Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F15818g1.121ON22522511161e-156
ZYRO0F18568g1.2ON22522511161e-156
Kpol_2002.31.2ON2232193972e-47
TPHA0E040701.2ON2312303233e-36
TPHA0E036101.121ON2312303233e-36
Suva_3.1471.2ON2102163162e-35
YCR039C (MATALPHA2)1.121ON2102163162e-35
YCL067C (HMLALPHA2)1.2ON2102163162e-35
Skud_3.1181.121ON2102163162e-35
Suva_3.135singletonON1191022848e-32
Suva_3.74singletonON1191022848e-32
Suva_3.751.121ON1191022848e-32
YCR096C (HMRA2)singletonOFF1191022848e-32
NCAS0B091401.2ON2052202918e-32
Skud_102.1singletonON1851472882e-31
Smik_95.1singletonON1851472882e-31
Ecym_11151.121ON2301652902e-31
Ecym_10021.2ON2301652902e-31
Smik_3.1421.121ON2281472867e-31
NDAI0A001101.2ON2112232692e-28
KAFR0D007201.121ON2062162612e-27
TBLA0A070501.121ON2612432452e-24
KNAG0C001601.2ON2032162386e-24
TBLA0A076001.2ON2302292353e-23
TDEL0C070001.2ON2371802196e-21
CAGL0B01265g1.121ON1862072019e-19
CAGL0B00264g1.2ON2102141993e-18
KLLA0C00374g1.2ON223921574e-12
Kwal_YGOB_matalpha21.121ON110741427e-11
Kwal_33.12995singletonOFF110741427e-11
Kwal_YGOB_HMalpha21.2ON110741427e-11
Kwal_33.matalpha2singletonOFF110741427e-11
KLTH0F00396g1.2ON108491083e-06
NDAI0F021706.170ON383891136e-06
TDEL0F018106.170ON256921072e-05
Skud_16.1036.170ON295661054e-05
Ecym_22476.170ON349831065e-05
YPL177C (CUP9)6.170ON306661055e-05
ZYRO0G22044g6.170ON2011151035e-05
Suva_16.1326.170ON292661046e-05
Smik_6.3746.170ON294651047e-05
Kpol_1036.566.170ON2651121039e-05
KLTH0H05236g6.170ON234521011e-04
NCAS0H011306.170ON280631011e-04
YGL096W (TOS8)6.170ON276791012e-04
Kwal_27.110926.170ON22968958e-04
CAGL0C01551g6.170ON22165958e-04
AFL049C6.170ON25763950.001
Smik_7.1816.170ON27452950.001
SAKL0A05610g6.170ON32063950.001
KNAG0M005006.170ON29866940.001
KAFR0G036506.170ON17752920.001
KLLA0B10450g6.170ON38952940.002
Skud_7.1816.170ON27463920.002
NDAI0I013206.170ON40963900.005
Suva_7.1726.170ON27060890.005
CAGL0H02959g6.170ON25952870.010
TBLA0C037406.170ON29352870.010
KAFR0A043706.170ON40963860.016
TPHA0B025806.170ON26470800.064
KNAG0F022106.170ON32465780.13
NCAS0D035706.170ON25752740.45
CAGL0E00341gna 1ON13069662.2
Kpol_478.85.190ON202255683.5
TBLA0H021005.190ON218455665.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F18568g
         (225 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F15818g Chr6 complement(1302816..1303493) [678 bp, 225 aa] ...   434   e-156
ZYRO0F18568g Chr6 complement(1532755..1533432) [678 bp, 225 aa] ...   434   e-156
Kpol_2002.3 s2002 (4682..5353) [672 bp, 223 aa] {ON} (4682..5353...   157   2e-47
TPHA0E04070 Chr5 complement(848980..849613,849670..849731) [696 ...   129   3e-36
TPHA0E03610 Chr5 complement(765003..765636,765693..765754) [696 ...   129   3e-36
Suva_3.147 Chr3 complement(221912..222544) [633 bp, 210 aa] {ON}...   126   2e-35
YCR039C Chr3 complement(199546..200178) [633 bp, 210 aa] {ON}  M...   126   2e-35
YCL067C Chr3 complement(12386..13018) [633 bp, 210 aa] {ON}  HML...   126   2e-35
Skud_3.118 Chr3 complement(184042..184674) [633 bp, 210 aa] {ON}...   126   2e-35
Suva_3.135 Chr3 complement(211196..211555) [360 bp, 119 aa] {ON}...   114   8e-32
Suva_3.74 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON} ...   114   8e-32
Suva_3.75 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON} ...   114   8e-32
YCR096C Chr3 complement(293179..293538) [360 bp, 119 aa] {OFF}  ...   114   8e-32
NCAS0B09140 Chr2 complement(1754708..1755325) [618 bp, 205 aa] {...   116   8e-32
Skud_102.1 Chr102 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)       115   2e-31
Smik_95.1 Chr95 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)         115   2e-31
Ecym_1115 Chr1 (237261..237485,237542..238009) [693 bp, 230 aa] ...   116   2e-31
Ecym_1002 Chr1 complement(5334..5801,5858..6082) [693 bp, 230 aa...   116   2e-31
Smik_3.142 Chr3 complement(197575..198261) [687 bp, 228 aa] {ON}...   114   7e-31
NDAI0A00110 Chr1 (1584..2219) [636 bp, 211 aa] {ON} Anc_1.2  sil...   108   2e-28
KAFR0D00720 Chr4 (128684..129304) [621 bp, 206 aa] {ON}  mating ...   105   2e-27
TBLA0A07050 Chr1 (1728941..1729002,1729096..1729189,1729249..172...    99   2e-24
KNAG0C00160 Chr3 (25548..26159) [612 bp, 203 aa] {ON} Anc_1.2 YC...    96   6e-24
TBLA0A07600 Chr1 (1882710..1882771,1882865..1882958,1883018..188...    95   3e-23
TDEL0C07000 Chr3 complement(1273613..1274326) [714 bp, 237 aa] {...    89   6e-21
CAGL0B01265g Chr2 (113719..114279) [561 bp, 186 aa] {ON} similar...    82   9e-19
CAGL0B00264g Chr2 (11470..12102) [633 bp, 210 aa] {ON} highly si...    81   3e-18
KLLA0C00374g Chr3 (25132..25803) [672 bp, 223 aa] {ON} uniprot|Q...    65   4e-12
Kwal_YGOB_matalpha2 s33 (284511..284843) [333 bp, 110 aa] {ON} (...    59   7e-11
Kwal_33.12995 s33 (32369..32701) [333 bp, 110 aa] {OFF} YCR096C ...    59   7e-11
Kwal_YGOB_HMalpha2 s33 (32369..32701) [333 bp, 110 aa] {ON} ANNO...    59   7e-11
Kwal_33.matalpha2 s33 (284511..284843) [333 bp, 110 aa] {OFF} (m...    59   7e-11
KLTH0F00396g Chr6 (31990..32051,32348..32612) [327 bp, 108 aa] {...    46   3e-06
NDAI0F02170 Chr6 (527340..528491) [1152 bp, 383 aa] {ON} Anc_6.1...    48   6e-06
TDEL0F01810 Chr6 complement(338066..338836) [771 bp, 256 aa] {ON...    46   2e-05
Skud_16.103 Chr16 complement(185398..186285) [888 bp, 295 aa] {O...    45   4e-05
Ecym_2247 Chr2 complement(486469..487518) [1050 bp, 349 aa] {ON}...    45   5e-05
YPL177C Chr16 complement(213042..213962) [921 bp, 306 aa] {ON}  ...    45   5e-05
ZYRO0G22044g Chr7 (1814345..1814950) [606 bp, 201 aa] {ON} some ...    44   5e-05
Suva_16.132 Chr16 complement(222346..223224) [879 bp, 292 aa] {O...    45   6e-05
Smik_6.374 Chr6 (610093..610977) [885 bp, 294 aa] {ON} YPL177C (...    45   7e-05
Kpol_1036.56 s1036 (153997..154794) [798 bp, 265 aa] {ON} (15399...    44   9e-05
KLTH0H05236g Chr8 complement(465998..466702) [705 bp, 234 aa] {O...    44   1e-04
NCAS0H01130 Chr8 complement(216012..216854) [843 bp, 280 aa] {ON...    44   1e-04
YGL096W Chr7 (325331..326161) [831 bp, 276 aa] {ON}  TOS8Homeodo...    44   2e-04
Kwal_27.11092 s27 (635052..635741) [690 bp, 229 aa] {ON} YPL177C...    41   8e-04
CAGL0C01551g Chr3 complement(169232..169897) [666 bp, 221 aa] {O...    41   8e-04
AFL049C Chr6 complement(346546..347319) [774 bp, 257 aa] {ON} Sy...    41   0.001
Smik_7.181 Chr7 (319819..320643) [825 bp, 274 aa] {ON} YGL096W (...    41   0.001
SAKL0A05610g Chr1 complement(506437..507399) [963 bp, 320 aa] {O...    41   0.001
KNAG0M00500 Chr13 complement(79067..79963) [897 bp, 298 aa] {ON}...    41   0.001
KAFR0G03650 Chr7 (752766..753299) [534 bp, 177 aa] {ON} Anc_6.17...    40   0.001
KLLA0B10450g Chr2 (912877..914046) [1170 bp, 389 aa] {ON} some s...    41   0.002
Skud_7.181 Chr7 (328628..329449) [822 bp, 274 aa] {ON} YGL096W (...    40   0.002
NDAI0I01320 Chr9 complement(318160..319389) [1230 bp, 409 aa] {O...    39   0.005
Suva_7.172 Chr7 (319317..320129) [813 bp, 270 aa] {ON} YGL096W (...    39   0.005
CAGL0H02959g Chr8 (277540..278319) [780 bp, 259 aa] {ON} some si...    38   0.010
TBLA0C03740 Chr3 complement(892360..893241) [882 bp, 293 aa] {ON...    38   0.010
KAFR0A04370 Chr1 complement(870590..871819) [1230 bp, 409 aa] {O...    38   0.016
TPHA0B02580 Chr2 (592073..592867) [795 bp, 264 aa] {ON} Anc_6.17...    35   0.064
KNAG0F02210 Chr6 complement(423243..424217) [975 bp, 324 aa] {ON...    35   0.13 
NCAS0D03570 Chr4 (664388..665161) [774 bp, 257 aa] {ON} Anc_6.17...    33   0.45 
CAGL0E00341g Chr5 (29668..29775,29840..30076,30143..30190) [393 ...    30   2.2  
Kpol_478.8 s478 complement(33393..38306,38308..39462) [6069 bp, ...    31   3.5  
TBLA0H02100 Chr8 (504541..511095) [6555 bp, 2184 aa] {ON}              30   5.4  

