Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F18524g1.3ON33533516190.0
NCAS0B091301.3ON3673338801e-117
YCL064C (CHA1)1.3ON3603318631e-114
Suva_3.1501.3ON3613378611e-114
NDAI0K02950singletonON3343318561e-113
NCAS0A15330singletonON3473398541e-113
KAFR0D001101.3ON3653338551e-113
KNAG0C001801.3ON3593308511e-112
Smik_9.2na 1ON3383368481e-112
Smik_3.121.3ON3603398491e-112
Skud_3.11.3ON3603318461e-111
ZYRO0F15774gsingletonON4103308401e-110
NDAI0A001201.3ON3773388361e-110
Skud_9.2na 1ON3393348311e-110
Scer_YGOB_SDL1 (SDL1)na 1ON3373378271e-109
TBLA0A049201.3ON3603318161e-107
SAKL0C00418g1.3ON3643328141e-107
KAFR0F04430singletonON3433348101e-106
SAKL0C13904gsingletonON3393358091e-106
TPHA0E040401.3ON3573308021e-105
CAGL0B00286g1.3ON3603287941e-104
Kpol_2002.61.3ON3503347871e-103
KNAG0D05380singletonON3343377831e-102
KLLA0E01805gsingletonON3223337603e-99
Ecym_10061.3ON3643347304e-94
TDEL0D06540singletonON3373357275e-94
KAFR0I00130singletonON3443297269e-94
AFR747W1.3ON4263317331e-93
KLTH0F00440g1.3ON3413347172e-92
KLLA0C00440g1.3ON3773316968e-89
KNAG0A01150singletonON2312245803e-73
YIL167W (SDL1)singletonOFF2102025704e-72
YIL168WsingletonOFF1271242667e-28
SAKL0F11858g7.367ON5622621728e-13
KLLA0E19779g7.367ON5672981621e-11
KAFR0K017007.367ON5792761532e-10
Kpol_530.167.367ON5662621488e-10
Suva_5.1997.367ON5762641471e-09
TPHA0F031307.367ON5682751462e-09
TDEL0C018007.367ON5692631442e-09
Ecym_47087.367ON5702801442e-09
Smik_5.2257.367ON5762631443e-09
ZYRO0B02772g7.367ON5692621433e-09
YER086W (ILV1)7.367ON5762631425e-09
Skud_5.2057.367ON5762641425e-09
KNAG0C036907.367ON5772821391e-08
ACR232C7.367ON5602721381e-08
NDAI0A018107.367ON5702621353e-08
NCAS0A142307.367ON5692751336e-08
CAGL0I05126g7.367ON5712761282e-07
TBLA0C050707.367ON5752811283e-07
Kwal_33.148227.367ON5622571256e-07
SAKL0A10626gsingletonON3202791192e-06
KLTH0B04884g7.367ON5732571151e-05
YKL218C (SRY1)na 2ON3261641086e-05
Smik_4.2073.162ON76585750.94
KNAG0J026704.69ON50034731.3
KLLA0F09317g4.69ON49350712.3
TBLA0E032306.56ON90758703.1
KLTH0B03014g5.219ON85794703.2
CAGL0C01661g6.162ON37551684.6
CAGL0E03157g4.69ON50134684.9
AGR012C4.69ON49234685.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F18524g
         (335 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} simi...   628   0.0  
NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3    343   e-117
YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}  CH...   337   e-114
Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON...   336   e-114
NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON}             334   e-113
NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON}            333   e-113
KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON} A...   333   e-113
KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}...   332   e-112
Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)      331   e-112
Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON} Y...   331   e-112
Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL0...   330   e-111
ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} simi...   328   e-110
NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON} A...   326   e-110
Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)      324   e-110
Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa...   323   e-109
TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa] ...   318   e-107
SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON...   318   e-107
KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON}              316   e-106
SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} simi...   316   e-106
TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3...   313   e-105
CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON...   310   e-104
Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON} ...   307   e-103
KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {O...   306   e-102
KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {O...   297   3e-99
Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON} si...   285   4e-94
TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON}            284   5e-94
KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}...   284   9e-94
AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic ...   286   1e-93
KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON...   280   2e-92
KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON...   272   8e-89
KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}                   228   3e-73
YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open rea...   224   4e-72
YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading ...   107   7e-28
SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly...    71   8e-13
KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]...    67   1e-11
KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7....    64   2e-10
Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}...    62   8e-10
Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W ...    61   1e-09
TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {O...    61   2e-09
TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {O...    60   2e-09
Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar...    60   2e-09
Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W ...    60   3e-09
ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly...    60   3e-09
YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threon...    59   5e-09
Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W ...    59   5e-09
KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {O...    58   1e-08
ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON} S...    58   1e-08
NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {O...    57   3e-08
NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON} Anc_7...    56   6e-08
CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {...    54   2e-07
TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON} Anc_7...    54   3e-07
Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {...    53   6e-07
SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {O...    50   2e-06
KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly...    49   1e-05
YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}  SR...    46   6e-05
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    33   0.94 
KNAG0J02670 Chr10 (497838..499340) [1503 bp, 500 aa] {ON} Anc_4....    33   1.3  
KLLA0F09317g Chr6 (861757..863238) [1482 bp, 493 aa] {ON} simila...    32   2.3  
TBLA0E03230 Chr5 complement(810836..813559) [2724 bp, 907 aa] {O...    32   3.1  
KLTH0B03014g Chr2 (235495..238068) [2574 bp, 857 aa] {ON} weakly...    32   3.2  
CAGL0C01661g Chr3 complement(177284..178411) [1128 bp, 375 aa] {...    31   4.6  
CAGL0E03157g Chr5 (291237..292742) [1506 bp, 501 aa] {ON} highly...    31   4.9  
AGR012C Chr7 complement(738927..740405) [1479 bp, 492 aa] {ON} S...    31   5.5  

>ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 335

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/335 (91%), Positives = 307/335 (91%)

Query: 1   MNNWYYKTPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKSENGLVKSH 60
           MNNWYYKTPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKSENGLVKSH
Sbjct: 1   MNNWYYKTPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKSENGLVKSH 60

Query: 61  VLXXXXXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWKEADNY 120
           VL               KQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWKEADNY
Sbjct: 61  VLSSSGGNAGLAAAIASKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWKEADNY 120

Query: 121 LQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRGIVCSV 180
           LQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRGIVCSV
Sbjct: 121 LQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRGIVCSV 180

Query: 181 XXXXXXXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLATSLGST 240
                        EDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLATSLGST
Sbjct: 181 GGGGLFNGIIKGLEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLATSLGST 240

Query: 241 YIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPELLENF 300
           YIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPELLENF
Sbjct: 241 YIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPELLENF 300

Query: 301 LGGFSKDDIIVIIACGGSTTTFKDLTIASKNFSIS 335
           LGGFSKDDIIVIIACGGSTTTFKDLTIASKNFSIS
Sbjct: 301 LGGFSKDDIIVIIACGGSTTTFKDLTIASKNFSIS 335

>NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3
          Length = 367

 Score =  343 bits (880), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 172/333 (51%), Positives = 223/333 (66%), Gaps = 9/333 (2%)

Query: 1   MNNWYYKTPLLRQI---LNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKS----E 53
           M+  Y KTPLLRQ    ++ K +T +PQ F+KYE LQP GSFKSRGIGNLI   +    +
Sbjct: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60

Query: 54  NGLVKSHVLXXXXXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSH 113
           +G     V                +++ LPCTVVVPT+TKQRMV+KI+ +GA VII G+H
Sbjct: 61  SGNKSPQVFSSSGGNAGFAAATASQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAH 120

Query: 114 WKEADNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENV 173
           WKEAD YL+ + + S  +  T++P+YVHPFD+P +WEGHSTMV EI+D L EQNI++  +
Sbjct: 121 WKEADTYLKSSVMNSI-DLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKI 179

Query: 174 RGIVCSVXXXXXXXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSL 233
           +GIVCSV             E H LADKIP++ VET GC+V N SL  G+ +   KITS+
Sbjct: 180 KGIVCSVGGGGLYNGIIQGLEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSI 239

Query: 234 ATSLGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYH 293
           ATSLG+  I    FE A +Y  +S+V+ED DVIETCL+Y  DF  + EPACGASLH+ Y+
Sbjct: 240 ATSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYN 299

Query: 294 PELLENFLG-GFSKDDIIVIIACGGSTTTFKDL 325
             +LEN LG   S DDII++IACGGS+ T +DL
Sbjct: 300 TNILENALGHKLSSDDIILVIACGGSSNTVQDL 332

>YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}
           CHA1Catabolic L-serine (L-threonine) deaminase,
           catalyzes the degradation of both L-serine and
           L-threonine; required to use serine or threonine as the
           sole nitrogen source, transcriptionally induced by
           serine and threonine
          Length = 360

 Score =  337 bits (863), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 167/331 (50%), Positives = 223/331 (67%), Gaps = 11/331 (3%)

Query: 1   MNNWYYKTPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKS-----ENG 55
           M+  Y KTPLLRQ    K +    Q F+KYE LQP GSFKSRGIGNLI +KS     ++G
Sbjct: 1   MSIVYNKTPLLRQFFPGKASA---QFFLKYECLQPSGSFKSRGIGNLI-MKSAIRIQKDG 56

Query: 56  LVKSHVLXXXXXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWK 115
                V                +++ LPCTVVVPT+TK+RMV KI+N+GA+VI+ G++WK
Sbjct: 57  KRSPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWK 116

Query: 116 EADNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRG 175
           EAD +L+ N +    +    +P+YVHPFD+P +WEGHS+M+ EI+ +L+ Q+ISV  V+G
Sbjct: 117 EADTFLKTNVMNKI-DSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKG 175

Query: 176 IVCSVXXXXXXXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLAT 235
           IVCSV             E +GLAD+IP++ VET GC+V N SL  G+PV   KITS+AT
Sbjct: 176 IVCSVGGGGLYNGIIQGLERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIAT 235

Query: 236 SLGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPE 295
           SLG+  I    FE A +Y  +S+V+EDKDVIETCL+Y   F  ++EPACGA+LH+GY+ +
Sbjct: 236 SLGTAVISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTK 295

Query: 296 LLENFLGG-FSKDDIIVIIACGGSTTTFKDL 325
           +LEN LG   + DDI++IIACGGS+ T KDL
Sbjct: 296 ILENALGSKLAADDIVIIIACGGSSNTIKDL 326

>Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON}
           YCL064C (REAL)
          Length = 361

 Score =  336 bits (861), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 172/337 (51%), Positives = 225/337 (66%), Gaps = 13/337 (3%)

Query: 1   MNNWYYKTPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKS-----ENG 55
           M+  Y KTPLLRQ    K+   L Q ++KYE LQP GSFKSRGIGNLI LK+     +NG
Sbjct: 1   MSIVYNKTPLLRQFFPGKS---LAQFYLKYECLQPSGSFKSRGIGNLI-LKNAIRIQKNG 56

Query: 56  LVKSHVLXXXXXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWK 115
                V                +++ LPCTVVVPT+TK+RMV+KI+N+GA+VI+ G+ WK
Sbjct: 57  KRSPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWK 116

Query: 116 EADNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRG 175
           EAD YL+ N + +  +    +P+YVHPFD+P +WEGHS+MV EI+ +L+ Q + +E V+G
Sbjct: 117 EADTYLKTN-VMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKG 175

Query: 176 IVCSVXXXXXXXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLAT 235
           IVCSV             E HGLADKIP++ VET GC+V N SL  G+PV   KITS+AT
Sbjct: 176 IVCSVGGGGLYNGIIQGLERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIAT 235

Query: 236 SLGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPE 295
           SLG+  I    FE A +Y  KS+V+EDKDVIETCL+Y   F  + EPACGA+LH+GYH +
Sbjct: 236 SLGTANISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTD 295

Query: 296 LLENFLG-GFSKDDIIVIIACGGSTTTFKDL--TIAS 329
           +LE  L    + DDI++IIACGGS+ T +DL  T+AS
Sbjct: 296 ILETALDTKLAADDIVLIIACGGSSNTVQDLEETLAS 332

>NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  334 bits (856), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 166/331 (50%), Positives = 222/331 (67%), Gaps = 11/331 (3%)

Query: 1   MNNWYYKTPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLI-----SLKSENG 55
           M+  Y KTPLLRQ  +       P+IF+KYENLQP GSFKSRGIG LI      LK ++G
Sbjct: 1   MSFIYNKTPLLRQTFDSAKIG--PRIFLKYENLQPSGSFKSRGIGCLILQHINKLK-QDG 57

Query: 56  LVKSHVLXXXXXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWK 115
              +HV                + +++PCTVVVP STK+RMV KI+ +GA V+I+G HWK
Sbjct: 58  NKTAHVFSSSGGNAGLAAATASRSLQVPCTVVVPKSTKERMVNKIRKTGASVLIKGDHWK 117

Query: 116 EADNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRG 175
           EAD++L+++  +   ++   +P+YVHPFDDP +WEGHST++ EI+  L+ + IS+E V+G
Sbjct: 118 EADDFLRKSMKE--MDNTQEQPIYVHPFDDPVIWEGHSTIIDEIVQTLQTEKISIEKVKG 175

Query: 176 IVCSVXXXXXXXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLAT 235
           I+CSV             E H LA  IPVIAVET GC+VLN SL  G PV L KITS+AT
Sbjct: 176 IICSVGGGGLFNGIIKGLERHNLAQSIPVIAVETKGCDVLNKSLKNGTPVQLPKITSVAT 235

Query: 236 SLGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPE 295
           SLGSTYI    FENA++Y ++S+ L DKDV+ETCL+Y  DF   +EPACGAS+H+ Y+P 
Sbjct: 236 SLGSTYISSTAFENAMKYNSRSITLNDKDVLETCLKYNDDFSMTLEPACGASVHLAYNPG 295

