Anc_8.742 YMR223W
          Length = 463

 Score = 33.5 bits (75), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 2/55 (3%)

Query: 1217 DFKSIGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFN 1271
            D   + Y L  V  H+G  + GHY    K   +   W K+ND  ++ V + E  N
Sbjct: 397  DVPDLIYELIGVVAHKGTVNEGHYVATTKVAGRQ--WFKFNDSMVSSVTQEEALN 449

>KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223W UBP8
            Ubiquitin-specific protease that is a component of the
            SAGA (Spt-Ada-Gcn5- Acetyltransferase) acetylation
            complex required for SAGA- mediated deubiquitination of
            histone H2B
          Length = 453

 Score = 33.5 bits (75), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 25/64 (39%), Gaps = 8/64 (12%)

Query: 1223 YSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPYF 1282
            Y L AV    G  + GHY    K     G W ++ND  I  + E +V           Y 
Sbjct: 393  YELVAVISQEGSVNQGHYTCMCK--VPGGQWFRFNDTMIVSITEEDVLR------QQAYL 444

Query: 1283 LVYV 1286
            L YV
Sbjct: 445  LFYV 448

>KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7.390
           YBL067C
          Length = 714

 Score = 33.5 bits (75), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 18/31 (58%)

Query: 734 GLNNIGNTCYLNSLLQYYFSISSLRQYVLDY 764
           G  N GNTCY NS+LQ  F +   R  +L +
Sbjct: 123 GYENFGNTCYCNSILQCLFFLDDFRIDILKH 153

>Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON}
            (88495..89895) [1401 nt, 467 aa]
          Length = 466

 Score = 33.1 bits (74), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 25/64 (39%), Gaps = 8/64 (12%)

Query: 1223 YSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPYF 1282
            Y L  +  H G  + GHY    K     G W K+ND  +T + E  +           Y 
Sbjct: 406  YELIGIICHTGTVNEGHYTAICK--IPEGQWIKFNDSMVTIISEETMLK------EQAYL 457

Query: 1283 LVYV 1286
            L+Y 
Sbjct: 458  LIYT 461

>AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YMR223W (UBP8)
          Length = 469

 Score = 32.7 bits (73), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 28/66 (42%), Gaps = 8/66 (12%)

Query: 1221 IGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATP 1280
            + + L A+  H+G    GHY      R    +W K+ND  +T + E ++           
Sbjct: 410  LTFKLSAIIPHQGTVDKGHYTTIC--RINGDVWAKFNDSMVTLISEEDMLK------EQA 461

Query: 1281 YFLVYV 1286
            Y L YV
Sbjct: 462  YLLYYV 467

>YBR058C Chr2 complement(353672..356017) [2346 bp, 781 aa] {ON}
           UBP14Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains; involved in
           fructose-1,6-bisphosphatase (Fbp1p) degradation; similar
           to human isopeptidase T
          Length = 781

 Score = 32.7 bits (73), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 699 ALSKIGFERNSKLISHFIDTGTVDASCLPA-ENWPTGLNNIGNTCYLNSLLQ 749
            L ++  E+N       +D+   +   L A +N+  GL N+GN+CYLNS++Q
Sbjct: 288 TLVQLQVEQNENWQFRMVDSSGKEFEKLSASKNYGCGLINLGNSCYLNSVIQ 339

>YDR001C Chr4 complement(450220..452475) [2256 bp, 751 aa] {ON}
           NTH1Neutral trehalase, degrades trehalose; required for
           thermotolerance and may mediate resistance to other
           cellular stresses; may be phosphorylated by Cdc28p
          Length = 751

 Score = 32.7 bits (73), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 45/103 (43%), Gaps = 3/103 (2%)

Query: 576 YEPYRNVTQAYEILEVDESVDDDIIQTAYTVKVNDSPGLKIDCDRALYTIAVHSRSLALF 635
           YE Y   +Q +  L+++       I   Y   VND+PGL        +  +   ++L  +
Sbjct: 235 YEFYVQASQMHPSLKLEVEYLPKKITAEYVKSVNDTPGLLALAMEEHFNPSTGEKTLIGY 294

Query: 636 NFLVQQSEEFQEYFGPDQFSYQDALSVLQVNENAGDDTILEIF 678
            + V     F E +G D  SY  AL +L+ N+      ++E F
Sbjct: 295 PYAVPGG-RFNELYGWD--SYMMALGLLEANKTDVARGMVEHF 334

>Suva_4.254 Chr4 complement(447775..450033) [2259 bp, 752 aa] {ON}
           YBR001C (REAL)
          Length = 752

 Score = 32.7 bits (73), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 56/134 (41%), Gaps = 7/134 (5%)

Query: 549 NRHAELKNSLRLLAKFKKSPKLKFYAD----YEPYRNVTQAYEILEVDESVDDDIIQTAY 604
           N   E+    ++     K+P++    D    YE Y   +Q +  L+++       I   Y
Sbjct: 205 NNIGEIAKDTKINTPGAKNPRIYVPIDCPEQYEFYIQASQMHPSLKLEVEYLPKKITAEY 264