>ZYRO0F15818g Chr6 complement(1302816..1303493) [678 bp, 225 aa]
           {ON} similar to uniprot|Q6B2C0 Saccharomyces cerevisiae
           YCR039C MATALPHA2 Homeobox-domain containing protein
           which in haploid cells acts with Mcm1p to repress
           a-specific genes in diploid cells Alpha2p acts together
           with A1p to repress transcription of haploid-specific
           genes
          Length = 225

 Score =  434 bits (1116), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 215/225 (95%), Positives = 215/225 (95%)

Query: 1   MNKIPIERLLNPVHQEFPHEXXXXXXXXXXALCSKLPSENEQFEKDKAELEKILPSLNIL 60
           MNKIPIERLLNPVHQEFPHE          ALCSKLPSENEQFEKDKAELEKILPSLNIL
Sbjct: 1   MNKIPIERLLNPVHQEFPHEKLKNINNKLLALCSKLPSENEQFEKDKAELEKILPSLNIL 60

Query: 61  IRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSKPKYHLPYAAALGNTG 120
           IRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSKPKYHLPYAAALGNTG
Sbjct: 61  IRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSKPKYHLPYAAALGNTG 120

Query: 121 KEGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELMV 180
           KEGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELMV
Sbjct: 121 KEGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELMV 180

Query: 181 ETKLSGPQIKNWVSNRRRKEKSLTISFEVSELVKESKQGTEELNE 225
           ETKLSGPQIKNWVSNRRRKEKSLTISFEVSELVKESKQGTEELNE
Sbjct: 181 ETKLSGPQIKNWVSNRRRKEKSLTISFEVSELVKESKQGTEELNE 225

>ZYRO0F18568g Chr6 complement(1532755..1533432) [678 bp, 225 aa]
           {ON} similar to uniprot|Q6B2C0 Saccharomyces cerevisiae
           YCR039C MATALPHA2 Homeobox-domain containing protein
           which in haploid cells acts with Mcm1p to repress
           a-specific genes in diploid cells Alpha2p acts together
           with A1p to repress transcription of haploid-specific
           genes
          Length = 225

 Score =  434 bits (1116), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 215/225 (95%), Positives = 215/225 (95%)

Query: 1   MNKIPIERLLNPVHQEFPHEXXXXXXXXXXALCSKLPSENEQFEKDKAELEKILPSLNIL 60
           MNKIPIERLLNPVHQEFPHE          ALCSKLPSENEQFEKDKAELEKILPSLNIL
Sbjct: 1   MNKIPIERLLNPVHQEFPHEKLKNINNKLLALCSKLPSENEQFEKDKAELEKILPSLNIL 60

Query: 61  IRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSKPKYHLPYAAALGNTG 120
           IRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSKPKYHLPYAAALGNTG
Sbjct: 61  IRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSKPKYHLPYAAALGNTG 120

Query: 121 KEGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELMV 180
           KEGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELMV
Sbjct: 121 KEGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELMV 180

Query: 181 ETKLSGPQIKNWVSNRRRKEKSLTISFEVSELVKESKQGTEELNE 225
           ETKLSGPQIKNWVSNRRRKEKSLTISFEVSELVKESKQGTEELNE
Sbjct: 181 ETKLSGPQIKNWVSNRRRKEKSLTISFEVSELVKESKQGTEELNE 225

>Kpol_2002.3 s2002 (4682..5353) [672 bp, 223 aa] {ON} (4682..5353)
           [672 nt, 224 aa]
          Length = 223

 Score =  157 bits (397), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 91/219 (41%), Positives = 130/219 (59%), Gaps = 2/219 (0%)

Query: 1   MNKIPIERLLNPVHQEFPHEXXXXXXXXXXALCSKLPSENEQFEK-DKAELEKILPSLNI 59
           MNKIPI  LLNP HQE   +          +LCSK+P      E+ D  EL++IL  L  
Sbjct: 1   MNKIPINILLNPSHQENLKDKLQQINDKLTSLCSKIPGNTSGLEQEDHLELQRILLFLTT 60

Query: 60  LIRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSEL-KSKRSQFLRSKPKYHLPYAAALGN 118
           +++      ++  +V   +QLS+  S+++  +    ++  SQ  +   +  L   ++  +
Sbjct: 61  VVKNEKLDNDEIMLVRTTYQLSTTLSIMVKSLRMANENYESQTSKENSEEELTSPSSSDS 120

Query: 119 TGKEGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKEL 178
             +   VFNIVTQD +N  + + K+YRGHRLPK   +LLE W+ +N+E+PYL   S+ EL
Sbjct: 121 NDRNEFVFNIVTQDMMNKKKMNIKSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISEL 180

Query: 179 MVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELVKESK 217
           M  T LS  QIKNWVSNRRRKEKS+TIS EVS L++E K
Sbjct: 181 MKITSLSKVQIKNWVSNRRRKEKSITISPEVSRLLQELK 219

>TPHA0E04070 Chr5 complement(848980..849613,849670..849731) [696 bp,
           231 aa] {ON}   silenced copy of alpha2 at HMLalpha locus
          Length = 231

 Score =  129 bits (323), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 83/230 (36%), Positives = 135/230 (58%), Gaps = 10/230 (4%)

Query: 1   MNKIPIERLLNPVHQEFPHEXXXXXXXXXXALCSKLPSE-NEQFEKDKAELEKILPSLNI 59
           MNKIPI +LLNP       E           LC+KLP    +  E D  EL+ IL  L  
Sbjct: 1   MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTT 60

Query: 60  LIRECGSSKEDQKMVHRIHQLSSVFSLLLNEV---SELKSKRSQFLR--SKPKYHLPYAA 114
           ++++    KE+  +V   +QL +  +L++      ++ ++K ++ ++  S    +    +
Sbjct: 61  VVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQENDKENKENEIIKYESGTSDNSETNS 120

Query: 115 ALGNTGKEG----MVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYL 170
           +  ++  E     +VFN++TQD +N+ +++NK+YRGHRLPK   + LE W+  + ++PYL
Sbjct: 121 SCNSSDNEDKNSILVFNVITQDMMNNNKKNNKSYRGHRLPKKNVQYLEDWYMDHRKNPYL 180

Query: 171 QTSSMKELMVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELVKESKQGT 220
              ++K LM +T LS  Q+KNW+SNRRRKEKS+TIS EVS L++++K  T
Sbjct: 181 NEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALLRDNKTIT 230

>TPHA0E03610 Chr5 complement(765003..765636,765693..765754) [696 bp,
           231 aa] {ON} Anc_1.122 YCR039C MATalpha2 gene at MAT
           locus
          Length = 231

 Score =  129 bits (323), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 83/230 (36%), Positives = 135/230 (58%), Gaps = 10/230 (4%)