Query: 296 LLENFLG-GFSKDDIIVIIACGGSTTTFKDL 325
           ++E+ LG   S  DI++++ CGGS+ T  DL
Sbjct: 296 IVESALGTALSNHDIVIVVLCGGSSCTLHDL 326

>NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON} 
          Length = 347

 Score =  333 bits (854), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 176/339 (51%), Positives = 222/339 (65%), Gaps = 8/339 (2%)

Query: 1   MNNWYYKTPLLRQIL-NWKTTTELPQIFIKYENLQPGGSFKSRGIGNLI---SLKSENGL 56
           M+  Y KTPLLR++          PQ+++KYE+LQP GSFKSRGIG+LI   +L+ +   
Sbjct: 1   MSLVYNKTPLLRRVFPTGLKVPSAPQLYVKYESLQPSGSFKSRGIGHLIMKNALRVQQLG 60

Query: 57  VKS-HVLXXXXXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWK 115
            KS HV                + ++LPCTVVVPTSTK RMV+KI+N G EVI++GSHWK
Sbjct: 61  GKSLHVFSSSGGNAGLAAATASQSLKLPCTVVVPTSTKSRMVEKIRNVGTEVIVKGSHWK 120

Query: 116 EADNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRG 175
           EAD++L+ + I S   D   +P+YVHPFD P VWEGHSTMV EI+D  R QN+S+  V+ 
Sbjct: 121 EADSFLKNSVIPSV--DRIEEPIYVHPFDHPDVWEGHSTMVDEIVDTFRSQNVSLNKVKA 178

Query: 176 IVCSVXXXXXXXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLAT 235
           IVCSV             E + LADKIPVIA+ET GCN  NA L A + V L KITS+AT
Sbjct: 179 IVCSVGGGGLYNGIIHGLEKYHLADKIPVIAMETDGCNSFNACLKAKKQVELPKITSVAT 238

Query: 236 SLGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPE 295
           SLG+T +    FEN  RY + S+VL+D DV+ TCL+Y +DF  I EPACGASLH+ Y+ +
Sbjct: 239 SLGATGVATKAFENGQRYQSPSVVLQDIDVVNTCLKYANDFNIITEPACGASLHMAYNTK 298

Query: 296 LLENFLG-GFSKDDIIVIIACGGSTTTFKDLTIASKNFS 333
           L+E  LG     DDIIVIIACGGS  T +DL  + K  S
Sbjct: 299 LIEKALGKKLDSDDIIVIIACGGSANTMEDLQNSYKQLS 337

>KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON}
           Anc_1.3 YCL064C
          Length = 365

 Score =  333 bits (855), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 163/333 (48%), Positives = 220/333 (66%), Gaps = 9/333 (2%)

Query: 1   MNNWYYKTPLLRQIL---NWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKS----E 53
           M+  Y KTPLLRQ       + +  LPQ F+KYE LQP GSFKSRGIGNLI  ++    +
Sbjct: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60

Query: 54  NGLVKSHVLXXXXXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSH 113
            G  +  V                +++ LPCTVVVPT+TKQRM++KIK++GA VII G+ 
Sbjct: 61  KGTKRPEVFASSGGNAGYAAAVACQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120

Query: 114 WKEADNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENV 173
           WKEAD YL+++ +    N     P+YVHPFD+P +WEGHS++V EI+D LREQ +   N+
Sbjct: 121 WKEADQYLKKSVMNKI-NKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNI 179

Query: 174 RGIVCSVXXXXXXXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSL 233
           +GIVCSV             E H L DKIPV+ VET GC+V N SL  G+ V  +KITS+
Sbjct: 180 KGIVCSVGGGGLYNGIIQGLERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEKITSI 239

Query: 234 ATSLGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYH 293
           ATSL +  I    FENA++YG +S++++D DVIETCL+Y  D+  + EPACGAS+H+ Y+
Sbjct: 240 ATSLATASISAKTFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYN 299

Query: 294 PELLENFLG-GFSKDDIIVIIACGGSTTTFKDL 325
            ++LEN LG   +KDD +V+IACGGS+ T +D+
Sbjct: 300 IDILENALGTKLTKDDTVVVIACGGSSNTLQDM 332

>KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}
           Anc_1.3 YCL064C
          Length = 359

 Score =  332 bits (851), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 163/330 (49%), Positives = 225/330 (68%), Gaps = 9/330 (2%)

Query: 1   MNNWYYKTPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLI---SLKSEN-GL 56
           M+  Y KTPLLRQ    K    LPQ+F+KYE LQP GSFKSRGIGNLI   +++ +  G 
Sbjct: 1   MSLVYNKTPLLRQFFPGK---NLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGE 57

Query: 57  VKSHVLXXXXXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWKE 116
            ++HV                +++ LPCTVVVPT+TK RMV+KI+N+GA+VI+ G+HWKE
Sbjct: 58  RRAHVFASSGGNAGFAAATACQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKE 117

Query: 117 ADNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRGI 176
           AD +L++  +    +  T++P+YVHPFD+P +WEGH+T+V EI++ L  Q I  ENV+GI
Sbjct: 118 ADQHLKKTVMSQI-DLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGI 176

Query: 177 VCSVXXXXXXXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLATS 236
           VCSV             E HGLA+KIP++ VET GC+VLN SLN  + +  +KITS+ATS
Sbjct: 177 VCSVGGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATS 236

Query: 237 LGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPEL 296
           LG+  I +  FE A +Y  +S+V++D  VIETCL+Y  DF  + EPACGA+LH+ Y+ ++
Sbjct: 237 LGTASISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDI 296

Query: 297 LENFLG-GFSKDDIIVIIACGGSTTTFKDL 325
           LE  LG   + +D+I++IACGGS+ T KDL
Sbjct: 297 LEKALGHSLTPNDVILVIACGGSSNTLKDL 326

>Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)
          Length = 338

 Score =  331 bits (848), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 173/336 (51%), Positives = 223/336 (66%), Gaps = 10/336 (2%)

Query: 5   YYKTPLLRQIL-NWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKSENGLVKSH--- 60
           Y KTPL+RQ+  N KT    P  +IK++ LQPGGSFKSRGIG+LI  K++  L +     
Sbjct: 6   YEKTPLIRQVFDNGKTN---PLFYIKHDMLQPGGSFKSRGIGHLIRKKNKEALAEGSGKL 62

Query: 61  -VLXXXXXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWKEADN 119
            V                + M L CTVVVP +TK RMV+KI+++GA+VII G HW EAD 
Sbjct: 63  VVFSSSGGNAGLAAATSCRLMALNCTVVVPKTTKSRMVKKIQSAGAKVIIHGDHWGEADE 122

Query: 120 YLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRGIVCS 179
           YL+Q  +      G SK LYVHPFDD  +WEGHST+V EI+  L+E++IS   V+G+VCS
Sbjct: 123 YLKQEVMAQEGQHG-SKTLYVHPFDDEIIWEGHSTIVDEILQQLQEKDISPLQVKGLVCS 181

