Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F18590g1.1ON20020010731e-151
ZYRO0F15840g1.120ON20020010731e-151
TDEL0C070101.1ON2052055582e-72
Kpol_2002.21.1ON2092183767e-45
TBLA0A070401.120ON2011923566e-42
TBLA0A075901.1ON2011923566e-42
TPHA0E036201.120ON1951973471e-40
TPHA0E040801.1ON1951973471e-40
Suva_3.1481.1ON1751872746e-30
CAGL0B00242g1.1ON1841412591e-27
YCR040W (MATALPHA1)1.120ON1751842572e-27
YCL066W (HMLALPHA1)1.1ON1751842572e-27
CAGL0B01243g1.120ON1431392491e-26
Smik_92.1singletonON1561802474e-26
Skud_3.1191.120ON1741842485e-26
Skud_71.1singletonON1551802413e-25
Suva_69.2singletonON1451752361e-24
KAFR0D007101.120ON1721751771e-15
KNAG0C001501.1ON1451781742e-15
KLLA0C00352g1.1ON2611911793e-15
NCAS0B091501.1ON1501821638e-14
KLTH0F00374g1.1ON2491921565e-12
Ecym_10031.1ON263681549e-12
Ecym_11141.120ON263681549e-12
Kwal_33.matalpha1singletonOFF2441941485e-11
Kwal_33.12992singletonOFF2441941485e-11
Kwal_YGOB_matalpha11.120ON2441941485e-11
Kwal_YGOB_HMalpha11.1ON2441941485e-11
NDAI0A001001.1ON135641252e-08
Smik_3.1441.120ON5423790.009
Smik_88.1singletonON3519690.13
Suva_3.140singletonON3120690.15
Skud_80.1singletonON3218680.19
NDAI0B021108.94ON846134750.29
Suva_3.791.120ON3517660.36
YDR416W (SYF1)5.519ON85985682.2
TBLA0E015304.34ON113660664.5
NCAS0G011406.273ON49829648.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F18590g
         (200 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F18590g Chr6 (1533781..1534383) [603 bp, 200 aa] {ON} simil...   417   e-151
ZYRO0F15840g Chr6 (1303842..1304444) [603 bp, 200 aa] {ON} simil...   417   e-151
TDEL0C07010 Chr3 (1274648..1275265) [618 bp, 205 aa] {ON} Anc_1....   219   2e-72
Kpol_2002.2 s2002 complement(3611..4240) [630 bp, 209 aa] {ON} c...   149   7e-45
TBLA0A07040 Chr1 complement(1727988..1728593) [606 bp, 201 aa] {...   141   6e-42
TBLA0A07590 Chr1 complement(1881757..1882362) [606 bp, 201 aa] {...   141   6e-42
TPHA0E03620 Chr5 (766068..766655) [588 bp, 195 aa] {ON} Anc_1.12...   138   1e-40
TPHA0E04080 Chr5 (850045..850632) [588 bp, 195 aa] {ON}   silenc...   138   1e-40
Suva_3.148 Chr3 (222811..223338) [528 bp, 175 aa] {ON} YCL066W (...   110   6e-30
CAGL0B00242g Chr2 complement(10582..11136) [555 bp, 184 aa] {ON}...   104   1e-27
YCR040W Chr3 (200442..200969) [528 bp, 175 aa] {ON}  MATALPHA1Tr...   103   2e-27
YCL066W Chr3 (13282..13809) [528 bp, 175 aa] {ON}  HMLALPHA1Sile...   103   2e-27
CAGL0B01243g Chr2 complement(112831..113262) [432 bp, 143 aa] {O...   100   1e-26
Smik_92.1 Chr92 complement(3..470) [468 bp, 156 aa] {ON} YCR040W...   100   4e-26
Skud_3.119 Chr3 (184941..185465) [525 bp, 174 aa] {ON} YCR040W (...   100   5e-26
Skud_71.1 Chr71 complement(3..467) [465 bp, 155 aa] {ON} YCR040W...    97   3e-25
Suva_69.2 Chr69 (369..803) [435 bp, 145 aa] {ON} YCL066W (REAL)        96   1e-24
KAFR0D00710 Chr4 complement(127819..128337) [519 bp, 172 aa] {ON...    73   1e-15
KNAG0C00150 Chr3 complement(24902..25339) [438 bp, 145 aa] {ON} ...    72   2e-15
KLLA0C00352g Chr3 complement(24124..24909) [786 bp, 261 aa] {ON}...    74   3e-15
NCAS0B09150 Chr2 (1755595..1756047) [453 bp, 150 aa] {ON} Anc_1.1      67   8e-14
KLTH0F00374g Chr6 complement(30927..31676) [750 bp, 249 aa] {ON}...    65   5e-12
Ecym_1003 Chr1 (6314..7105) [792 bp, 263 aa] {ON} similar to Sac...    64   9e-12
Ecym_1114 Chr1 complement(236238..237029) [792 bp, 263 aa] {ON} ...    64   9e-12
Kwal_33.matalpha1 s33 complement(283160..283894) [735 bp, 244 aa...    62   5e-11
Kwal_33.12992 s33 complement(31018..31752) [735 bp, 244 aa] {OFF...    62   5e-11
Kwal_YGOB_matalpha1 s33 complement(283160..283894) [735 bp, 244 ...    62   5e-11
Kwal_YGOB_HMalpha1 s33 complement(31018..31752) [735 bp, 244 aa]...    62   5e-11
NDAI0A00100 Chr1 complement(783..1190) [408 bp, 135 aa] {ON} Anc...    53   2e-08
Smik_3.144 Chr3 (198300..198334,198763..198892) [165 bp, 54 aa] ...    35   0.009
Smik_88.1 Chr88 complement(3..72,501..535) [105 bp, 35 aa] {ON} ...    31   0.13 
Suva_3.140 Chr3 (212396..212488) [93 bp, 31 aa] {ON} YCR040W (REAL)    31   0.15 
Skud_80.1 Chr80 complement(3..98) [96 bp, 32 aa] {ON} YCR040W (R...    31   0.19 
NDAI0B02110 Chr2 (525331..527871) [2541 bp, 846 aa] {ON} Anc_8.9...    33   0.29 
Suva_3.79 Chr3 (114117..114221) [105 bp, 35 aa] {ON} YCR040W (REAL)    30   0.36 
YDR416W Chr4 (1298432..1301011) [2580 bp, 859 aa] {ON}  SYF1Memb...    31   2.2  
TBLA0E01530 Chr5 complement(350957..354367) [3411 bp, 1136 aa] {...    30   4.5  
NCAS0G01140 Chr7 (203105..204601) [1497 bp, 498 aa] {ON} Anc_6.2...    29   8.1  