Query: 1   MNKIPIERLLNPVHQEFPHEXXXXXXXXXXALCSKLPSE-NEQFEKDKAELEKILPSLNI 59
           MNKIPI +LLNP       E           LC+KLP    +  E D  EL+ IL  L  
Sbjct: 1   MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTT 60

Query: 60  LIRECGSSKEDQKMVHRIHQLSSVFSLLLNEV---SELKSKRSQFLR--SKPKYHLPYAA 114
           ++++    KE+  +V   +QL +  +L++      ++ ++K ++ ++  S    +    +
Sbjct: 61  VVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQENDKENKENEIIKYESGTSDNSETNS 120

Query: 115 ALGNTGKEG----MVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYL 170
           +  ++  E     +VFN++TQD +N+ +++NK+YRGHRLPK   + LE W+  + ++PYL
Sbjct: 121 SCNSSDNEDKNSILVFNVITQDMMNNNKKNNKSYRGHRLPKKNVQYLEDWYMDHRKNPYL 180

Query: 171 QTSSMKELMVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELVKESKQGT 220
              ++K LM +T LS  Q+KNW+SNRRRKEKS+TIS EVS L++++K  T
Sbjct: 181 NEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALLRDNKTIT 230

>Suva_3.147 Chr3 complement(221912..222544) [633 bp, 210 aa] {ON}
           (REAL)
          Length = 210

 Score =  126 bits (316), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 87/216 (40%), Positives = 122/216 (56%), Gaps = 19/216 (8%)

Query: 1   MNKIPIERLLNP-VHQEFPHEXXXXXXXXXXALCS--KLPSENEQFEKDKAELEKILPSL 57
           MNKIPI+ LLNP +  EF               C+  KLP      E+   EL  IL  L
Sbjct: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEE--VELRDILGFL 58

Query: 58  NILIRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSKPKYHLPYAAALG 117
           +   +    S E++K++    QL++  ++LL E+  +++ RS            Y     
Sbjct: 59  SRANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSN-----------YQLTQK 107

Query: 118 NTGKEGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKE 177
           N   +G+VFN+VTQD +N   +S K YRGHR  K   R+LESWF +NIE+PYL T  ++ 
Sbjct: 108 NKSADGLVFNVVTQDMIN---KSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLEN 164

Query: 178 LMVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELV 213
           LM  T LS  QIKNWVSNRRRKEK++TI+ E+++L+
Sbjct: 165 LMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 200

>YCR039C Chr3 complement(199546..200178) [633 bp, 210 aa] {ON}
           MATALPHA2Homeobox-domain protein that, with Mcm1p,
           represses a-specific genes in haploids; acts with A1p to
           repress transcription of haploid-specific genes in
           diploids; one of two genes encoded by the MATalpha
           mating type cassette
          Length = 210

 Score =  126 bits (316), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 87/216 (40%), Positives = 122/216 (56%), Gaps = 19/216 (8%)

Query: 1   MNKIPIERLLNP-VHQEFPHEXXXXXXXXXXALCS--KLPSENEQFEKDKAELEKILPSL 57
           MNKIPI+ LLNP +  EF               C+  KLP      E+   EL  IL  L
Sbjct: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEE--VELRDILGFL 58

Query: 58  NILIRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSKPKYHLPYAAALG 117
           +   +    S E++K++    QL++  ++LL E+  +++ RS            Y     
Sbjct: 59  SRANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSN-----------YQLTQK 107

Query: 118 NTGKEGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKE 177
           N   +G+VFN+VTQD +N   +S K YRGHR  K   R+LESWF +NIE+PYL T  ++ 
Sbjct: 108 NKSADGLVFNVVTQDMIN---KSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLEN 164

Query: 178 LMVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELV 213
           LM  T LS  QIKNWVSNRRRKEK++TI+ E+++L+
Sbjct: 165 LMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 200

>YCL067C Chr3 complement(12386..13018) [633 bp, 210 aa] {ON}
           HMLALPHA2Silenced copy of ALPHA2 at HML; homeobox-domain
           protein that associates with Mcm1p in haploid cells to
           repress a-specific gene expression and interacts with
           a1p in diploid cells to repress haploid-specific gene
           expression
          Length = 210

 Score =  126 bits (316), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 87/216 (40%), Positives = 122/216 (56%), Gaps = 19/216 (8%)

Query: 1   MNKIPIERLLNP-VHQEFPHEXXXXXXXXXXALCS--KLPSENEQFEKDKAELEKILPSL 57
           MNKIPI+ LLNP +  EF               C+  KLP      E+   EL  IL  L
Sbjct: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEE--VELRDILGFL 58

Query: 58  NILIRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSKPKYHLPYAAALG 117
           +   +    S E++K++    QL++  ++LL E+  +++ RS            Y     
Sbjct: 59  SRANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSN-----------YQLTQK 107

Query: 118 NTGKEGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKE 177
           N   +G+VFN+VTQD +N   +S K YRGHR  K   R+LESWF +NIE+PYL T  ++ 
Sbjct: 108 NKSADGLVFNVVTQDMIN---KSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLEN 164

Query: 178 LMVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELV 213
           LM  T LS  QIKNWVSNRRRKEK++TI+ E+++L+
Sbjct: 165 LMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 200

>Skud_3.118 Chr3 complement(184042..184674) [633 bp, 210 aa] {ON}
           YCR039C (REAL)
          Length = 210

 Score =  126 bits (316), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 87/216 (40%), Positives = 122/216 (56%), Gaps = 19/216 (8%)

Query: 1   MNKIPIERLLNP-VHQEFPHEXXXXXXXXXXALCS--KLPSENEQFEKDKAELEKILPSL 57
           MNKIPI+ LLNP +  EF               C+  KLP      E+   EL  IL  L
Sbjct: 1   MNKIPIKDLLNPQITDEFKSNILDINKKLFSICCNLPKLPESVTTEEE--VELRDILGFL 58

Query: 58  NILIRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSKPKYHLPYAAALG 117
           +   +    S E++K++    QL++  ++LL E+  +++ RS            Y     
Sbjct: 59  SRANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSN-----------YQLTQK 107

Query: 118 NTGKEGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKE 177
           N   +G+VFN+VTQD +N   +S K YRGHR  K   R+LESWF +NIE+PYL T  ++ 
Sbjct: 108 NKSADGLVFNVVTQDMIN---KSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLEN 164

Query: 178 LMVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELV 213
           LM  T LS  QIKNWVSNRRRKEK++TI+ E+++L+
Sbjct: 165 LMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 200

>Suva_3.135 Chr3 complement(211196..211555) [360 bp, 119 aa] {ON}
           YCR096C (REAL)
          Length = 119

 Score =  114 bits (284), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 55/102 (53%), Positives = 72/102 (70%), Gaps = 3/102 (2%)

Query: 112 YAAALGNTGKEGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQ 171
           Y     N   +G+VFN+VTQD +N   +S K YRGHR  K   R+LESWF +NIE+PYL 
Sbjct: 11  YQLTQKNKSADGLVFNVVTQDMIN---KSTKPYRGHRFTKENVRILESWFAKNIENPYLD 67

Query: 172 TSSMKELMVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELV 213
           T  ++ LM  T LS  QIKNWVSNRRRKEK++TI+ E+++L+
Sbjct: 68  TKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 109

>Suva_3.74 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON}
           YCR039C (REAL)
          Length = 119

 Score =  114 bits (284), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 55/102 (53%), Positives = 72/102 (70%), Gaps = 3/102 (2%)

Query: 112 YAAALGNTGKEGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQ 171
           Y     N   +G+VFN+VTQD +N   +S K YRGHR  K   R+LESWF +NIE+PYL 
Sbjct: 11  YQLTQKNKSADGLVFNVVTQDMIN---KSTKPYRGHRFTKENVRILESWFAKNIENPYLD 67

Query: 172 TSSMKELMVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELV 213
           T  ++ LM  T LS  QIKNWVSNRRRKEK++TI+ E+++L+
Sbjct: 68  TKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 109

>Suva_3.75 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON}
           YCL067C (REAL)
          Length = 119

 Score =  114 bits (284), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 55/102 (53%), Positives = 72/102 (70%), Gaps = 3/102 (2%)

Query: 112 YAAALGNTGKEGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQ 171
           Y     N   +G+VFN+VTQD +N   +S K YRGHR  K   R+LESWF +NIE+PYL 
Sbjct: 11  YQLTQKNKSADGLVFNVVTQDMIN---KSTKPYRGHRFTKENVRILESWFAKNIENPYLD 67

Query: 172 TSSMKELMVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELV 213
           T  ++ LM  T LS  QIKNWVSNRRRKEK++TI+ E+++L+
Sbjct: 68  TKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 109