Query: 180 VXXXXXXXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLATSLGS 239
           V             E + LA KIP++AVET GC+VLN SL  G PV L+++TS+ATSLGS
Sbjct: 182 VGGGGLFSGIIKGLERNRLAGKIPIVAVETAGCDVLNKSLKNGSPVALERLTSVATSLGS 241

Query: 240 TYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPELLEN 299
            YI    FE+ + YG KS+VL D+DV++TCLRY  D+  IVEPACGASLH+ YHPE+LE 
Sbjct: 242 PYIAPFAFESFITYGCKSVVLSDQDVLDTCLRYADDYNFIVEPACGASLHLCYHPEILEK 301

Query: 300 FLG-GFSKDDIIVIIACGGSTTTFKDLTIASKNFSI 334
            LG   S+DD+++IIACGGS  T++DL  ASK   +
Sbjct: 302 ALGQKLSEDDVVIIIACGGSCMTYEDLVKASKTLGV 337

>Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON}
           YCL064C (REAL)
          Length = 360

 Score =  331 bits (849), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 166/339 (48%), Positives = 226/339 (66%), Gaps = 11/339 (3%)

Query: 1   MNNWYYKTPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKS-----ENG 55
           M+  Y KTPLLRQ    K+     Q F+KYE LQP GSFKSRGIGNLI +KS     ++G
Sbjct: 1   MSIVYNKTPLLRQFFPGKSPA---QFFLKYECLQPSGSFKSRGIGNLI-MKSAIRIQKDG 56

Query: 56  LVKSHVLXXXXXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWK 115
                +                +++ LPCTVVVPT+TK+RMV+KI+N+GA+VI+ G++WK
Sbjct: 57  KKSPQIFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWK 116

Query: 116 EADNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRG 175
           EAD +L+ + +Q   +    +P+YVHPFD+P +WEGHS+MV E++ +L  Q IS+  V+G
Sbjct: 117 EADTFLKADVMQKI-DTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKG 175

Query: 176 IVCSVXXXXXXXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLAT 235
           IVCSV             E +GLADKIP++ VET GC+V N SL  G+PV   KITS+AT
Sbjct: 176 IVCSVGGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIAT 235

Query: 236 SLGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPE 295
           SLG+  I    F+ A +Y  +S+V+EDKDVI+TCL+Y   F  +VEPACGA+LH+GY+ E
Sbjct: 236 SLGTAVISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTE 295

Query: 296 LLENFLGG-FSKDDIIVIIACGGSTTTFKDLTIASKNFS 333
           +LE  LG   + DDI++IIACGGS+ T +DL  A  +F+
Sbjct: 296 ILERALGSKLAADDIVIIIACGGSSNTIQDLEEALDHFN 334

>Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL064C
           (REAL)
          Length = 360

 Score =  330 bits (846), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 167/331 (50%), Positives = 219/331 (66%), Gaps = 11/331 (3%)

Query: 1   MNNWYYKTPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKS-----ENG 55
           M+  Y KTPLLRQ    K+     Q F+KYE LQP GSFKSRGIGNLI LK+     ++G
Sbjct: 1   MSIVYNKTPLLRQFFPSKSPA---QFFLKYECLQPSGSFKSRGIGNLI-LKNAIRIQKDG 56

Query: 56  LVKSHVLXXXXXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWK 115
                V                +++ LPCTVVVPT+TK+RMV+KI+N+GA+VI+ G++WK
Sbjct: 57  RRSPQVFASSGGNAGLAAATTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWK 116

Query: 116 EADNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRG 175
           EAD +L+ N +    +    +P+YVHPFD+P +WEGHS+MV EI+ +L+ Q IS+  V+G
Sbjct: 117 EADTFLKANIMNQI-DSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKG 175

Query: 176 IVCSVXXXXXXXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLAT 235
           IVCSV             E + LADKIP++ VET GC+V N SL  G+PV   KITS+AT
Sbjct: 176 IVCSVGGGGLYNGIIQGLERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIAT 235

Query: 236 SLGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPE 295
           SLG+  I    FE A +Y  KS+V+EDKDVIETCL+Y      + EPACGA+LH+GYH E
Sbjct: 236 SLGTAVISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTE 295

Query: 296 LLENFLGG-FSKDDIIVIIACGGSTTTFKDL 325
           +LE  LG   + DDI++IIACGGS+ T +DL
Sbjct: 296 ILEKALGSKLAADDIVIIIACGGSSNTVQDL 326

>ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 410

 Score =  328 bits (840), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 161/330 (48%), Positives = 225/330 (68%), Gaps = 9/330 (2%)

Query: 1   MNNWYYKTPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKSEN----GL 56
           M + Y KTPLL+QI N  T+    Q+F+KYE LQP GSFKSRGIG+LIS ++++    G 
Sbjct: 47  MPSIYNKTPLLKQIFNHATSA---QVFVKYECLQPSGSFKSRGIGHLISKRAKDIQGDGR 103

Query: 57  VKSHVLXXXXXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWKE 116
              HV                +++ LPCTVV+PT+TKQRM  KI+  GA V+++GSHWKE
Sbjct: 104 KSPHVFSSSGGNAGYAAAVAAQKLNLPCTVVIPTTTKQRMADKIRGCGANVVVQGSHWKE 163

Query: 117 ADNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRGI 176
           AD++L+ N +Q+  N    +P+YVHPFD+P +WEGH+++V EII +L+ +N ++  V+GI
Sbjct: 164 ADSHLK-NILQNQVNMAILEPIYVHPFDNPTIWEGHASIVDEIISSLKNENTALNRVKGI 222

Query: 177 VCSVXXXXXXXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLATS 236
           VCSV             E + LA+KIP++AVET GC+VLN SL  G+ V  +K+ S+ATS
Sbjct: 223 VCSVGGGGLYNGIIQGLEKYNLANKIPLLAVETKGCHVLNTSLQVGQCVEFNKMNSVATS 282

Query: 237 LGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPEL 296
           L ++ I     +   +YG+KS+VLEDK+V++TCL+Y  +F  I EPACGASLH+GYHP+L
Sbjct: 283 LCTSQISSRTLDYVQKYGSKSIVLEDKEVLQTCLKYAENFNMITEPACGASLHLGYHPQL 342

Query: 297 LENFLG-GFSKDDIIVIIACGGSTTTFKDL 325
           +E  LG    KDD+I++IACGGS+ T  DL
Sbjct: 343 IERALGKNLDKDDVIIVIACGGSSNTILDL 372

>NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON}
           Anc_1.3
          Length = 377

 Score =  326 bits (836), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 166/338 (49%), Positives = 218/338 (64%), Gaps = 14/338 (4%)

Query: 1   MNNWYYKTPLLRQILN--------WKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKS 52
           M+  Y KTPLLRQ             + T  PQ F+KYE LQP GSFKSRGIGNLI   +
Sbjct: 1   MSVVYNKTPLLRQFFQNSVAKSSATASVTATPQFFVKYECLQPSGSFKSRGIGNLILKSA 60