>ZYRO0F18590g Chr6 (1533781..1534383) [603 bp, 200 aa] {ON} similar
           to uniprot|P01365 Saccharomyces cerevisiae YCR040W
           MATALPHA1 Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression
           targets the transcription factor Mcm1p to the promoters
           of alpha- specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 200

 Score =  417 bits (1073), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 200/200 (100%), Positives = 200/200 (100%)

Query: 1   MNTKSFRGFKSNQPLFKVKVEKKGRSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKL 60
           MNTKSFRGFKSNQPLFKVKVEKKGRSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKL
Sbjct: 1   MNTKSFRGFKSNQPLFKVKVEKKGRSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKL 60

Query: 61  IKIPSPPEVLLRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTKG 120
           IKIPSPPEVLLRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTKG
Sbjct: 61  IKIPSPPEVLLRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTKG 120

Query: 121 SRKGCSEKPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFV 180
           SRKGCSEKPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFV
Sbjct: 121 SRKGCSEKPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFV 180

Query: 181 KPKCGFVEWVDQRYERESCI 200
           KPKCGFVEWVDQRYERESCI
Sbjct: 181 KPKCGFVEWVDQRYERESCI 200

>ZYRO0F15840g Chr6 (1303842..1304444) [603 bp, 200 aa] {ON} similar
           to uniprot|P01365 Saccharomyces cerevisiae YCR040W
           MATALPHA1 Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression
           targets the transcription factor Mcm1p to the promoters
           of alpha- specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 200

 Score =  417 bits (1073), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 200/200 (100%), Positives = 200/200 (100%)

Query: 1   MNTKSFRGFKSNQPLFKVKVEKKGRSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKL 60
           MNTKSFRGFKSNQPLFKVKVEKKGRSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKL
Sbjct: 1   MNTKSFRGFKSNQPLFKVKVEKKGRSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKL 60

Query: 61  IKIPSPPEVLLRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTKG 120
           IKIPSPPEVLLRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTKG
Sbjct: 61  IKIPSPPEVLLRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTKG 120

Query: 121 SRKGCSEKPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFV 180
           SRKGCSEKPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFV
Sbjct: 121 SRKGCSEKPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFV 180

Query: 181 KPKCGFVEWVDQRYERESCI 200
           KPKCGFVEWVDQRYERESCI
Sbjct: 181 KPKCGFVEWVDQRYERESCI 200

>TDEL0C07010 Chr3 (1274648..1275265) [618 bp, 205 aa] {ON} Anc_1.121
           YCR040W silenced copy of alpha1 gene at T. delbrueckii
           HML locus
          Length = 205

 Score =  219 bits (558), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 146/205 (71%), Gaps = 9/205 (4%)

Query: 1   MNTKSFRGFKSNQPLFKVKVEKKGRSKR---PTLQDTTQTSKCI---AGKCIEDQQVNVF 54
           +++KSFRGF+ N+PLFKV++ K  R+ +    T     +  KC    +G+ +E++ V  F
Sbjct: 3   VSSKSFRGFRVNRPLFKVQINKDSRTSQCKAKTKFKKAKLDKCQPENSGR-LEERHVKTF 61

Query: 55  MTVSKLIKIPSPPEVLLRKIEEEKHKLKKDDFNMDNILLWDPYVYW-GEGYFFSIADSSL 113
           + + + IKIP PP +LL KIE+EK K+  +  + +   LWD  + W  E   FSIA   L
Sbjct: 62  VVILRPIKIPLPPNILLEKIEQEKRKVYSET-SPEIGSLWDSPIAWDNEDLLFSIASDVL 120

Query: 114 NNLSTKGSRKGCSEKPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTF 173
            N+  K +R+  S KPLNSFMAFRAYNSQFG GLKQNILSSLLA+AWHSHPEQQ IWDTF
Sbjct: 121 GNIYKKPARETASNKPLNSFMAFRAYNSQFGYGLKQNILSSLLASAWHSHPEQQGIWDTF 180

Query: 174 AQQFNFVKPKCGFVEWVDQRYERES 198
           AQQFNFVKPKCGFVEWVDQRYERES
Sbjct: 181 AQQFNFVKPKCGFVEWVDQRYERES 205

>Kpol_2002.2 s2002 complement(3611..4240) [630 bp, 209 aa] {ON}
           complement(3611..4240) [630 nt, 210 aa]
          Length = 209

 Score =  149 bits (376), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 105/218 (48%), Positives = 127/218 (58%), Gaps = 35/218 (16%)

Query: 1   MNTKSFRGFKSNQPLFKVKVEKKGRSKRPTLQDTTQTSKCIA--------GKCIEDQQVN 52
           M+TKS R + S QPLFKVK+ K  + ++       Q  K IA        GK  +   VN
Sbjct: 1   MSTKS-RSWTS-QPLFKVKLNKSNKIEK-------QKKKGIAINKLANSAGKLSQKANVN 51

Query: 53  VFMTVSKLIKIPSPPEVLLRKIEEEKHKLK--------KDDFNMDNILL-WDPYVYWGEG 103
           VF+T S + KIP PP  LL  I+EE  K+K        ++D N+ N    WD      + 
Sbjct: 52  VFITNSLVTKIPFPPSSLLLGIDEETKKMKSKKTSINIQNDTNILNFSSSWDE-----DD 106

Query: 104 YFFSIADSSLNNLSTKGSR----KGCSEKPLNSFMAFRAYNSQFGNGLKQNILSSLLAAA 159
            F S  ++  + LST  +        S+K LN FMAFRAYNSQFG GLKQ ILSSLL+ A
Sbjct: 107 LFLSDTETEYDLLSTSPNSVIEVDTSSKKSLNGFMAFRAYNSQFGYGLKQEILSSLLSEA 166