>YCR096C Chr3 complement(293179..293538) [360 bp, 119 aa] {OFF}
           HMRA2Silenced copy of a2 at HMR; similarity to Alpha2p;
           required along with a1p for inhibiting expression of the
           HO endonuclease in a/alpha HO/HO diploid cells with an
           active mating-type interconversion system
          Length = 119

 Score =  114 bits (284), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 55/102 (53%), Positives = 72/102 (70%), Gaps = 3/102 (2%)

Query: 112 YAAALGNTGKEGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQ 171
           Y     N   +G+VFN+VTQD +N   +S K YRGHR  K   R+LESWF +NIE+PYL 
Sbjct: 11  YQLTQKNKSADGLVFNVVTQDMIN---KSTKPYRGHRFTKENVRILESWFAKNIENPYLD 67

Query: 172 TSSMKELMVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELV 213
           T  ++ LM  T LS  QIKNWVSNRRRKEK++TI+ E+++L+
Sbjct: 68  TKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 109

>NCAS0B09140 Chr2 complement(1754708..1755325) [618 bp, 205 aa] {ON}
           Anc_1.2
          Length = 205

 Score =  116 bits (291), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 79/220 (35%), Positives = 120/220 (54%), Gaps = 18/220 (8%)

Query: 1   MNKIPIERLLNPVHQEFPHEXXXXXXXXXXALCSKLPS-ENEQFEKDKAELEKILPSLNI 59
           MNKI I  LLNP +    HE           +CS  P+ EN  F+  + +L  I  +L+ 
Sbjct: 1   MNKIAIHDLLNPPNTTKTHEQLESINTQLNTICSVFPTTENLDFKTYQEQLRNIAVTLSS 60

Query: 60  LIRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSKPKYHLPYAAALGNT 119
           L  +   S E++ ++   +Q+SSV   LL E +  K +             P     G+ 
Sbjct: 61  LTNQNELSSENKNVLRVTYQISSVLLKLLGENAHNKDQ-------------PKTPTSGSE 107

Query: 120 GKEG--MVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKE 177
            +    +VFNI+T+  ++    SN+  RGHRL K    LLE W+ +++++PYL  +S++ 
Sbjct: 108 SERNPKLVFNILTKKRMSPT--SNEPRRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQM 165

Query: 178 LMVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELVKESK 217
           LM ET LS  QIKNWVSNRRRKEKSL+I+ E+ +++ + K
Sbjct: 166 LMQETSLSKMQIKNWVSNRRRKEKSLSIAPEIVDILNKQK 205

>Skud_102.1 Chr102 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)
          Length = 185

 Score =  115 bits (288), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 94/147 (63%), Gaps = 14/147 (9%)

Query: 67  SKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSKPKYHLPYAAALGNTGKEGMVF 126
           S E++K++    QL++  ++LL E+  +++ RS            Y     N   +G+VF
Sbjct: 43  SDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSN-----------YQLTQKNKSADGLVF 91

Query: 127 NIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSG 186
           N+VTQD +N   +S K YRGHR  K   R+LESWF +NIE+PYL T  ++ LM  T LS 
Sbjct: 92  NVVTQDMIN---KSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSR 148

Query: 187 PQIKNWVSNRRRKEKSLTISFEVSELV 213
            QIKNWVSNRRRKEK++TI+ E+++L+
Sbjct: 149 IQIKNWVSNRRRKEKTITIAPELADLL 175

>Smik_95.1 Chr95 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)
          Length = 185

 Score =  115 bits (288), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 94/147 (63%), Gaps = 14/147 (9%)

Query: 67  SKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSKPKYHLPYAAALGNTGKEGMVF 126
           S E++K++    QL++  ++LL E+  +++ RS            Y     N   +G+VF
Sbjct: 43  SDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSN-----------YQLTQKNKSADGLVF 91

Query: 127 NIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSG 186
           N+VTQD +N   +S K YRGHR  K   R+LESWF +NIE+PYL T  ++ LM  T LS 
Sbjct: 92  NVVTQDMIN---KSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSR 148

Query: 187 PQIKNWVSNRRRKEKSLTISFEVSELV 213
            QIKNWVSNRRRKEK++TI+ E+++L+
Sbjct: 149 IQIKNWVSNRRRKEKTITIAPELADLL 175

>Ecym_1115 Chr1 (237261..237485,237542..238009) [693 bp, 230 aa]
           {ON} similar to YCL067C HMLALPHA2, 1-intron
          Length = 230

 Score =  116 bits (290), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 104/165 (63%), Gaps = 7/165 (4%)

Query: 50  LEKILPSLNILIRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSKPKYH 109
           L K+L  L IL  +   SK D+ ++  I QL+++   L+N+  ++ + +   +  K    
Sbjct: 70  LNKVLQGLKILSSDQVFSKPDRVVIQNISQLTAIIVRLVNKKEDIINLQKGLVDPK---E 126

Query: 110 LPYAAALGNTGKEGMVFNIVTQDTLNSARRS-NKTYRGHRLPKHITRLLESWFNRNIEHP 168
           +P A +     K G++FN+VTQD + + R+  + +Y+GHRLPK   +LLESW+  NIE+P
Sbjct: 127 IPEAIS---KEKCGIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENP 183

Query: 169 YLQTSSMKELMVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELV 213
           YL  + ++ LM ET  S  Q+KNWV+N+RRK+K  TIS E+S+L+
Sbjct: 184 YLNDTDIRILMRETGFSRSQVKNWVANKRRKDKHSTISPELSDLL 228

>Ecym_1002 Chr1 complement(5334..5801,5858..6082) [693 bp, 230 aa]
           {ON} similar to Saccharomyces cerevisiae YCL067C
           HMLALPHA2; 1-intron
          Length = 230

 Score =  116 bits (290), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 104/165 (63%), Gaps = 7/165 (4%)

Query: 50  LEKILPSLNILIRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSKPKYH 109
           L K+L  L IL  +   SK D+ ++  I QL+++   L+N+  ++ + +   +  K    
Sbjct: 70  LNKVLQGLKILSSDQVFSKPDRVVIQNISQLTAIIVRLVNKKEDIINLQKGLVDPK---E 126

Query: 110 LPYAAALGNTGKEGMVFNIVTQDTLNSARRS-NKTYRGHRLPKHITRLLESWFNRNIEHP 168
           +P A +     K G++FN+VTQD + + R+  + +Y+GHRLPK   +LLESW+  NIE+P
Sbjct: 127 IPEAIS---KEKCGIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENP 183

Query: 169 YLQTSSMKELMVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELV 213
           YL  + ++ LM ET  S  Q+KNWV+N+RRK+K  TIS E+S+L+
Sbjct: 184 YLNDTDIRILMRETGFSRSQVKNWVANKRRKDKHSTISPELSDLL 228

>Smik_3.142 Chr3 complement(197575..198261) [687 bp, 228 aa] {ON}
           YCL067C (REAL)
          Length = 228

 Score =  114 bits (286), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 94/147 (63%), Gaps = 14/147 (9%)

Query: 67  SKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSKPKYHLPYAAALGNTGKEGMVF 126
           S E++K++    QL++  ++LL E+  +++ RS            Y     N   +G+VF
Sbjct: 86  SDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSN-----------YQLTQKNKSADGLVF 134

Query: 127 NIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSG 186
           N+VTQD +N   +S K YRGHR  K   R+LESWF +NIE+PYL T  ++ LM  T LS 
Sbjct: 135 NVVTQDMIN---KSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSR 191

Query: 187 PQIKNWVSNRRRKEKSLTISFEVSELV 213
            QIKNWVSNRRRKEK++TI+ E+++L+
Sbjct: 192 IQIKNWVSNRRRKEKTITIAPELADLL 218

>NDAI0A00110 Chr1 (1584..2219) [636 bp, 211 aa] {ON} Anc_1.2  silent
           copy of MATalpha2 gene at HMLalpha
          Length = 211

 Score =  108 bits (269), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 74/223 (33%), Positives = 109/223 (48%), Gaps = 28/223 (12%)

Query: 1   MNKIPIERLLNPVHQEFPHEXXXXXXXXXXALCSKLPSENEQFEKD-KAELEKILPSLNI 59
           MNKI I  LLNP                   +CSK P+  E  +   + +L  I+  L+ 
Sbjct: 1   MNKIAISDLLNPPTAGPVTSNLDSINNQLVTICSKFPTAKENVDGSYQIQLHNIVSFLST 60

Query: 60  LIRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQF---------LRSKPKYHL 110
           L +    + +D   +   ++LSS+   +L ++  L                L +  KY  
Sbjct: 61  LTQSTNLTSKDCSNIQLTYELSSMLGKVLKDMVLLNGTEEVEKKKVKEEEELETNSKY-- 118

Query: 111 PYAAALGNTGKEGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYL 170
                         VFN++TQD +   +  NK +RGHRLPK     LE W+  +I+ PYL
Sbjct: 119 --------------VFNVITQDMMIPEK--NKPHRGHRLPKEKVNRLEHWYLAHIQKPYL 162