Query: 53  EN----GLVKSHVLXXXXXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVI 108
            N    G     V                +++ LPCTVVVPT+TKQRMV+KIK++GA VI
Sbjct: 61  MNINKIGQKTPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120

Query: 109 IRGSHWKEADNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNI 168
           I G+HWKEAD +L+ N I +  +    +P+YVHPFD+P +WEGH+TMV EI+D+L +QNI
Sbjct: 121 INGAHWKEADMFLK-NSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNI 179

Query: 169 SVENVRGIVCSVXXXXXXXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLD 228
            +  V+GIVCSV             + + LADKIP++ VET GC+V N SL   + +   
Sbjct: 180 PINKVKGIVCSVGGGGLYNGIIQGLQKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFS 239

Query: 229 KITSLATSLGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASL 288
           KITS+ATSLG+  I +  FE A +Y  +S+V+EDK+VIETCL+Y  D+  +VEPACGAS+
Sbjct: 240 KITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASI 299

Query: 289 HIGYHPELLENFLG-GFSKDDIIVIIACGGSTTTFKDL 325
           H+ YH ++LE  LG   + DDII++IACGGS+ T  DL
Sbjct: 300 HLAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDL 337

>Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)
          Length = 339

 Score =  324 bits (831), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 168/334 (50%), Positives = 218/334 (65%), Gaps = 8/334 (2%)

Query: 5   YYKTPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKSENGLV----KSH 60
           Y +TPL+ Q+ N   T   P++++K+E LQPGGSFKSRGIG+LI+  +E  L     K  
Sbjct: 6   YERTPLIHQVFNNGQTG--PRLYVKHEMLQPGGSFKSRGIGHLINRSNEEALADGSGKLA 63

Query: 61  VLXXXXXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWKEADNY 120
           V                  M L CTVVVP +TK RM++KI+N+GA+VII GSHW EAD Y
Sbjct: 64  VFSSSGGNAGLAAATACSSMALDCTVVVPKTTKSRMIKKIQNAGAKVIIHGSHWGEADEY 123

Query: 121 LQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRGIVCSV 180
           L+Q  +      G SK LYVHPFDD ++WEGHST+V E++  L+E+NIS+  ++ +VCSV
Sbjct: 124 LRQELMIQESQLG-SKTLYVHPFDDERIWEGHSTIVDEVLQQLQEKNISLARIKAMVCSV 182

Query: 181 XXXXXXXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLATSLGST 240
                        E + LA KI VIAVET GC+VLN SL  G P+ L++++S+ATSLGS 
Sbjct: 183 GGGGLFSGIIKGLERNNLAGKIRVIAVETIGCDVLNKSLVNGSPITLERLSSIATSLGSP 242

Query: 241 YIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPELLENF 300
           YI    FE+   YG KS+VL D+DV+ TCLRY  D+  IVEPACGASLH+ YH E+LEN 
Sbjct: 243 YIAPFAFESFNAYGCKSVVLSDQDVLATCLRYADDYNSIVEPACGASLHLCYHQEILENA 302

Query: 301 L-GGFSKDDIIVIIACGGSTTTFKDLTIASKNFS 333
           L    S DDI++IIACGGS  T++DL   S+  S
Sbjct: 303 LEQKLSDDDIVIIIACGGSCMTYEDLVETSRRIS 336

>Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa]
           {ON} ANNOTATED BY YGOB - Skipping over stop codon in
           S288c
          Length = 337

 Score =  323 bits (827), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 169/337 (50%), Positives = 220/337 (65%), Gaps = 9/337 (2%)

Query: 4   WYYKTPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKSENGLV----KS 59
           +Y KTPL+RQ LN   T      ++K+E LQPGGSFKSRGIG+LI   +E  L     K 
Sbjct: 5   YYEKTPLIRQFLNNGKTNSW--FYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGSGKL 62

Query: 60  HVLXXXXXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWKEADN 119
            V                + M L C+VVVP +TK RMV+KI+++GA+VII G HW EAD 
Sbjct: 63  AVFSSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGEADE 122

Query: 120 YLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRGIVCS 179
           YL+    Q  ++   SK LYVHPFD+  +WEGHST+V EII+ L+E +IS+  V+ +VCS
Sbjct: 123 YLRHEMAQESQHG--SKTLYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALVCS 180

Query: 180 VXXXXXXXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLATSLGS 239
           V             + + LA+KIPV+AVET GC+VLN SL  G PV L+K+TS+ATSL S
Sbjct: 181 VGGGGLFSGIIKGLDRNQLAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSLAS 240

Query: 240 TYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPELLEN 299
            YI    FE+  +YG KS+VL D+DV+ TCLRY  D+  IVEPACGASLH+ YHPE+LE+
Sbjct: 241 PYIASFAFESFNKYGCKSVVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEILED 300

Query: 300 FL-GGFSKDDIIVIIACGGSTTTFKDLTIASKNFSIS 335
            L     +DDI++IIACGGS  T++DL  AS   ++S
Sbjct: 301 ILEQKIYEDDIVIIIACGGSCMTYEDLVKASSTLNVS 337

>TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa]
           {ON} Anc_1.3 YCL064C
          Length = 360

 Score =  318 bits (816), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 160/331 (48%), Positives = 215/331 (64%), Gaps = 10/331 (3%)

Query: 1   MNNWYYKTPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLI-----SLKSENG 55
           M+  Y KTPLLRQ       + +PQ F+KYE +QP GSFKSRGIGNLI      + S N 
Sbjct: 1   MSIVYNKTPLLRQFFRG---SPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNL 57

Query: 56  LVKSHVLXXXXXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWK 115
             +  V                +++ +PCTVVVPT+TK+RMV KIK++GA+VI+ G HW 
Sbjct: 58  NKRPQVFSSSGGNAGLAAATASRRLSIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWS 117

Query: 116 EADNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRG 175
           EAD+YLQ + I    +    +P+YVHPFD+P +WEGHSTM+ EII++L EQNI + NV+ 
Sbjct: 118 EADDYLQNHVINKI-DLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKA 176

Query: 176 IVCSVXXXXXXXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLAT 235
           I CS+             E + LA KIP+I VET GC V N SL   + V   KI ++AT
Sbjct: 177 ITCSIGGGGLYNGLIRGLEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIAT 236

Query: 236 SLGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPE 295
           SLG++ I    FENA++Y  KS+V+++ DVI+TCLRY  DF Q+ EPACGA+LH+ Y+  
Sbjct: 237 SLGTSTISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTG 296

Query: 296 LLENFLG-GFSKDDIIVIIACGGSTTTFKDL 325
           L+EN L    +KDDII++IACGGS+ T ++L
Sbjct: 297 LIENALDTTLTKDDIIIVIACGGSSNTVQEL 327

>SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 364

 Score =  318 bits (814), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 160/332 (48%), Positives = 212/332 (63%), Gaps = 10/332 (3%)

Query: 1   MNNWYYKTPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLIS-----LKSENG 55
           M ++Y KTPLLR+I      +  PQ  +KYE  QP GSFKSRGIG+LI+     ++SE G
Sbjct: 1   MTSFYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESE-G 59