Query: 160 WHSHPEQQKIWDTFAQQFNFVKPKCGFVEWVDQRYERE 197
           WHS PEQQK W   +QQFNFVKPKCGFVEWV Q YERE
Sbjct: 167 WHSDPEQQKKWTVLSQQFNFVKPKCGFVEWVGQTYERE 204

>TBLA0A07040 Chr1 complement(1727988..1728593) [606 bp, 201 aa] {ON}
            MATalpha1 gene at MAT locus
          Length = 201

 Score =  141 bits (356), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 113/192 (58%), Gaps = 13/192 (6%)

Query: 13  QPLFKVKVEKKGRSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIPSPPEVLLR 72
           + LFKV ++     +  T       SK +  K  E + +++ +  +  IKIP PP  LL 
Sbjct: 11  KALFKVNLKLNKNIRMKT------NSKSMRNKFNETRGISILLYKNHNIKIPFPPTTLLY 64

Query: 73  KIEEEKHKLKK-----DDFNMDNILLWDPYVYWGEGYF--FSIADSSLNNLSTKGSRKGC 125
            IE EK K+       +++ MDN   +   +++ + Y    S+ D+   N          
Sbjct: 65  NIEVEKQKIISTQHMLNEYTMDNDDNYLSDLFYEDEYNDNNSLFDNGFPNNVNSNPNPVN 124

Query: 126 SEKPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPKCG 185
           SE+ LN F+AFRAYNSQFG GLKQNILSSLL+ AWH +P QQ +W+ F+Q++NFVKPKCG
Sbjct: 125 SERVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVKPKCG 184

Query: 186 FVEWVDQRYERE 197
           FVEW+ Q YERE
Sbjct: 185 FVEWLGQTYERE 196

>TBLA0A07590 Chr1 complement(1881757..1882362) [606 bp, 201 aa] {ON}
           Anc_1.1 YCL066W silenced copy of alpha1 gene at HML
           locus
          Length = 201

 Score =  141 bits (356), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 113/192 (58%), Gaps = 13/192 (6%)

Query: 13  QPLFKVKVEKKGRSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIPSPPEVLLR 72
           + LFKV ++     +  T       SK +  K  E + +++ +  +  IKIP PP  LL 
Sbjct: 11  KALFKVNLKLNKNIRMKT------NSKSMRNKFNETRGISILLYKNHNIKIPFPPTTLLY 64

Query: 73  KIEEEKHKLKK-----DDFNMDNILLWDPYVYWGEGYF--FSIADSSLNNLSTKGSRKGC 125
            IE EK K+       +++ MDN   +   +++ + Y    S+ D+   N          
Sbjct: 65  NIEVEKQKIISTQHMLNEYTMDNDDNYLSDLFYEDEYNDNNSLFDNGFPNNVNSNPNPVN 124

Query: 126 SEKPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPKCG 185
           SE+ LN F+AFRAYNSQFG GLKQNILSSLL+ AWH +P QQ +W+ F+Q++NFVKPKCG
Sbjct: 125 SERVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVKPKCG 184

Query: 186 FVEWVDQRYERE 197
           FVEW+ Q YERE
Sbjct: 185 FVEWLGQTYERE 196

>TPHA0E03620 Chr5 (766068..766655) [588 bp, 195 aa] {ON} Anc_1.121
           YCR040W MATalpha1 gene at MAT locus
          Length = 195

 Score =  138 bits (347), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 118/197 (59%), Gaps = 19/197 (9%)

Query: 11  SNQPLFKVKVEKKG-RS-KRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIPSPPE 68
           S QPLFKV + KK  RS K  T ++  Q  K         Q+ + F+  +  +KIP PP 
Sbjct: 8   SKQPLFKVSLNKKRIRSIKIKTHKNNVQLKK---------QRSHQFIAENFKLKIPYPPT 58

Query: 69  VLLRKIEEE--KHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNN----LSTKGSR 122
            LLR I+ E  + ++KK     D   L++  + W E    S  D  +N+    ++     
Sbjct: 59  CLLRSIDAELRRIEIKKSIVAQDVNSLFNVELTWDEDNVLS--DDDINDDIAYINYSSEE 116

Query: 123 KGCSEKPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKP 182
           +   +K LNSF+AFRAYN+QFGNGL Q++LS LL+ AWHS PEQ  +WD FAQQFNFVKP
Sbjct: 117 ELLFKKSLNSFIAFRAYNAQFGNGLNQHLLSHLLSLAWHSAPEQHHVWDVFAQQFNFVKP 176

Query: 183 KCGFVEWVDQRYERESC 199
           KCGFVEWV Q YERE C
Sbjct: 177 KCGFVEWVGQTYEREWC 193

>TPHA0E04080 Chr5 (850045..850632) [588 bp, 195 aa] {ON}   silenced
           copy of alpha1 at HMLalpha locus
          Length = 195

 Score =  138 bits (347), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 118/197 (59%), Gaps = 19/197 (9%)

Query: 11  SNQPLFKVKVEKKG-RS-KRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIPSPPE 68
           S QPLFKV + KK  RS K  T ++  Q  K         Q+ + F+  +  +KIP PP 
Sbjct: 8   SKQPLFKVSLNKKRIRSIKIKTHKNNVQLKK---------QRSHQFIAENFKLKIPYPPT 58

Query: 69  VLLRKIEEE--KHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNN----LSTKGSR 122
            LLR I+ E  + ++KK     D   L++  + W E    S  D  +N+    ++     
Sbjct: 59  CLLRSIDAELRRIEIKKSIVAQDVNSLFNVELTWDEDNVLS--DDDINDDIAYINYSSEE 116

Query: 123 KGCSEKPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKP 182
           +   +K LNSF+AFRAYN+QFGNGL Q++LS LL+ AWHS PEQ  +WD FAQQFNFVKP
Sbjct: 117 ELLFKKSLNSFIAFRAYNAQFGNGLNQHLLSHLLSLAWHSAPEQHHVWDVFAQQFNFVKP 176

Query: 183 KCGFVEWVDQRYERESC 199
           KCGFVEWV Q YERE C
Sbjct: 177 KCGFVEWVGQTYEREWC 193

>Suva_3.148 Chr3 (222811..223338) [528 bp, 175 aa] {ON} YCL066W
           (REAL)
          Length = 175