Query: 171 QTSSMKELMVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELV 213
            + ++K LM ETKLS  QIKNW+SNRRRKEK L+IS ++ E++
Sbjct: 163 DSKNLKVLMEETKLSKVQIKNWISNRRRKEKLLSISPDIVEII 205

>KAFR0D00720 Chr4 (128684..129304) [621 bp, 206 aa] {ON}  mating
           type gene MATalpha2
          Length = 206

 Score =  105 bits (261), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 72/216 (33%), Positives = 108/216 (50%), Gaps = 13/216 (6%)

Query: 1   MNKIPIERLLNPVHQEFPHEXXXXXXXXXXALCSKLPSENEQFEKD-KAELEKILPSLNI 59
           MNKI I+ LLN        +          ALCSKLPS     E +   EL  I+ +L+ 
Sbjct: 1   MNKIQIQDLLNSPRDVDTKQELRDINDKLFALCSKLPSSEALLEAEFHLELRDIMLNLSK 60

Query: 60  LIRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSKPKYHLPYAAALGNT 119
           L        E++ + +  HQL+     L+  +                      ++  + 
Sbjct: 61  LQDTSRMGSEEKHLAYTAHQLTCTMITLIKGMKNFHGTGGH-----------SYSSSKSE 109

Query: 120 GKEGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELM 179
             +  VFN+VTQD +N   R+  +YRGHR  K   ++LE W+  +I+ PYL   S + L+
Sbjct: 110 SDDKTVFNVVTQDMMN-LNRTGISYRGHRFSKENVKVLERWYTAHIDRPYLNRQSTEYLI 168

Query: 180 VETKLSGPQIKNWVSNRRRKEKSLTISFEVSELVKE 215
            +T LS  QIKNWVSNRRRKEKS+ +S E+ +L+++
Sbjct: 169 SKTGLSRVQIKNWVSNRRRKEKSVHVSPELIQLLQK 204

>TBLA0A07050 Chr1
           (1728941..1729002,1729096..1729189,1729249..1729878)
           [786 bp, 261 aa] {ON}  MATalpha2 gene at MAT locus
          Length = 261

 Score = 99.0 bits (245), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 77/243 (31%), Positives = 116/243 (47%), Gaps = 32/243 (13%)

Query: 1   MNKIPIERLLNPVHQEFPHEXXXXXXXXXXALCSKLPSENEQFEKDKAELEKILPSLNIL 60
           MNKIPI+ LLNP + E   E          ++CS+LPS     E    +L +IL  L   
Sbjct: 1   MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLPSAKSMEE---TQLSEILKFLTKT 57

Query: 61  IRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSEL-KSKRSQFLRSKPKYHL--------- 110
           I+     KE+ ++V    QLS+V S L+ E  +L +   SQ   +   +++         
Sbjct: 58  IKHEPLGKEETELVTTTVQLSTVLSSLVKEARQLHRLHHSQSTHNPRVFNVLTQHMMSNS 117

Query: 111 ------PYAAALGNTGKEGMVFNIVTQDTLNSAR------------RSNKTYRGHRLPKH 152
                 P++ +L N+         +T  +                 +   ++RGHRLPKH
Sbjct: 118 NSTSTSPHSNSLPNSPSTKKSTTPLTNPSPPYYYSSSSPKSLSPPLQHTPSHRGHRLPKH 177

Query: 153 ITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVSNRRRKEK-SLTISFEVSE 211
               LE WF  N  HPYL  S ++ L  ++ LS  Q+KNW+SNRRRKE+ SL IS  ++ 
Sbjct: 178 TLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERHSLKISNNIAS 237

Query: 212 LVK 214
           L++
Sbjct: 238 LLQ 240

>KNAG0C00160 Chr3 (25548..26159) [612 bp, 203 aa] {ON} Anc_1.2
           YCL067C silent copy of mating type alpha2 gene at HML
           locus
          Length = 203

 Score = 96.3 bits (238), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 69/216 (31%), Positives = 106/216 (49%), Gaps = 14/216 (6%)

Query: 1   MNKIPIERLLNPVHQEFPHEXXXXXXXXXXALCSKLPSENEQFEKD-KAELEKILPSLNI 59
           MN+I I+ LLN        +           +CS  P E      + + +L+ IL  L  
Sbjct: 1   MNRIEIQDLLNNQDCSSLDKDFKNINSQLLEICSNFPKELLSNHGELQMQLQGILLFLTK 60

Query: 60  LIRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSKPKYHLPYAAALGNT 119
           L+ +   S   +      +Q S + + LL    +       F   + +Y+ P       T
Sbjct: 61  LVGKNDLSVTLKNEARMTYQFSKIIASLLKSFED-------FFFERKEYNDPA------T 107

Query: 120 GKEGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELM 179
            +   VF++VTQD +N  + S +  RGHR   + T  LE W+ ++ E PYL   S+ EL 
Sbjct: 108 SENEFVFSVVTQDMMNKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRSLHELE 167

Query: 180 VETKLSGPQIKNWVSNRRRKEKSLTISFEVSELVKE 215
            +TKLS  QI+NWVSNRRRKEKS+ +S  + +L++E
Sbjct: 168 FKTKLSKMQIRNWVSNRRRKEKSIHVSPVIQDLLQE 203

>TBLA0A07600 Chr1
           (1882710..1882771,1882865..1882958,1883018..1883554)
           [693 bp, 230 aa] {ON} Anc_1.2 YCL067C silenced copy of
           alpha2 gene at HML locus
          Length = 230

 Score = 95.1 bits (235), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 71/229 (31%), Positives = 108/229 (47%), Gaps = 31/229 (13%)

Query: 1   MNKIPIERLLNPVHQEFPHEXXXXXXXXXXALCSKLPSENEQFEKDKAELEKILPSLNIL 60
           MNKIPI+ LLNP + E   E          ++CS+LPS       ++ +L +IL  L   
Sbjct: 1   MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLPSAKSM---EETQLSEILKFLTKT 57

Query: 61  IRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSEL-KSKRSQFLRSKPKYHL--------- 110
           I+     KE+ ++V    QLS+V S L+ E  +L +   SQ   +   +++         
Sbjct: 58  IKHEPLGKEETELVTTTVQLSTVLSSLVKEARQLHRLHHSQSTHNPRVFNVLTQHMMSNS 117

Query: 111 ------PYAAALGNTGKEGMVFNIVTQDTLNSAR------------RSNKTYRGHRLPKH 152
                 P++ +L N+         +T  +                 +   ++RGHRLPKH
Sbjct: 118 NSTSTSPHSNSLPNSPSTKKSTTPLTNPSPPYYYSSSSPKSLSPPLQHTPSHRGHRLPKH 177

Query: 153 ITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVSNRRRKEK 201
               LE WF  N  HPYL  S ++ L  ++ LS  Q+KNW+SNRRRKE+
Sbjct: 178 TLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226

>TDEL0C07000 Chr3 complement(1273613..1274326) [714 bp, 237 aa] {ON}
           Anc_1.122 YCR039C silenced copy of alpha2 gene at T.
           delbrueckii HML locus
          Length = 237

 Score = 89.0 bits (219), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 97/180 (53%), Gaps = 11/180 (6%)

Query: 47  KAELEKILPSLNILIRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSKP 106
           + EL+K+L SL ++       +  + ++    QLS   S++L+E  +++    QF +S+ 
Sbjct: 63  RCELKKVLSSLKVVTTNGKLEENGELLLRTTFQLSKTLSVVLSEFKKVEESNIQFHKSRD 122

Query: 107 KYHLPYAAALGNTGKEGMV--FNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRN 164
                + +    T     V  F IV  +T      + K +RGHRLP      LE WFN+N
Sbjct: 123 -----WDSERKETNLRCKVPNFEIVPLNT-KQDYSTGKRHRGHRLPSEKVEKLELWFNQN 176

Query: 165 IEHPYLQTSSMKELMVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELV---KESKQGTE 221
           I  PYL   +++ L+ ET LS  QIKNW+SNRRRK+KS  I+  +S+L+   K SK  T+
Sbjct: 177 ISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKKSAGIADTISDLLFTKKNSKTDTK 236

>CAGL0B01265g Chr2 (113719..114279) [561 bp, 186 aa] {ON} similar to
           uniprot|P01367 Saccharomyces cerevisiae YCR039c or
           uniprot|P01367 Saccharomyces cerevisiae YCL067c HMLALP2
           mating type regulatory protein
          Length = 186

 Score = 82.0 bits (201), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 61/207 (29%), Positives = 98/207 (47%), Gaps = 43/207 (20%)