Query: 56  LVKSHVLXXXXXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWK 115
              +HV                +   LPCTVVVPT+T  RMV KI+ +GA+VI+ G+HW 
Sbjct: 60  NKTAHVFASSGGNAGLAAATACRAFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWG 119

Query: 116 EADNYLQQNYIQSFRNDGTS-KPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVR 174
           +AD YL ++ +     D T  +P+Y HPFD+P +WEGHST+V EI+++L  Q I    V+
Sbjct: 120 DADQYLHRSVMPCI--DTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVK 177

Query: 175 GIVCSVXXXXXXXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLA 234
           GIVCS+             E H LA  IP+I VET GC V + SL AG+P++ DKITS+A
Sbjct: 178 GIVCSIGGGGLYNGIIEGLEKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVA 237

Query: 235 TSLGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHP 294
           TSLG+  I +   ENA++Y  KS+VL D DV+ TCL +  D   + EPACGASLH GY+P
Sbjct: 238 TSLGTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNP 297

Query: 295 ELLENFLGG-FSKDDIIVIIACGGSTTTFKDL 325
            LLE+ LGG    +DII++IACGGS+TT +DL
Sbjct: 298 HLLEDTLGGSLGPEDIIIVIACGGSSTTVQDL 329

>KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score =  316 bits (810), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 163/334 (48%), Positives = 216/334 (64%), Gaps = 11/334 (3%)

Query: 1   MNNWYYKTPLLRQIL---NWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKS----- 52
           M   Y KTPLLR      N  T+   PQ+F KYE+ QPG SFKSRGIGNLI LK+     
Sbjct: 1   MPTVYNKTPLLRPYFLEANRGTSDSSPQVFFKYESFQPGCSFKSRGIGNLI-LKNAKKVE 59

Query: 53  ENGLVKSHVLXXXXXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGS 112
           E G+    V                +++ +PCTVVVP+STK RMV+KI+++GA+VI+ G+
Sbjct: 60  EEGIKTLEVFSSSGGNAGYAAAVACRELSIPCTVVVPSSTKVRMVEKIRSTGAQVIVSGN 119

Query: 113 HWKEADNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVEN 172
            WKEAD YL+ + I    +    +PLYVHPFDDP +WEGHST++ EI+++L ++N+    
Sbjct: 120 FWKEADEYLRNSVINKV-DSSKVEPLYVHPFDDPLIWEGHSTIIDEIVESLNDENVHTSK 178

Query: 173 VRGIVCSVXXXXXXXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITS 232
           V+G+VCS+             E H LADKIPVIAVET GC+V N  L  G+ V  +KI+S
Sbjct: 179 VKGVVCSIGGGGLYNGIIEGLERHALADKIPVIAVETEGCHVFNTCLELGKHVEFEKISS 238

Query: 233 LATSLGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGY 292
           +ATSLGS  I    FE A +Y +K +VL+D DV+ETCLRY  D   I+EPAC AS+H+ Y
Sbjct: 239 IATSLGSPSISTKTFEYAQKYHSKGVVLQDIDVLETCLRYSEDSNMIIEPACAASVHLAY 298

Query: 293 HPELLENFLG-GFSKDDIIVIIACGGSTTTFKDL 325
           + ++LE  L    SKDD+I+IIACGGS TT +D+
Sbjct: 299 NVDILEEALNKKLSKDDVIIIIACGGSATTLQDI 332

>SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 339

 Score =  316 bits (809), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 159/335 (47%), Positives = 219/335 (65%), Gaps = 8/335 (2%)

Query: 3   NWYYKTPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKSE----NGLVK 58
           ++Y KTPLL ++L   TT   P+ F+KYE LQPGGSFKSRGIG L+    E    +G   
Sbjct: 6   SFYNKTPLLPRVLT--TTDGAPRFFLKYEFLQPGGSFKSRGIGYLVKKSYEKARRDGGKS 63

Query: 59  SHVLXXXXXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWKEAD 118
             V                +   + CTVVVP +TK RMV+KI+ +GAEV++ G HW  AD
Sbjct: 64  LAVFSSSGGNAGLAAAIAAQTFSINCTVVVPRTTKSRMVEKIRKTGAEVLVYGKHWGMAD 123

Query: 119 NYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRGIVC 178
            YL++  ++   +     PLYVHPFD+P +W+GHST+V E++  L+E+N+S++ V+ IVC
Sbjct: 124 EYLREVVMKEV-DVSKVVPLYVHPFDNPIIWQGHSTIVDEVVAQLKEENVSIDKVKAIVC 182

Query: 179 SVXXXXXXXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLATSLG 238
           SV             E H LAD+IP++A+ET GC+VLN SLN+G PV+L+ +TS+A+SL 
Sbjct: 183 SVGGGGLYNGIVKGLETHQLADRIPILAIETKGCDVLNKSLNSGNPVVLESLTSVASSLA 242

Query: 239 STYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPELLE 298
           S YI +  FENA +Y +KS++L+D  VIETCL +  D G +VEPACGASL+  YHPELL 
Sbjct: 243 SPYISEKAFENARKYESKSILLKDSQVIETCLNFADDAGIVVEPACGASLYSCYHPELLP 302

Query: 299 NFLGG-FSKDDIIVIIACGGSTTTFKDLTIASKNF 332
            ++G   ++DD+IV+IACGGS  T+KDL    K  
Sbjct: 303 LYIGKELTEDDVIVVIACGGSAVTYKDLEYMKKEL 337

>TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3
           YCL064C
          Length = 357

 Score =  313 bits (802), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 158/330 (47%), Positives = 214/330 (64%), Gaps = 9/330 (2%)

Query: 1   MNNWYYKTPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLI---SLKSENGLV 57
           M+  Y KTPLLR +   K    LPQ+F+KYE  QP GSFKSRGIGNLI   SL+ +    
Sbjct: 1   MSQVYNKTPLLRHLFPGKN---LPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSK 57

Query: 58  KS-HVLXXXXXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWKE 116
           KS  V                K + LPCTVVVPT+TK RMV+KIK +GA VI++G+HWKE
Sbjct: 58  KSPEVFSSSGGNAGLAAATASKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKE 117

Query: 117 ADNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRGI 176
           AD YL+ N + +  +    +P+YVHPFD+ K+WEGH+TM+ EI++   +Q+I +E V+ I
Sbjct: 118 ADTYLKTNVLSNI-DKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAI 176

Query: 177 VCSVXXXXXXXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLATS 236
           VCSV             E H LA KIPV+ VET GC+V N SL  G+ +  +KI ++ATS
Sbjct: 177 VCSVGGGGLYNGIIQGLEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATS 236

Query: 237 LGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPEL 296
           LG+  I    FE A +Y  KS+V++D  V+ETCL++  D   + EPACGA+LH+GY+ ++
Sbjct: 237 LGTANISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDI 296

Query: 297 LENFLG-GFSKDDIIVIIACGGSTTTFKDL 325
           LE  LG   + DDI++IIACGGS+ T ++L
Sbjct: 297 LEKSLGKKLATDDIVLIIACGGSSNTVQEL 326

>CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|P25379 Saccharomyces
           cerevisiae YCL064c CHA1 L-serine/L-threonine deaminase
          Length = 360

 Score =  310 bits (794), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 154/328 (46%), Positives = 212/328 (64%), Gaps = 12/328 (3%)

Query: 5   YYKTPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKSE----NGL-VKS 59
           Y KTPL+RQI        +PQ+++K+E  QP GSFKSRGIG+LIS +S+    NGL  K 
Sbjct: 4   YNKTPLIRQIF-----PSIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKP 58

Query: 60  HVLXXXXXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWKEADN 119
            V                K + LPCTVV+PT+TKQRM  KI+ +GA VI+ G+ WKEADN
Sbjct: 59  MVFASSGGNAGLAAATAAKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADN 118

Query: 120 YLQQNYIQSFRN-DGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRGIVC 178
           YL+ N +          +P+YVHPFD+P +WEGH++MV EI+++ + + I +  ++ IVC
Sbjct: 119 YLKDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVC 178

Query: 179 SVXXXXXXXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLATSLG 238
           SV             E + LADKIP++ VET GC+V N SL   + V   KITS+ATSLG
Sbjct: 179 SVGGGGLYNGIIQGLEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLG 238

Query: 239 STYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPELLE 298
           +  I    F+ A RYG KS+VL D+DV++TCLRY  DF  ++EPACGA++H+ YH E+LE
Sbjct: 239 TADISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEILE 298

Query: 299 NFLG-GFSKDDIIVIIACGGSTTTFKDL 325
             LG   + DDI++++ACGGS+ T +D+
Sbjct: 299 KELGTKLNADDIVLVVACGGSSNTVEDM 326

>Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON}
           complement(7840..8892) [1053 nt, 351 aa]
          Length = 350

 Score =  307 bits (787), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 162/334 (48%), Positives = 222/334 (66%), Gaps = 11/334 (3%)

Query: 1   MNNWYYKTPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLI-----SLKSENG 55
           M+  Y KTPLL+     K    LPQ ++KYE+LQP GSFKSRGIGNLI      +K  N 
Sbjct: 1   MSLVYNKTPLLKHFFPGK---NLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKIN- 56

Query: 56  LVKSHVLXXXXXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWK 115
           + K +V                +++ LPCTVVVPT+TK+RMVQKI+ +GA VII+G+HWK
Sbjct: 57  VKKPYVFSSSGGNAGLAAATASQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWK 116

Query: 116 EADNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRG 175
           EADN+L+QN +     D   +P+YVHPFD+P +WEGHSTMV EI++   +Q  +++N++ 
Sbjct: 117 EADNFLKQNIMNEINKDKI-EPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKA 175

Query: 176 IVCSVXXXXXXXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLAT 235
           IVCSV             E + LADKIPV+ VET GC+V N SL   +PV   KI+++AT
Sbjct: 176 IVCSVGGGGLYNGIIQGLEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIAT 235

Query: 236 SLGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPE 295
           SLG+  I   +F+ A +Y  KS+V+EDKDV+ETCL++  D   ++EPACGA++H+GYH +
Sbjct: 236 SLGTANISNQMFDYAKKYNTKSVVVEDKDVVETCLKFTHDHNMVIEPACGAAIHLGYHTD 295

Query: 296 LLENFLG-GFSKDDIIVIIACGGSTTTFKDLTIA 328
           LLE  LG   + DD ++I+ACGGS+ T K+L  A
Sbjct: 296 LLETALGTKLTCDDAVLIVACGGSSNTVKELETA 329

>KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  306 bits (783), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 160/337 (47%), Positives = 214/337 (63%), Gaps = 11/337 (3%)

Query: 1   MNNWYYKTPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKSEN----GL 56
           M   Y KTPLL + L   +  + P    KYEN+QPGGSFK RG+ +LI  + E     G 
Sbjct: 1   MPALYNKTPLLPKNL---SGGDGPTFLFKYENMQPGGSFKIRGVSHLIEKRVEQIKSEGK 57

Query: 57  VKSHVLXXXXXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWKE 116
              HV                  + +PCTVVVPT TK RMV+KI+ + AEVI++GS+WKE
Sbjct: 58  KPPHVFSSSGGNAGLAAATACHILSIPCTVVVPTLTKPRMVEKIRKANAEVIVKGSNWKE 117

Query: 117 ADNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRGI 176
           AD+YL+   I S   +   +P+YV+PFDDP +WEGHSTM+ EI++ L ++NI ++ V+GI
Sbjct: 118 ADDYLRGTVIAS---NNAVQPIYVNPFDDPLLWEGHSTMIDEILNALNQENIKLDAVKGI 174

Query: 177 VCSVXXXXXXXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLATS 236
           VCSV             E+H LA  IPV+AVET GC+VL  SL A +PV L+KI S+ATS
Sbjct: 175 VCSVGGGGLFNGIVHGLENHQLACTIPVVAVETKGCDVLGLSLAAEKPVRLNKIDSIATS 234

Query: 237 LGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPEL 296
           LGS+Y+    F+NAV++ ++S+VL D DV+ TC RY+ DF  IVEPACGA++H  YH ++
Sbjct: 235 LGSSYVSCQAFDNAVKFKSRSVVLHDSDVLNTCYRYLDDFNAIVEPACGATIHTAYHYKI 294

Query: 297 LENFLG-GFSKDDIIVIIACGGSTTTFKDLTIASKNF 332
           LE  LG   +  DII+II CGGS  T +DL  A +  
Sbjct: 295 LEKALGQKLTPSDIIIIIVCGGSCVTIQDLENAKRKL 331

>KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 322

 Score =  297 bits (760), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 161/333 (48%), Positives = 211/333 (63%), Gaps = 23/333 (6%)

Query: 1   MNNWYYKTPLL--RQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISL------KS 52
           M+    KTPLL  R+ LN       P   +KYENLQPGGSFKSRGI +LI          
Sbjct: 1   MDQLTIKTPLLPFREPLNGG-----PTFLLKYENLQPGGSFKSRGISHLIKTTMDSISDP 55

Query: 53  ENGLVKSHVLXXXXXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGS 112
           EN L    V                  +++PCTV+VP STK RM++KI+++GA+V+I G 
Sbjct: 56  ENELA---VYSSSGGNAGLAAARACATLKVPCTVIVPKSTKPRMIKKIESAGAKVVIFGD 112

Query: 113 HWKEADNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVEN 172
           HWKEAD YL++ Y+   R    S  LYVHPFD+P +W+GHSTM+ EII+ L E +  + +
Sbjct: 113 HWKEADTYLRE-YV--MRQSSYSNTLYVHPFDNPIIWDGHSTMIDEIIEQLAESHTDIND 169

Query: 173 VRGIVCSVXXXXXXXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITS 232
           V+GIVCSV             E HGLA  IPV A+ET GC+VL+ SL AG PV+LD+I+S
Sbjct: 170 VKGIVCSVGGGGLYNGVVNGLERHGLAGSIPVFAMETDGCDVLSKSLIAGEPVVLDRISS 229