 Score =  110 bits (274), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 72/187 (38%), Positives = 96/187 (51%), Gaps = 35/187 (18%)

Query: 11  SNQPLFKVKVEKKGRSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIPSPPEVL 70
           +++P F++K  K  +S R T        K IA K I     N+   + K I+IP+P  + 
Sbjct: 3   TSKPAFRIK-NKTSKSHRKTDIAKKVEGKRIA-KLINPSCFNIIRPLKKNIQIPAPSPLF 60

Query: 71  LRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTKGSRKGC---SE 127
           L+KI+                              + IA  +  N+  + SRK     S+
Sbjct: 61  LKKIQ-----------------------------LYRIASGN-QNIQCRQSRKASITPSK 90

Query: 128 KPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPKCGFV 187
           K LNSFMAFRAY SQFG G+KQNILSSLL+  WH+   Q  IWD FAQQ+NF+ P  GFV
Sbjct: 91  KYLNSFMAFRAYYSQFGAGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGFV 150

Query: 188 EWVDQRY 194
           EW+   Y
Sbjct: 151 EWLTNNY 157

>CAGL0B00242g Chr2 complement(10582..11136) [555 bp, 184 aa] {ON}
           some similarities with uniprot|P01365 Saccharomyces
           cerevisiae YCR040w MATALPHA1 mating type regulatory
           protein or uniprot|P01365 Saccharomyces cerevisiae
           YCL066w HMLALPHA1
          Length = 184

 Score =  104 bits (259), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 83/141 (58%), Gaps = 5/141 (3%)

Query: 51  VNVFMTVSKLIKIPSPPEVLLRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIA- 109
           +N+ +T     +IP P  VLL++I EE+ KL     +  NI+  D    W    F S   
Sbjct: 40  LNMLLTKPNKFQIPPPHPVLLKRIREERMKLTSSFESGINII--DIETSWEIDKFISHHF 97

Query: 110 DSSLNNLSTKGSRKGCSEKPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKI 169
           ++S+ N+    S     ++P+N+FMAFR Y +Q G GLKQN LS +L+ AW++    Q I
Sbjct: 98  NTSIGNVLKSKSSS--KKRPMNAFMAFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNI 155

Query: 170 WDTFAQQFNFVKPKCGFVEWV 190
           WD FAQQFNF  P+CGFV ++
Sbjct: 156 WDIFAQQFNFASPRCGFVNYI 176

>YCR040W Chr3 (200442..200969) [528 bp, 175 aa] {ON}
           MATALPHA1Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression;
           targets the transcription factor Mcm1p to the promoters
           of alpha-specific genes; one of two genes encoded by the
           MATalpha mating type cassette
          Length = 175

 Score =  103 bits (257), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 69/184 (37%), Positives = 91/184 (49%), Gaps = 29/184 (15%)

Query: 11  SNQPLFKVKVEKKGRSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIPSPPEVL 70
           +++P FK+K  K  +S R T        K +A + +     N+   + K I+IP P    
Sbjct: 3   TSKPAFKIK-NKASKSYRNTAVSKKLKEKRLA-EHVRPSCFNIIRPLKKDIQIPVPSSRF 60

Query: 71  LRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTKGSRKGCSEKPL 130
           L KI+   H++     N                          N  S K S+K      L
Sbjct: 61  LNKIQ--IHRIASGSQNTQ--------------------FRQFNKTSIKSSKK-----YL 93

Query: 131 NSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPKCGFVEWV 190
           NSFMAFRAY SQFG+G+KQN+LSSLLA  WH+   Q  IWD FAQQ+NF+ P  GFVEW+
Sbjct: 94  NSFMAFRAYYSQFGSGVKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGFGFVEWL 153

Query: 191 DQRY 194
              Y
Sbjct: 154 TNNY 157

>YCL066W Chr3 (13282..13809) [528 bp, 175 aa] {ON}
           HMLALPHA1Silenced copy of ALPHA1 at HML, encoding a
           transcriptional coactivator involved in the regulation
           of mating-type alpha-specific gene expression
          Length = 175

 Score =  103 bits (257), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 69/184 (37%), Positives = 91/184 (49%), Gaps = 29/184 (15%)

Query: 11  SNQPLFKVKVEKKGRSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIPSPPEVL 70
           +++P FK+K  K  +S R T        K +A + +     N+   + K I+IP P    
Sbjct: 3   TSKPAFKIK-NKASKSYRNTAVSKKLKEKRLA-EHVRPSCFNIIRPLKKDIQIPVPSSRF 60

Query: 71  LRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTKGSRKGCSEKPL 130
           L KI+   H++     N                          N  S K S+K      L
Sbjct: 61  LNKIQ--IHRIASGSQNTQ--------------------FRQFNKTSIKSSKK-----YL 93

Query: 131 NSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPKCGFVEWV 190
           NSFMAFRAY SQFG+G+KQN+LSSLLA  WH+   Q  IWD FAQQ+NF+ P  GFVEW+
Sbjct: 94  NSFMAFRAYYSQFGSGVKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGFGFVEWL 153

Query: 191 DQRY 194
              Y
Sbjct: 154 TNNY 157

>CAGL0B01243g Chr2 complement(112831..113262) [432 bp, 143 aa] {ON}
           some similarities with uniprot|P01365 Saccharomyces
           cerevisiae YCR040w MATALPHA1 expressed copy at MAT locus
           or uniprot|P01365 Saccharomyces cerevisiae YCL066w
           HMLALPHA1 silenced copy at HML
          Length = 143

 Score =  100 bits (249), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 81/139 (58%), Gaps = 5/139 (3%)

Query: 53  VFMTVSKLIKIPSPPEVLLRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIA-DS 111
           + +T     +IP P  VLL++I EE+ KL     +  NI+  D    W    F S   ++
Sbjct: 1   MLLTKPNKFQIPPPHPVLLKRIREERMKLTSSFESGINII--DIETSWEIDKFISHHFNT 58

Query: 112 SLNNLSTKGSRKGCSEKPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWD 171
           S+ N+    S     ++P+N+FMAFR Y +Q G GLKQN LS +L+ AW++    Q IWD
Sbjct: 59  SIGNVLKSKSSS--KKRPMNAFMAFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNIWD 116