Query: 605 TVKVNDSPGLKIDCDRALYTIAVHSRSLALFNFLVQQSEEFQEYFGPDQFSYQDALSVLQ 664
              VND+PGL        +  +   ++L  + + V     F E +G D  SY  AL +L+
Sbjct: 265 VKSVNDTPGLLALAMEEHFNPSTGEKTLIGYPYAVPGG-RFNELYGWD--SYMMALGLLE 321

Query: 665 VNENAGDDTILEIF 678
            N+      ++E F
Sbjct: 322 ANKTDVARGMVEHF 335

>Smik_4.236 Chr4 complement(429539..431794) [2256 bp, 751 aa] {ON}
           YBR001C (REAL)
          Length = 751

 Score = 32.7 bits (73), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 56/134 (41%), Gaps = 7/134 (5%)

Query: 549 NRHAELKNSLRLLAKFKKSPKLKFYAD----YEPYRNVTQAYEILEVDESVDDDIIQTAY 604
           N   E+    ++     K+P++    D    YE Y   +Q +  L+++       I   Y
Sbjct: 204 NNVGEIAKDTKIDTPGAKNPRIYVPYDCPEQYEFYVQASQMHPSLKLEVEYLPKKITAEY 263

Query: 605 TVKVNDSPGLKIDCDRALYTIAVHSRSLALFNFLVQQSEEFQEYFGPDQFSYQDALSVLQ 664
              VND+PGL        +  +   ++L  + + V     F E +G D  SY  AL +L+
Sbjct: 264 VKSVNDTPGLLALAMEEHFNPSTGEKTLIGYPYAVPGG-RFNELYGWD--SYMMALGLLE 320

Query: 665 VNENAGDDTILEIF 678
            N+      ++E F
Sbjct: 321 ANKTDVARGMVEHF 334

>Kpol_251.7 s251 (12280..13719) [1440 bp, 480 aa] {ON}
           (12280..13719) [1440 nt, 480 aa]
          Length = 480

 Score = 32.7 bits (73), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 17/21 (80%)

Query: 733 TGLNNIGNTCYLNSLLQYYFS 753
            GL N+GN+CY+NS+LQ  F+
Sbjct: 322 CGLINLGNSCYMNSVLQLLFN 342

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
           Anc_3.270 YBR058C
          Length = 795

 Score = 32.7 bits (73), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 19/27 (70%)

Query: 727 PAENWPTGLNNIGNTCYLNSLLQYYFS 753
           P++    G  N+GN+CYLNS+LQ  F+
Sbjct: 327 PSKELGCGFINLGNSCYLNSVLQCLFN 353

>Kpol_1055.31 s1055 complement(78247..80715) [2469 bp, 822 aa] {ON}
            complement(78247..80715) [2469 nt, 823 aa]
          Length = 822

 Score = 32.7 bits (73), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 37/76 (48%), Gaps = 6/76 (7%)

Query: 1217 DFKSIGYSLFAVFIHRGEASYGHYWIYIKDRYKSGI--WRKYNDETITEVPESEVFNFSE 1274
            D K+  Y L  V  H G +S G +  Y  D Y   +  W + +D  I E+ + +V    E
Sbjct: 747  DTKNRAYELTGVIYHHGLSSDGGH--YTADVYHKELDKWYRIDDVNIIELEKDDVLKGGE 804

Query: 1275 -GN-TATPYFLVYVKQ 1288
             GN T T Y L+Y K+
Sbjct: 805  DGNDTRTAYILIYRKK 820

>Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar to
            Ashbya gossypii AGR139C
          Length = 834

 Score = 32.7 bits (73), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 8/68 (11%)

Query: 1223 YSLFAVFIHRG-EASYGHYW--IYIKDRYKSGIWRKYNDETITEVPESEVFNFSE--GNT 1277
            Y L  V  H G  +S GHY   +  +D  K   W + +D T+TE+ + EV    E   ++
Sbjct: 767  YKLTGVVYHHGLSSSGGHYTADVLHQDEEK---WYRIDDTTVTEINKEEVVTGGEEGSHS 823

Query: 1278 ATPYFLVY 1285
             T Y L+Y
Sbjct: 824  RTAYILIY 831

>ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {ON}
            similar to uniprot|Q01477 Saccharomyces cerevisiae
            YER151C UBP3 Ubiquitin-specific protease that interacts
            with Bre5p to co-regulate anterograde and retrograde
            transport between endoplasmic reticulum and Golgi
            compartments inhibitor of gene silencing cleaves
            ubiquitin fusions but not polyubiquitin
          Length = 826

 Score = 32.3 bits (72), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 1223 YSLFAVFIHRGEAS-YGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSE--GNTAT 1279
            Y L  V  H G +S  GHY   +  R +S  W + +D +I E+ + +V    E  G++ T
Sbjct: 759  YHLTGVIYHHGVSSDGGHYTADVYHR-ESDKWYRIDDVSIIELEKEDVLKGGEESGDSRT 817

Query: 1280 PYFLVYVK 1287
             Y L+Y K
Sbjct: 818  AYILMYQK 825

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 143,633,033
Number of extensions: 6891340
Number of successful extensions: 29117
Number of sequences better than 10.0: 352
Number of HSP's gapped: 29943
Number of HSP's successfully gapped: 486
Length of query: 1305
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1183
Effective length of database: 39,492,147
Effective search space: 46719209901
Effective search space used: 46719209901
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 72 (32.3 bits)