Query: 3   KIPIERLLNPVHQEFPHEXXXXXXXXXXALCSKLPSENEQFEKDKAELEKILPSLNILIR 62
           +I I  LLNP+ +E   E          +LCS LP + +      +++ + L   N+  +
Sbjct: 6   RISITHLLNPIQEENLKEKLQEINNQLISLCSSLP-KRQSLPGPSSDILRFLSRNNLDPQ 64

Query: 63  ECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSKPKYHLPYAAALGNTGKE 122
           E G       ++   ++LS++ S L                                 + 
Sbjct: 65  EIG-------LIKTTYRLSTLLSKL--------------------------------REH 85

Query: 123 GMVFNIVTQDTLNSARRSN---KTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELM 179
            +VFN+VT+D L      N    +YRGHR  +   ++LE+W+  +I++PYL  +S + L 
Sbjct: 86  EIVFNVVTKDHLLKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLA 145

Query: 180 VETKLSGPQIKNWVSNRRRKEKSLTIS 206
            +T LS  QIKNWV+NRRRK+KS+ IS
Sbjct: 146 QKTNLSKIQIKNWVANRRRKQKSIYIS 172

>CAGL0B00264g Chr2 (11470..12102) [633 bp, 210 aa] {ON} highly
           similar to uniprot|P01367 Saccharomyces cerevisiae
           YCR039c or uniprot|P01367 Saccharomyces cerevisiae
           YCL067c HMLALP 2 mating type regulatory protein
          Length = 210

 Score = 81.3 bits (199), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 62/214 (28%), Positives = 102/214 (47%), Gaps = 44/214 (20%)

Query: 3   KIPIERLLNPVHQEFPHEXXXXXXXXXXALCSKLPSENEQFEKDKAELEKILPSLNILIR 62
           +I I  LLNP+ +E   E          +LCS LP + +      +++ + L   N+  +
Sbjct: 6   RISITHLLNPIQEENLKEKLQEINNQLISLCSSLP-KRQSLPGPSSDILRFLSRNNLDPQ 64

Query: 63  ECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSKPKYHLPYAAALGNTGKE 122
           E G       ++   ++LS++ S L                                 + 
Sbjct: 65  EIG-------LIKTTYRLSTLLSKL--------------------------------REH 85

Query: 123 GMVFNIVTQDTLNSARRSN---KTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELM 179
            +VFN+VT+D L      N    +YRGHR  +   ++LE+W+  +I++PYL  +S + L 
Sbjct: 86  EIVFNVVTKDHLLKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLA 145

Query: 180 VETKLSGPQIKNWVSNRRRKEKSLTIS-FEVSEL 212
            +T LS  QIKNWV+NRRRK+KS+ IS F++  +
Sbjct: 146 QKTNLSKIQIKNWVANRRRKQKSIYISLFDIHNI 179

>KLLA0C00374g Chr3 (25132..25803) [672 bp, 223 aa] {ON}
           uniprot|Q9HDS5 Kluyveromyces lactis HMLALPHA2 Mating-
           type protein ALPHA2
          Length = 223

 Score = 65.1 bits (157), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 33/92 (35%), Positives = 57/92 (61%), Gaps = 2/92 (2%)

Query: 122 EGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELMVE 181
           E +   I+TQD ++S   +N+  +G R PK   +LLE+W++ N  +PYL  + +  +   
Sbjct: 133 ESVNIKILTQDLMHS--NNNEFKKGKRFPKSHIQLLENWYSMNRRNPYLAENDLAYISKN 190

Query: 182 TKLSGPQIKNWVSNRRRKEKSLTISFEVSELV 213
           T L+  QIKNW++NRRRK+K   +S ++  ++
Sbjct: 191 TTLTKTQIKNWLANRRRKDKITEVSSDIRNIL 222

>Kwal_YGOB_matalpha2 s33 (284511..284843) [333 bp, 110 aa] {ON}
           (matalpha2) - mating type alpha2 protein [contig MAT]
           FULL
          Length = 110

 Score = 59.3 bits (142), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 45/74 (60%), Gaps = 2/74 (2%)

Query: 128 IVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGP 187
           I++   LNSA R N+  +  + P +I+  LE+WF+ N  HPYL    +  L   T LS  
Sbjct: 20  ILSFKFLNSAARGNQ--KVSKYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSK 77

Query: 188 QIKNWVSNRRRKEK 201
           QI+NW+SNRRRK K
Sbjct: 78  QIRNWMSNRRRKSK 91

>Kwal_33.12995 s33 (32369..32701) [333 bp, 110 aa] {OFF} YCR096C
           (HMRA2) - Regulatory protein MATa2p (no known function);
           sequence is the same as the last 119 residues of
           MATalpha2p [contig 123] FULL
          Length = 110

 Score = 59.3 bits (142), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 45/74 (60%), Gaps = 2/74 (2%)

Query: 128 IVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGP 187
           I++   LNSA R N+  +  + P +I+  LE+WF+ N  HPYL    +  L   T LS  
Sbjct: 20  ILSFKFLNSAARGNQ--KVSKYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSK 77

Query: 188 QIKNWVSNRRRKEK 201
           QI+NW+SNRRRK K
Sbjct: 78  QIRNWMSNRRRKSK 91

>Kwal_YGOB_HMalpha2 s33 (32369..32701) [333 bp, 110 aa] {ON}
           ANNOTATED BY YGOB - This is Kwal_33.12995
          Length = 110

 Score = 59.3 bits (142), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 45/74 (60%), Gaps = 2/74 (2%)

Query: 128 IVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGP 187
           I++   LNSA R N+  +  + P +I+  LE+WF+ N  HPYL    +  L   T LS  
Sbjct: 20  ILSFKFLNSAARGNQ--KVSKYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSK 77

Query: 188 QIKNWVSNRRRKEK 201
           QI+NW+SNRRRK K
Sbjct: 78  QIRNWMSNRRRKSK 91

>Kwal_33.matalpha2 s33 (284511..284843) [333 bp, 110 aa] {OFF}
           (matalpha2) - mating type alpha2 protein [contig MAT]
           FULL
          Length = 110

 Score = 59.3 bits (142), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 45/74 (60%), Gaps = 2/74 (2%)

Query: 128 IVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGP 187
           I++   LNSA R N+  +  + P +I+  LE+WF+ N  HPYL    +  L   T LS  
Sbjct: 20  ILSFKFLNSAARGNQ--KVSKYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSK 77

Query: 188 QIKNWVSNRRRKEK 201
           QI+NW+SNRRRK K
Sbjct: 78  QIRNWMSNRRRKSK 91

>KLTH0F00396g Chr6 (31990..32051,32348..32612) [327 bp, 108 aa] {ON}
           conserved hypothetical protein
          Length = 108

 Score = 46.2 bits (108), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 30/49 (61%)

Query: 157 LESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVSNRRRKEKSLTI 205
           LE WF  NI++PY     +  L   T LS  QI+NW+SNRRRK +  +I
Sbjct: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESI 98

>NDAI0F02170 Chr6 (527340..528491) [1152 bp, 383 aa] {ON} Anc_6.170
           YGL096W
          Length = 383

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 50/89 (56%), Gaps = 8/89 (8%)

Query: 133 TLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNW 192
           +L   RRSN       LPK   R+L SW   ++++PY  +   ++L+++T L+  Q+ NW
Sbjct: 261 SLQHGRRSN-------LPKETIRILNSWLLNHLQNPYPTSQEKRDLLIKTGLTKVQLSNW 313

Query: 193 VSNRRRKEKSLTISFEVSELVKESKQGTE 221
             N RR+ K     +E+++ +K S+  +E
Sbjct: 314 FINVRRR-KIFHDYYEMAQNMKSSQDDSE 341

>TDEL0F01810 Chr6 complement(338066..338836) [771 bp, 256 aa] {ON}
           Anc_6.170 YPL177C
          Length = 256

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 50/92 (54%), Gaps = 8/92 (8%)

Query: 134 LNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWV 193
           +++ RRSN       LPK   ++L +W   ++ +PY      +EL+++T L+  Q+ NW 
Sbjct: 128 ISNGRRSN-------LPKETVQILNTWLLDHLRNPYPTPQEKRELLIKTGLTKIQLSNWF 180

Query: 194 SNRRRKEKSLTISFEVSELVKESKQGTEELNE 225
            N RR+ K     +E++   + S + TE++ E
Sbjct: 181 INVRRR-KIFCDYYELANRNRNSSECTEQVTE 211

>Skud_16.103 Chr16 complement(185398..186285) [888 bp, 295 aa] {ON}
           YPL177C (REAL)
          Length = 295

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 37/66 (56%), Gaps = 7/66 (10%)

Query: 135 NSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVS 194
           NS RRSN       LPK   ++L +W   ++ +PY      +EL+++T L+  Q+ NW  
Sbjct: 151 NSGRRSN-------LPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFI 203