Query: 172 TFAQQFNFVKPKCGFVEWV 190
            FAQQFNF  P+CGFV ++
Sbjct: 117 IFAQQFNFASPRCGFVNYI 135

>Smik_92.1 Chr92 complement(3..470) [468 bp, 156 aa] {ON} YCR040W
           (REAL)
          Length = 156

 Score = 99.8 bits (247), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 92/180 (51%), Gaps = 29/180 (16%)

Query: 11  SNQPLFKVKVEKKGRSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIPSPPEVL 70
           +++P F++  +     + P +    +  +    K ++    NV   + K I+IP P    
Sbjct: 3   TSKPAFRINNKISKSHRNPVVSKKIKERRIT--KHVKPNCFNVIRPLKKDIQIPIPSSRF 60

Query: 71  LRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTKGSRKGCSEKPL 130
           L+KI+   H++   + +                    I    LN  S K ++K      L
Sbjct: 61  LKKIQI--HRIASGNQH--------------------IQCRQLNKTSIKSTKKY-----L 93

Query: 131 NSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPKCGFVEWV 190
           NSFMAFRAY SQFG+G+KQNILSSLL+  WH+   Q  IWD FAQQ+NF+ P  GFVEW+
Sbjct: 94  NSFMAFRAYYSQFGSGVKQNILSSLLSEEWHADKTQHGIWDYFAQQYNFINPGFGFVEWL 153

>Skud_3.119 Chr3 (184941..185465) [525 bp, 174 aa] {ON} YCR040W
           (REAL)
          Length = 174

 Score =  100 bits (248), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 64/184 (34%), Positives = 93/184 (50%), Gaps = 30/184 (16%)

Query: 11  SNQPLFKVKVEKKGRSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIPSPPEVL 70
           +++P F++K +K  +S R T+    + +  +  K I     NV   + K I+IP+P    
Sbjct: 3   TSKPAFRIK-KKTSKSYRKTVISKVEGNGIV--KRISPSCFNVIRPLKKDIQIPAPASRF 59

Query: 71  LRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTKGSRKGCSEKPL 130
           L+KI+  +                            S  + +        +    S+K +
Sbjct: 60  LKKIQIHR---------------------------ISSGNQTTQCRQLSKASIKSSKKHI 92

Query: 131 NSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPKCGFVEWV 190
           NSFMAFRAY SQFG+G+KQNILSSLL+  WH+   Q  IWD FAQQ+NF+ P  GFVEW+
Sbjct: 93  NSFMAFRAYYSQFGSGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGFVEWL 152

Query: 191 DQRY 194
              Y
Sbjct: 153 TNNY 156

>Skud_71.1 Chr71 complement(3..467) [465 bp, 155 aa] {ON} YCR040W
           (REAL)
          Length = 155

 Score = 97.4 bits (241), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 92/180 (51%), Gaps = 30/180 (16%)

Query: 11  SNQPLFKVKVEKKGRSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIPSPPEVL 70
           +++P F++K +K  +S R T+    + +  +  K I     NV   + K I+IP+P    
Sbjct: 3   TSKPAFRIK-KKTSKSYRKTVISKVEGNGIV--KRISPSCFNVIRPLKKDIQIPAPASRF 59

Query: 71  LRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTKGSRKGCSEKPL 130
           L+KI+  +                            S  + +        +    S+K +
Sbjct: 60  LKKIQIHR---------------------------ISSGNQTTQCRQLSKASIKSSKKHI 92

Query: 131 NSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPKCGFVEWV 190
           NSFMAFRAY SQFG+G+KQNILSSLL+  WH+   Q  IWD FAQQ+NF+ P  GFVEW+
Sbjct: 93  NSFMAFRAYYSQFGSGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGFVEWL 152

>Suva_69.2 Chr69 (369..803) [435 bp, 145 aa] {ON} YCL066W (REAL)
          Length = 145

 Score = 95.5 bits (236), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 66/175 (37%), Positives = 89/175 (50%), Gaps = 35/175 (20%)

Query: 11  SNQPLFKVKVEKKGRSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIPSPPEVL 70
           +++P F++K  K  +S R T        K IA K I     N+   + K I+IP+P  + 
Sbjct: 3   TSKPAFRIK-NKTSKSHRKTDIAKKVEGKRIA-KLINPSCFNIIRPLKKNIQIPAPSPLF 60

Query: 71  LRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTKGSRKGC---SE 127
           L+KI+                              + IA  +  N+  + SRK     S+
Sbjct: 61  LKKIQ-----------------------------LYRIASGN-QNIQCRQSRKASITPSK 90

Query: 128 KPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKP 182
           K LNSFMAFRAY SQFG G+KQNILSSLL+  WH+   Q  IWD FAQQ+NF+ P
Sbjct: 91  KYLNSFMAFRAYYSQFGAGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINP 145

>KAFR0D00710 Chr4 complement(127819..128337) [519 bp, 172 aa] {ON}
           mating type gene MATalpha1
          Length = 172

 Score = 72.8 bits (177), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 89/175 (50%), Gaps = 17/175 (9%)

Query: 8   GFKSNQPLFKVKVEKKGRSKRPTLQDTTQTSKCIAGKCIED-QQVNVFMTVSKLIKIPSP 66
           G  + QPLFKVK++K  R  + TLQ + +  K    K  +    VNVF  +++ +   +P
Sbjct: 4   GVLNKQPLFKVKLKKTIRGTK-TLQSSKRIGKPSLSKAKKRLNNVNVFSVMTEDLDSIAP 62

Query: 67  PEVLLRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSL---NNL--STKGS 121
              +++ I+  K++ +  +         D   YW     F + D  L   N++  + K  
Sbjct: 63  NLDIIQMIDIAKNRTQDTN---------DLLYYWNYALPFGL-DPLLVPFNDIPIALKNP 112

Query: 122 RKGCSEKPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQ 176
            + C  + LN FMAFR+Y SQ+  GLKQ  LS +LA AWHS  ++Q  W +  Q+
Sbjct: 113 IEICQNRNLNPFMAFRSYYSQYAQGLKQIELSEVLAKAWHSDTKEQNYWISLTQK 167

>KNAG0C00150 Chr3 complement(24902..25339) [438 bp, 145 aa] {ON}
           Anc_1.1 YCL066W silent copy of mating type alpha1 gene
           at HML locus
          Length = 145

 Score = 71.6 bits (174), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 78/178 (43%), Gaps = 52/178 (29%)

Query: 11  SNQPLFKVKVEK--------KGRSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIK 62
           S +PLFK+ + +        + R++RP L     T+   A K                 K
Sbjct: 3   SKKPLFKMNITQSHSSNKSIRKRTRRPNLNSFASTN---AAKNTP--------------K 45

Query: 63  IPSPP---EVLLRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTK 119
           IP P     VL R + ++++ +  DD                         SSL+  + +
Sbjct: 46  IPDPNIIRAVLFRNLNDDRNIISHDD------------------------SSSLSAKTIR 81

Query: 120 GSRKGCSEKPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQF 177
             R+ C    LNSF+AFRAY SQF NG+ QN LSS+L+  W S+  QQ  WD   +Q+
Sbjct: 82  SPREICKHGSLNSFIAFRAYYSQFANGINQNKLSSILSKFWKSNQSQQTFWDRLTEQY 139

>KLLA0C00352g Chr3 complement(24124..24909) [786 bp, 261 aa] {ON}
           uniprot|Q08398 Kluyveromyces lactis HMLAPLHA1 Mating-
           type protein ALPHA1
          Length = 261

 Score = 73.6 bits (179), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 90/191 (47%), Gaps = 25/191 (13%)

Query: 9   FKSNQPLFKVKVEKKG----RSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIP 64
            KSN P FKV V K+     R     ++        ++ +  + + VN++M+      IP
Sbjct: 1   MKSNAPTFKVAVSKRSCSSVRKTSKKIRSGMIRKPSVSSRYRKHEGVNLYMSKVTPTSIP 60

Query: 65  SPPEVLLRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTKGSRKG 124
           +PP+VL+  I+E+   L K +  M                  S+ +S  N LS++  +  
Sbjct: 61  APPQVLVAYIKEKVKTLNKSEVLM------------------SLGNS--NQLSSRDVKTK 100

Query: 125 CSEKPLNSFMAFRAYNSQFGNG-LKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPK 183
             +K +N F+AFR+Y S+  NG L Q  LS++++  W    + +K W+  AQ++N     
Sbjct: 101 TKKKQINDFIAFRSYYSRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDASG 160

Query: 184 CGFVEWVDQRY 194
             F  W++  Y
Sbjct: 161 KHFFNWLEVNY 171

>NCAS0B09150 Chr2 (1755595..1756047) [453 bp, 150 aa] {ON} Anc_1.1
          Length = 150

 Score = 67.4 bits (163), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 75/182 (41%), Gaps = 44/182 (24%)

Query: 12  NQPLFKVKVEKKGR---SKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIPSPPE 68
           N+PLFKV + ++ R   SK+P          C           N+F+   K I IP PP 
Sbjct: 10  NKPLFKVNIPRRVRNRNSKQPLKPKPVTYDTCF----------NIFLKDPKNITIPQPPN 59

Query: 69  VLLRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTKGSRKGCSEK 128
            +L+++E  +                             I   S      +        K
Sbjct: 60  WVLQELETIR-----------------------------IIYPSKQKPKPRKQVTSNPSK 90

Query: 129 PLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPKCGFVE 188
           P+N F+ FR+Y S++G G+KQ +LS LLA  W S    Q +WD FA Q++ V   C    
Sbjct: 91  PINGFILFRSYYSRWGYGIKQTMLSQLLAKFWKSSDTDQALWDYFALQYSTV--GCEMGV 148

Query: 189 WV 190
           WV
Sbjct: 149 WV 150

>KLTH0F00374g Chr6 complement(30927..31676) [750 bp, 249 aa] {ON}
           weakly similar to uniprot|P01365 Saccharomyces
           cerevisiae YCR040W MATALPHA1 Transcriptional
           co-activator involved in regulation of
           mating-type-specific gene expression targets the
           transcription factor Mcm1p to the promoters of
           alpha-specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 249

 Score = 64.7 bits (156), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 87/192 (45%), Gaps = 35/192 (18%)

Query: 11  SNQPLFKVKVEKKGRSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIPSPPEVL 70
           S +P FKV ++KKG++    L++++        K   +   N++M+ SK   IP PP  L
Sbjct: 3   STKPSFKVLIKKKGKTLNRRLKNSS--------KSYRENGANLYMSYSKPQAIPKPPNTL 54

Query: 71  L-----RKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTKGSRKGC 125
           +     +K  +   K  K+D+ +  + +    +Y                     S    
Sbjct: 55  INLVRSKKTSQSSRKCLKNDYILKELDVKKLSIY---------------------SNNTV 93

Query: 126 SEKPLNSFMAFRAYNSQFGNG-LKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPKC 184
            +K +N F+ FR+Y ++F  G ++Q  LS +L+  W  + +   +W+ F Q +N      
Sbjct: 94  LKKKINPFIGFRSYYAKFAKGRVRQQELSKILSEYWTKNSKIHSVWEFFTQHYNREVTSM 153

Query: 185 GFVEWVDQRYER 196
            F  W+++ Y++
Sbjct: 154 CFTLWLEENYQQ 165

>Ecym_1003 Chr1 (6314..7105) [792 bp, 263 aa] {ON} similar to
           Saccharomyces cerevisiae YCL066W HMLALPHA1
          Length = 263

 Score = 63.9 bits (154), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 43/68 (63%), Gaps = 1/68 (1%)

Query: 128 KPLNSFMAFRAYNSQFGNGLKQNI-LSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPKCGF 186
           K +N FMAFR+Y S+F  G+   + LS +LA  WH  P+ ++ W+ FA+ +N  +P   F
Sbjct: 111 KKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNMEQPDQSF 170

Query: 187 VEWVDQRY 194
            EW+++ Y
Sbjct: 171 PEWLEKTY 178

>Ecym_1114 Chr1 complement(236238..237029) [792 bp, 263 aa] {ON}
           similar to YCL066W HMLALPHA1
          Length = 263

 Score = 63.9 bits (154), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 43/68 (63%), Gaps = 1/68 (1%)