Query: 195 NRRRKE 200
           N RR++
Sbjct: 204 NVRRRK 209

>Ecym_2247 Chr2 complement(486469..487518) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii AFL049C
          Length = 349

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 38/83 (45%)

Query: 118 NTGKEGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKE 177
           +  + G     V    L S   + K +R   LPK    +L  W   + ++PY      KE
Sbjct: 199 SASQAGTAIPKVPHKALKSVEHTKKQHRRSNLPKETVDILNEWLRDHYDNPYPSPQEKKE 258

Query: 178 LMVETKLSGPQIKNWVSNRRRKE 200
           L+ +T L+  Q+ NW  N RR++
Sbjct: 259 LLKQTGLNPVQLSNWFINVRRRK 281

>YPL177C Chr16 complement(213042..213962) [921 bp, 306 aa] {ON}
           CUP9Homeodomain-containing transcriptional repressor of
           PTR2, which encodes a major peptide transporter;
           imported peptides activate ubiquitin-dependent
           proteolysis, resulting in degradation of Cup9p and
           de-repression of PTR2 transcription
          Length = 306

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 37/66 (56%), Gaps = 7/66 (10%)

Query: 135 NSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVS 194
           NS RRSN       LPK   ++L +W   ++ +PY      +EL+++T L+  Q+ NW  
Sbjct: 162 NSGRRSN-------LPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFI 214

Query: 195 NRRRKE 200
           N RR++
Sbjct: 215 NVRRRK 220

>ZYRO0G22044g Chr7 (1814345..1814950) [606 bp, 201 aa] {ON} some
           similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 201

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 53/115 (46%), Gaps = 22/115 (19%)

Query: 122 EGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELMVE 181
           EG+V +        S RRSN       LPK   ++L  W   ++ +PY      ++L+++
Sbjct: 64  EGVVSSGKNHKGSRSGRRSN-------LPKETVQILNRWLLDHLGNPYPTPQEKRDLLIK 116

Query: 182 TKLSGPQIKNWVSNRRRK--------------EKSLTISFEVSELVKESKQGTEE 222
           T L+  Q+ NW  N RR+              EKS T      E V+E+ +G+EE
Sbjct: 117 TGLTKIQLSNWFINVRRRKIFCDYYEMAHRRSEKSGT-RIVTEEAVREATRGSEE 170

>Suva_16.132 Chr16 complement(222346..223224) [879 bp, 292 aa] {ON}
           YPL177C (REAL)
          Length = 292

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 37/66 (56%), Gaps = 7/66 (10%)

Query: 135 NSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVS 194
           NS RRSN       LPK   ++L +W   ++ +PY      +EL+++T L+  Q+ NW  
Sbjct: 148 NSGRRSN-------LPKETVQVLNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFI 200

Query: 195 NRRRKE 200
           N RR++
Sbjct: 201 NVRRRK 206

>Smik_6.374 Chr6 (610093..610977) [885 bp, 294 aa] {ON} YPL177C
           (REAL)
          Length = 294

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 7/65 (10%)

Query: 135 NSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVS 194
           NS RRSN       LPK   ++L +W   ++ +PY      +EL+++T L+  Q+ NW  
Sbjct: 150 NSGRRSN-------LPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFI 202

Query: 195 NRRRK 199
           N RR+
Sbjct: 203 NVRRR 207

>Kpol_1036.56 s1036 (153997..154794) [798 bp, 265 aa] {ON}
           (153997..154794) [798 nt, 266 aa]
          Length = 265

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 52/112 (46%), Gaps = 11/112 (9%)

Query: 111 PYAAALGNTGKEGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYL 170
           PY   + N  K+ M         + + +RSN       LPK+  ++L  W   ++++PY 
Sbjct: 135 PYRNTISNVSKKSMK---KCHGIIGAGKRSN-------LPKNSVQILNQWLLNHLQNPYP 184

Query: 171 QTSSMKELMVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELVKESKQGTEE 222
                KEL+ +T L+  Q+ NW  N RR+ K  +  +++     E  +G  +
Sbjct: 185 TPQEKKELLKQTGLTKIQLSNWFINVRRR-KIFSDYYDIVNKTGERNKGNGD 235

>KLTH0H05236g Chr8 complement(465998..466702) [705 bp, 234 aa] {ON}
           some similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 234

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%)

Query: 149 LPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVSNRRRKE 200
           LPK    +L +W   ++ +PY      +EL+V+T LS  Q+ NW  N RR++
Sbjct: 109 LPKETVEILNAWLASHLNNPYPSPQEKRELLVQTGLSKVQLSNWFINVRRRK 160

>NCAS0H01130 Chr8 complement(216012..216854) [843 bp, 280 aa] {ON}
           Anc_6.170 YGL096W
          Length = 280

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 38/63 (60%), Gaps = 7/63 (11%)

Query: 138 RRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVSNRR 197
           RRSN       LPK + ++L +W   ++++PY  +   +EL+++T L+  Q+ NW  N R
Sbjct: 129 RRSN-------LPKEMVQILNTWLLNHLQNPYPTSQEKRELLIKTGLTKVQLSNWFINVR 181

Query: 198 RKE 200
           R++
Sbjct: 182 RRK 184

>YGL096W Chr7 (325331..326161) [831 bp, 276 aa] {ON}
           TOS8Homeodomain-containing protein and putative
           transcription factor found associated with chromatin;
           target of SBF transcription factor; induced during
           meiosis and under cell-damaging conditions; similar to
           Cup9p transcription factor
          Length = 276

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 38/79 (48%), Gaps = 11/79 (13%)

Query: 133 TLNSARRSNKTY---------RGHR--LPKHITRLLESWFNRNIEHPYLQTSSMKELMVE 181
           + NS R SN  Y          G R  LPK    +L  W + ++ +PY      +EL+ +
Sbjct: 174 STNSVRGSNNGYSAKEKKHKAHGKRSNLPKATVSILNKWLHEHVNNPYPTVQEKRELLAK 233

Query: 182 TKLSGPQIKNWVSNRRRKE 200
           T L+  QI NW  N RR++
Sbjct: 234 TGLTKLQISNWFINARRRK 252

>Kwal_27.11092 s27 (635052..635741) [690 bp, 229 aa] {ON} YPL177C
           (CUP9) - putative DNA binding protein which shows
           similarity in homeobox domain to human proto-oncogene
           PBX1 [contig 31] FULL
          Length = 229

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 149 LPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVSNRRRKEKSLTISFE 208
           LPK    +L +W   ++ +PY      +EL+++T LS  Q+ NW  N RR+ K  +  + 
Sbjct: 125 LPKETVDILNNWLLAHLNYPYPSPQEKRELLIKTGLSKVQLSNWFINVRRR-KVFSDYYP 183

Query: 209 VSELVKES 216
           +S  V+ S
Sbjct: 184 MSRSVQPS 191

>CAGL0C01551g Chr3 complement(169232..169897) [666 bp, 221 aa] {ON}
           similar to uniprot|P41817 Saccharomyces cerevisiae
           YPL177c CUP9
          Length = 221

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 7/65 (10%)

Query: 136 SARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVSN 195
           S RRSN       LPK   ++L  W   +I +PY      ++L+++T L+  Q+ NW  N
Sbjct: 76  SKRRSN-------LPKDTIQILNQWLLDHIHNPYPTQQEKRDLLIKTGLTKIQLSNWFIN 128

Query: 196 RRRKE 200
            RR++
Sbjct: 129 VRRRK 133

>AFL049C Chr6 complement(346546..347319) [774 bp, 257 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL177C
           (CUP9) and YGL096W (TOS8)
          Length = 257

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 33/63 (52%)

Query: 138 RRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVSNRR 197
           + + K +R   LPK    +L  W   + ++PY      KEL+ +T L+  Q+ NW  N R
Sbjct: 127 KETKKQHRRSNLPKETVDILNEWLRNHYDNPYPSPQEKKELLKQTGLNPVQLSNWFINVR 186

Query: 198 RKE 200
           R++
Sbjct: 187 RRK 189

>Smik_7.181 Chr7 (319819..320643) [825 bp, 274 aa] {ON} YGL096W
           (REAL)
          Length = 274

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%)

Query: 149 LPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVSNRRRKE 200
           LPK    +L  W   +I +PY      +EL+ +T L+  QI NW  N RR++
Sbjct: 199 LPKATVSILNKWLLEHINNPYPTVQEKRELLAKTGLTKLQISNWFINARRRK 250

>SAKL0A05610g Chr1 complement(506437..507399) [963 bp, 320 aa] {ON}
           some similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 320

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 37/63 (58%)

Query: 138 RRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVSNRR 197
           +RS+ + +   LPK   ++L +W   ++ +PY      +EL+++T L+  Q+ NW  N R
Sbjct: 202 KRSSPSNKRTNLPKETVQILNNWLLAHLHNPYPSPQEKRELLLKTGLNPVQLSNWFINVR 261