Query: 128 KPLNSFMAFRAYNSQFGNGLKQNI-LSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPKCGF 186
           K +N FMAFR+Y S+F  G+   + LS +LA  WH  P+ ++ W+ FA+ +N  +P   F
Sbjct: 111 KKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNMEQPDQSF 170

Query: 187 VEWVDQRY 194
            EW+++ Y
Sbjct: 171 PEWLEKTY 178

>Kwal_33.matalpha1 s33 complement(283160..283894) [735 bp, 244 aa]
           {OFF} (matalpha1) - mating type alpha1 protein [contig
           MAT] FULL
          Length = 244

 Score = 61.6 bits (148), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 89/194 (45%), Gaps = 33/194 (17%)

Query: 9   FKSNQPLFKVKVEKK-GRSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIPSPP 67
            K  +P FKV V K+ G   +P +   +     ++      + VN++M+ SK   IP PP
Sbjct: 1   MKFTKPSFKVSVNKRHGAKLKPKISKKSLKRNYVS------EGVNLYMSYSKQELIPKPP 54

Query: 68  EVLLRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTK---GSRKG 124
           + +++ +  +                       G+G    ++     +  ++   GS K 
Sbjct: 55  KAVMKILGSDH----------------------GKGLSKGLSKGIHKDQKSQTFLGSGKC 92

Query: 125 CSEKPLNSFMAFRAYNSQFGNG-LKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPK 183
            S+K +N F+ FR+Y ++   G ++Q  LS++L+  W SH +  K W+ F + +N     
Sbjct: 93  TSKKKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTV 152

Query: 184 CGFVEWVDQRYERE 197
             F EW+++ Y+ E
Sbjct: 153 MCFTEWLEKNYKPE 166

>Kwal_33.12992 s33 complement(31018..31752) [735 bp, 244 aa] {OFF}
           YCR040W (MATALPHA1) - transcription factor involved in
           the regulation of alpha-specific genes [contig 123] FULL
          Length = 244

 Score = 61.6 bits (148), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 89/194 (45%), Gaps = 33/194 (17%)

Query: 9   FKSNQPLFKVKVEKK-GRSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIPSPP 67
            K  +P FKV V K+ G   +P +   +     ++      + VN++M+ SK   IP PP
Sbjct: 1   MKFTKPSFKVSVNKRHGAKLKPKISKKSLKRNYVS------EGVNLYMSYSKQELIPKPP 54

Query: 68  EVLLRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTK---GSRKG 124
           + +++ +  +                       G+G    ++     +  ++   GS K 
Sbjct: 55  KAVMKILGSDH----------------------GKGLSKGLSKGIHKDQKSQTFLGSGKC 92

Query: 125 CSEKPLNSFMAFRAYNSQFGNG-LKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPK 183
            S+K +N F+ FR+Y ++   G ++Q  LS++L+  W SH +  K W+ F + +N     
Sbjct: 93  TSKKKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTV 152

Query: 184 CGFVEWVDQRYERE 197
             F EW+++ Y+ E
Sbjct: 153 MCFTEWLEKNYKPE 166

>Kwal_YGOB_matalpha1 s33 complement(283160..283894) [735 bp, 244 aa]
           {ON} (matalpha1) - mating type alpha1 protein [contig
           MAT] FULL
          Length = 244

 Score = 61.6 bits (148), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 89/194 (45%), Gaps = 33/194 (17%)

Query: 9   FKSNQPLFKVKVEKK-GRSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIPSPP 67
            K  +P FKV V K+ G   +P +   +     ++      + VN++M+ SK   IP PP
Sbjct: 1   MKFTKPSFKVSVNKRHGAKLKPKISKKSLKRNYVS------EGVNLYMSYSKQELIPKPP 54

Query: 68  EVLLRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTK---GSRKG 124
           + +++ +  +                       G+G    ++     +  ++   GS K 
Sbjct: 55  KAVMKILGSDH----------------------GKGLSKGLSKGIHKDQKSQTFLGSGKC 92

Query: 125 CSEKPLNSFMAFRAYNSQFGNG-LKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPK 183
            S+K +N F+ FR+Y ++   G ++Q  LS++L+  W SH +  K W+ F + +N     
Sbjct: 93  TSKKKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTV 152

Query: 184 CGFVEWVDQRYERE 197
             F EW+++ Y+ E
Sbjct: 153 MCFTEWLEKNYKPE 166

>Kwal_YGOB_HMalpha1 s33 complement(31018..31752) [735 bp, 244 aa]
           {ON} ANNOTATED BY YGOB - This is Kwal_33.12992
          Length = 244

 Score = 61.6 bits (148), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 89/194 (45%), Gaps = 33/194 (17%)

Query: 9   FKSNQPLFKVKVEKK-GRSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIPSPP 67
            K  +P FKV V K+ G   +P +   +     ++      + VN++M+ SK   IP PP
Sbjct: 1   MKFTKPSFKVSVNKRHGAKLKPKISKKSLKRNYVS------EGVNLYMSYSKQELIPKPP 54

Query: 68  EVLLRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTK---GSRKG 124
           + +++ +  +                       G+G    ++     +  ++   GS K 
Sbjct: 55  KAVMKILGSDH----------------------GKGLSKGLSKGIHKDQKSQTFLGSGKC 92

Query: 125 CSEKPLNSFMAFRAYNSQFGNG-LKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPK 183
            S+K +N F+ FR+Y ++   G ++Q  LS++L+  W SH +  K W+ F + +N     
Sbjct: 93  TSKKKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTV 152

Query: 184 CGFVEWVDQRYERE 197
             F EW+++ Y+ E
Sbjct: 153 MCFTEWLEKNYKPE 166

>NDAI0A00100 Chr1 complement(783..1190) [408 bp, 135 aa] {ON}
           Anc_1.1  silent copy of MATalpha1 gene at HMLalpha
           possible pseudogene; contains 2 copies of a 20 bp direct
           repeat, causing a frameshft; synthetic translation made
           by ignoring one copy.
          Length = 135

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 42/64 (65%)

Query: 125 CSEKPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPKC 184
           C  K +N FM FR+Y SQ+G GLKQ++LS LL+  W++H   Q +WD FAQQ N +  + 
Sbjct: 58  CYAKSINGFMLFRSYYSQYGKGLKQSLLSPLLSKLWNAHETDQLLWDQFAQQCNAIGHEG 117