Query: 198 RKE 200
           R++
Sbjct: 262 RRK 264

>KNAG0M00500 Chr13 complement(79067..79963) [897 bp, 298 aa] {ON}
           Anc_6.170 YPL177C
          Length = 298

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 1/66 (1%)

Query: 135 NSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVS 194
            S+ R  K  R + LPK    +L  W   ++ +PY  +   +EL+++T LS  Q+ NW  
Sbjct: 170 GSSGRDRKQSR-YNLPKDTVLILNRWLLDHLHNPYPTSQEKRELLIKTGLSKIQLSNWFI 228

Query: 195 NRRRKE 200
           N RR++
Sbjct: 229 NVRRRK 234

>KAFR0G03650 Chr7 (752766..753299) [534 bp, 177 aa] {ON} Anc_6.170
           YPL177C
          Length = 177

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 32/52 (61%)

Query: 149 LPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVSNRRRKE 200
           LPK   ++L +W   ++ +PY  +   ++L+++T L+  Q+ NW  N RR++
Sbjct: 76  LPKETIQILNAWLLNHLHNPYPTSQEKRDLLIKTGLTKIQLSNWFINVRRRK 127

>KLLA0B10450g Chr2 (912877..914046) [1170 bp, 389 aa] {ON} some
           similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 389

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%)

Query: 149 LPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVSNRRRKE 200
           LPK +  +L  W  +N+ +PY      +EL+ +T L+  Q+ NW  N RR++
Sbjct: 256 LPKEVINVLNDWLLKNLHNPYPTPQVKRELLEKTGLNPVQLSNWFINVRRRK 307

>Skud_7.181 Chr7 (328628..329449) [822 bp, 274 aa] {ON} YGL096W
           (REAL)
          Length = 274

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 4/63 (6%)

Query: 142 KTYRGH----RLPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVSNRR 197
           K  +GH     LPK    +L  W   +I +PY      ++L+ +T L+  QI NW  N R
Sbjct: 188 KRLKGHGKRSNLPKATVCILNQWLLEHIHNPYPTVQEKRDLLAKTGLTKLQISNWFINAR 247

Query: 198 RKE 200
           R++
Sbjct: 248 RRK 250

>NDAI0I01320 Chr9 complement(318160..319389) [1230 bp, 409 aa] {ON}
           Anc_6.170 YGL096W
          Length = 409

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%)

Query: 138 RRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVSNRR 197
           RR   + R   LP    ++L  W   ++ +PY  T   KEL+ +T L+  Q+ NW  N R
Sbjct: 301 RRKKGSGRRSSLPITTVQILNEWLLDHLTNPYPTTQEKKELLKQTGLTKIQLSNWFINVR 360

Query: 198 RKE 200
           R++
Sbjct: 361 RRK 363

>Suva_7.172 Chr7 (319317..320129) [813 bp, 270 aa] {ON} YGL096W
           (REAL)
          Length = 270

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 4/60 (6%)

Query: 145 RGH----RLPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVSNRRRKE 200
           +GH     LP     +L  W   +I +PY      +EL+ +T L+  QI NW  N RR++
Sbjct: 193 KGHGKRSNLPGATVHILNKWLLEHINNPYPTLQEKRELLAQTGLTKLQISNWFINARRRK 252

>CAGL0H02959g Chr8 (277540..278319) [780 bp, 259 aa] {ON} some
           similarities with uniprot|P53147 Saccharomyces
           cerevisiae YGL096w TOS8
          Length = 259

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%)

Query: 149 LPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVSNRRRKE 200
           LPK   ++L  W   +I +PY       EL ++T L+  Q+ NW  N RR++
Sbjct: 168 LPKETVKILNEWLYDHINNPYPTPQEKMELSLKTGLTKIQLSNWFINVRRRK 219

>TBLA0C03740 Chr3 complement(892360..893241) [882 bp, 293 aa] {ON}
           Anc_6.170 YPL177C
          Length = 293

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%)

Query: 149 LPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVSNRRRKE 200
           LPK   ++L  W   ++ +PY       EL+V T L+  Q+ NW  N RR++
Sbjct: 182 LPKETVQILNDWLLNHLRNPYPTPKEKSELLVLTGLTKIQLSNWFINVRRRK 233

>KAFR0A04370 Chr1 complement(870590..871819) [1230 bp, 409 aa] {ON}
           Anc_6.170 YPL177C
          Length = 409

 Score = 37.7 bits (86), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 149 LPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVSNRRRKEKSLTISFE 208
           LPK   ++L +W   ++ +PY       EL+ +T L+  Q+ NW  N RR+ K  T  F+
Sbjct: 275 LPKETVQILNNWLVNHLGNPYPTAIEKNELLKQTGLTKIQLSNWFINVRRR-KVFTDYFD 333

Query: 209 VSE 211
             E
Sbjct: 334 SPE 336

>TPHA0B02580 Chr2 (592073..592867) [795 bp, 264 aa] {ON} Anc_6.170
           YPL177C
          Length = 264

 Score = 35.4 bits (80), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 36/70 (51%), Gaps = 3/70 (4%)

Query: 133 TLNSARRSNKTYRGHR--LPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGPQIK 190
           T+N+   S KT  G R  LPK    +L  W   ++ +PY      +EL+  T LS  Q+ 
Sbjct: 143 TINTQTTS-KTSIGKRSNLPKQSVDVLNKWLLNHLGNPYPTPKEKEELLELTGLSKIQLS 201

Query: 191 NWVSNRRRKE 200
           NW  N RR++
Sbjct: 202 NWFINVRRRK 211

>KNAG0F02210 Chr6 complement(423243..424217) [975 bp, 324 aa] {ON}
           Anc_6.170 YPL177C
          Length = 324

 Score = 34.7 bits (78), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 7/65 (10%)

Query: 136 SARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVSN 195
           S++RSN       LP+   ++L +W   ++  PY       EL+ +T L+  Q+ NW  N
Sbjct: 240 SSKRSN-------LPRETVQMLNNWLLNHLHDPYPTPHEKLELLRQTGLTKIQLSNWFIN 292

Query: 196 RRRKE 200
            RR++
Sbjct: 293 VRRRK 297

>NCAS0D03570 Chr4 (664388..665161) [774 bp, 257 aa] {ON} Anc_6.170
           YGL096W
          Length = 257

 Score = 33.1 bits (74), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 26/52 (50%)

Query: 149 LPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVSNRRRKE 200
           LP+    +L  W   ++ +PY      K L+  T L+  Q+ NW  N RR++
Sbjct: 187 LPRGTVEVLNGWLLEHLNNPYPNVQEKKLLLELTGLTKVQLSNWFINVRRRK 238

>CAGL0E00341g Chr5 (29668..29775,29840..30076,30143..30190) [393 bp,
           130 aa] {ON} similar to uniprot|P09091 Saccharomyces
           cerevisiae YCR097w Mating-type protein a1
          Length = 130

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 6/69 (8%)

Query: 137 ARRSNKTYRGHR-LP-KHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVS 194
            +R NKTY   + LP K   +L+E++  +     YL      +L V+  ++  Q++ W +
Sbjct: 62  CQRKNKTYTTRKPLPAKAKLQLVETFSKKR----YLTRCEKHQLAVQCGITTNQVQIWFA 117

Query: 195 NRRRKEKSL 203
           NRR++ K L
Sbjct: 118 NRRKRSKDL 126

>Kpol_478.8 s478 complement(33393..38306,38308..39462) [6069 bp, 2022
            aa] {ON} complement(33393..38306,38308..39462) [6069 nt,
            2023 aa]
          Length = 2022

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 26/55 (47%)

Query: 111  PYAAALGNTGKEGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNI 165
            PY  + G  GKE M      +  L      NK +  + LP +I+RL+   F+ N+
Sbjct: 1804 PYLNSHGEFGKEAMYMGETLKLNLKRYIHLNKIWVNNELPGYISRLMGEQFSVNL 1858

>TBLA0H02100 Chr8 (504541..511095) [6555 bp, 2184 aa] {ON} 
          Length = 2184

 Score = 30.0 bits (66), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 26/55 (47%)

Query: 111  PYAAALGNTGKEGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNI 165
            PY  + G TGK  M    +T   L      NK +  + +P +++RL+   F  NI
Sbjct: 1922 PYLNSHGETGKNAMRQGDLTTLNLKRFEHLNKLWAENEIPGYVSRLMGDDFRMNI 1976

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.129    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,707,373
Number of extensions: 913160
Number of successful extensions: 2623
Number of sequences better than 10.0: 83
Number of HSP's gapped: 2587
Number of HSP's successfully gapped: 83
Length of query: 225
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 119
Effective length of database: 41,326,803
Effective search space: 4917889557
Effective search space used: 4917889557
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 63 (28.9 bits)