Query: 185 GFVE 188
           G  E
Sbjct: 118 GICE 121

>Smik_3.144 Chr3 (198300..198334,198763..198892) [165 bp, 54 aa]
           {ON} YCR040W (REAL)
          Length = 54

 Score = 35.0 bits (79), Expect = 0.009,   Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 16/23 (69%)

Query: 172 TFAQQFNFVKPKCGFVEWVDQRY 194
           +F QQ+NF+ P  GFVEW+   Y
Sbjct: 14  SFPQQYNFINPGFGFVEWLTNNY 36

>Smik_88.1 Chr88 complement(3..72,501..535) [105 bp, 35 aa] {ON}
           YCL066W (REAL)
          Length = 35

 Score = 31.2 bits (69), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 11/19 (57%), Positives = 15/19 (78%)

Query: 172 TFAQQFNFVKPKCGFVEWV 190
           +F QQ+NF+ P  GFVEW+
Sbjct: 14  SFPQQYNFINPGFGFVEWL 32

>Suva_3.140 Chr3 (212396..212488) [93 bp, 31 aa] {ON} YCR040W (REAL)
          Length = 31

 Score = 31.2 bits (69), Expect = 0.15,   Method: Composition-based stats.
 Identities = 11/20 (55%), Positives = 14/20 (70%)

Query: 175 QQFNFVKPKCGFVEWVDQRY 194
           QQ+NF+ P  GFVEW+   Y
Sbjct: 1   QQYNFINPGFGFVEWLTNNY 20

>Skud_80.1 Chr80 complement(3..98) [96 bp, 32 aa] {ON} YCR040W
           (REAL)
          Length = 32

 Score = 30.8 bits (68), Expect = 0.19,   Method: Composition-based stats.
 Identities = 11/18 (61%), Positives = 14/18 (77%)

Query: 173 FAQQFNFVKPKCGFVEWV 190
           F QQ+NF+ P  GFVEW+
Sbjct: 12  FPQQYNFINPGFGFVEWL 29

>NDAI0B02110 Chr2 (525331..527871) [2541 bp, 846 aa] {ON} Anc_8.94
           YFR002W
          Length = 846

 Score = 33.5 bits (75), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 59/134 (44%), Gaps = 15/134 (11%)

Query: 30  TLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIP-SPPEVLLRKIEEEKHKLKKDDFNM 88
           TL+ +T+ S  I    +E  + N+  T S+L  I  S  E+  R IE  K K      N+
Sbjct: 11  TLESSTKGSAKIFNDLVESSK-NLPATSSQLGSIQLSVNEIKRRAIELRKKK------NI 63

Query: 89  DNILLWDPYVYWGEGYFFSIADSSLNNLSTKGSRKGCSEKPLNSFMAFRAYNSQFGNGLK 148
           DN L    Y+  G G      DSSL NL     +   SE+ L S       ++       
Sbjct: 64  DNTLTKAHYLLAGSGLAIEDVDSSLKNL----QKNELSERKLTSKYVGNEIDTYLRVKKG 119

Query: 149 QNILSS---LLAAA 159
           +NIL+S   LLA A
Sbjct: 120 ENILASIEQLLADA 133

>Suva_3.79 Chr3 (114117..114221) [105 bp, 35 aa] {ON} YCR040W (REAL)
          Length = 35

 Score = 30.0 bits (66), Expect = 0.36,   Method: Composition-based stats.
 Identities = 11/17 (64%), Positives = 14/17 (82%)

Query: 174 AQQFNFVKPKCGFVEWV 190
           AQQ+NF+ P  GFVEW+
Sbjct: 16  AQQYNFINPGFGFVEWL 32

>YDR416W Chr4 (1298432..1301011) [2580 bp, 859 aa] {ON}  SYF1Member
           of the NineTeen Complex (NTC) that contains Prp19p and
           stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs; null
           mutant has splicing defect and arrests in G2/M; homologs
           in human and C. elegans
          Length = 859

 Score = 30.8 bits (68), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/85 (22%), Positives = 40/85 (47%), Gaps = 1/85 (1%)

Query: 29  PTLQDTTQTSKCIAGKCIEDQQVN-VFMTVSKLIKIPSPPEVLLRKIEEEKHKLKKDDFN 87
           P ++D  +     A + ++ + V   F  +   + +P+ PE+LL K +    K+      
Sbjct: 479 PYIEDLEEIYLNWADRELDKEGVERAFSILEDALHVPTNPEILLEKYKNGHRKIPAQTVL 538

Query: 88  MDNILLWDPYVYWGEGYFFSIADSS 112
            +++ +W  Y+ + E Y    A+SS
Sbjct: 539 FNSLRIWSKYIDYLEAYCPKDANSS 563

>TBLA0E01530 Chr5 complement(350957..354367) [3411 bp, 1136 aa] {ON}
            Anc_4.34 YHL023C
          Length = 1136

 Score = 30.0 bits (66), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 5/60 (8%)

Query: 44   KCIEDQQVNVFMTVSKLIKI---PSPPEVLLRKIEEEKHKLKKDDFNMDNILLWDPYVYW 100
            KCI+DQ  ++ M  +KL+K     +P EV++ +    +H +KK   NM   L+   Y +W
Sbjct: 1079 KCIQDQPSDIQMIFNKLLKYFNGRTPMEVVILRENVSRHDIKKLMKNMHKYLM--EYHHW 1136

>NCAS0G01140 Chr7 (203105..204601) [1497 bp, 498 aa] {ON} Anc_6.273
           YPL245W
          Length = 498

 Score = 29.3 bits (64), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 1/29 (3%)

Query: 164 PEQQKIWDTFAQQFNFVKPKCGFVEWVDQ 192
           PE +K W T  QQF    PK   + W+DQ
Sbjct: 277 PESKKEWYTLRQQFRVAAPK-DVLNWIDQ 304

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,753,287
Number of extensions: 975946
Number of successful extensions: 2795
Number of sequences better than 10.0: 44
Number of HSP's gapped: 2806
Number of HSP's successfully gapped: 53
Length of query: 200
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 96
Effective length of database: 41,556,135
Effective search space: 3989388960
Effective search space used: 3989388960
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)