Query: 233 LATSLGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGY 292
           +ATSLGST I    F+ A+++ +KS+VL+DK+V++TCLR+  +   +VEPACGASLH  Y
Sbjct: 230 IATSLGSTEICADSFQKAIKFSSKSIVLDDKNVVDTCLRFFDETSILVEPACGASLHTCY 289

Query: 293 HPELLENFLGGFSKDDIIVIIACGGSTTTFKDL 325
            PEL    LG    DDI+V+I CGGS  T+ DL
Sbjct: 290 RPEL----LGPLGPDDIVVVILCGGSCNTYDDL 318

>Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON}
           similar to Ashbya gossypii AFR747W
          Length = 364

 Score =  285 bits (730), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 147/334 (44%), Positives = 201/334 (60%), Gaps = 9/334 (2%)

Query: 1   MNNWYYKTPLLRQILNWKTT--TELPQIFIKYENLQPGGSFKSRGIGNLISLK----SEN 54
           M++ Y KTPLLR+         +++PQ  +KYE  QP GSFKSRGIGNLI  K      +
Sbjct: 1   MSSLYVKTPLLRRAFGKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRD 60

Query: 55  GLVKSHVLXXXXXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHW 114
              + HV                ++M +PCTVVVPTST+QR+++KI  +GA +I RG ++
Sbjct: 61  PAKQPHVFSSSGGNAGLAAATASQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDYF 120

Query: 115 KEADNYLQ---QNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVE 171
            EAD+YL+   Q        D  + P+YVHPF+ P +W GHS +V EI+++LR +NI   
Sbjct: 121 AEADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPYS 180

Query: 172 NVRGIVCSVXXXXXXXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKIT 231
            V+GIVCSV             E H LA+ IP+I VET GC VL+ SL AG+ +   K  
Sbjct: 181 RVKGIVCSVGGGGLYNGIIEGLERHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKAL 240

Query: 232 SLATSLGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIG 291
           S+ATSL    I +     A +Y  KSLVL + +V++TCLR+  +   + EPACGA+LH+G
Sbjct: 241 SVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHLG 300

Query: 292 YHPELLENFLGGFSKDDIIVIIACGGSTTTFKDL 325
           YHP +L   LG  S +DI+++IACGGS TT  DL
Sbjct: 301 YHPAILHKELGPLSSEDIVILIACGGSATTLADL 334

>TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score =  284 bits (727), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 144/335 (42%), Positives = 207/335 (61%), Gaps = 8/335 (2%)

Query: 3   NWYYKTPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKSENGLVKS--- 59
           ++ +K+PLL +    ++  + PQ F+KYE LQP GSFKSRGIG LI+ K++    +    
Sbjct: 2   SYSHKSPLLNRRFK-ESEKDGPQFFLKYETLQPSGSFKSRGIGYLINSKAKEARSRDGSD 60

Query: 60  -HVLXXXXXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWKEAD 118
            HV                K + L CTVVVP +TK+ M+ +I+N+G++VI+ G+HW  AD
Sbjct: 61  VHVFSSSGGNAGLAAANASKLLNLNCTVVVPVTTKRHMIDRIQNAGSQVIVHGTHWGMAD 120

Query: 119 NYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRGIVC 178
            YL++  ++   ++   +PLYVHPFDDP VWEGHS M+ EI++ L+EQ  S+ +V+GI+C
Sbjct: 121 TYLKEVVMKKVPSN--VEPLYVHPFDDPLVWEGHSFMIDEIVEQLQEQGRSMRDVKGIIC 178

Query: 179 SVXXXXXXXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLATSLG 238
           SV             E HG A KIP+IAVET G + L  SL AG+PV L ++TS+A+SLG
Sbjct: 179 SVGGGGLYNGIVGGLERHGYAGKIPIIAVETVGADALAKSLAAGKPVRLTEVTSIASSLG 238

Query: 239 STYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPELLE 298
           S YI Q  FE A+RY  +S V  D++ + T LR+  +   +VEPAC AS+ + YH + L 
Sbjct: 239 SPYIAQDSFEKAIRYKTRSFVQTDEEAVRTSLRFFQETNILVEPACAASVSLCYHVDELN 298

Query: 299 NFLG-GFSKDDIIVIIACGGSTTTFKDLTIASKNF 332
             L    S  DI+++I CGGS TT  DL +  + +
Sbjct: 299 KLLSCKLSSKDIVIVIVCGGSATTISDLEMLQRRY 333

>KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}
           Anc_1.3 YCL064C
          Length = 344

 Score =  284 bits (726), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 140/329 (42%), Positives = 207/329 (62%), Gaps = 9/329 (2%)

Query: 5   YYKTPLLRQIL---NWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKS----ENGLV 57
           Y KTPL+ Q       +++  LPQ+ IKYE LQP GSFKSRGIGNL+  K+    +N   
Sbjct: 5   YNKTPLVPQSFPGTEIRSSDSLPQVLIKYEYLQPSGSFKSRGIGNLVYQKALQIQKNSTK 64

Query: 58  KSHVLXXXXXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWKEA 117
              V                +++ LPCTVVVP +TKQRM++KI+++GA+V I G+ WK A
Sbjct: 65  NPEVFSSSGGNAGYAAAVVAQKLSLPCTVVVPAATKQRMIEKIRSTGAKVTIHGTFWKGA 124

Query: 118 DNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRGIV 177
           D Y++ + +    N    +P+YVHP DDP +WEG+S +V E++++L+EQ I    V+ IV
Sbjct: 125 DKYMKNSVLNEI-NTEKVEPIYVHPSDDPLIWEGNSMIVDELMESLQEQKIDPSKVKAIV 183

Query: 178 CSVXXXXXXXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLATSL 237
           CSV             E + LADKIP++ VET G +V N  L +G+ +  +KI+++ATSL
Sbjct: 184 CSVGGGGLYNGLMQGLERYKLADKIPIVGVETDGSHVFNTCLKSGKHIEFEKISTVATSL 243

Query: 238 GSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPELL 297
           GS  I +  FE A++Y  + ++++D +V+ETCLRY  D+  I EPACGA++H+ YH ++L
Sbjct: 244 GSASITKKTFEYAMKYRPRGVIVKDIEVLETCLRYTQDYNMITEPACGAAIHLAYHVDIL 303

Query: 298 ENFLGG-FSKDDIIVIIACGGSTTTFKDL 325
           E  L      DD+++IIACGGS+ +  D+
Sbjct: 304 EKALDTRLDGDDVVIIIACGGSSNSLHDM 332

>AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL064C (CHA1)
          Length = 426

 Score =  286 bits (733), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 144/331 (43%), Positives = 209/331 (63%), Gaps = 8/331 (2%)

Query: 1   MNNWYYKTPLLRQILNWKTT--TELPQIFIKYENLQPGGSFKSRGIGNLISLK----SEN 54
           M ++Y KTPL+R +   +    T  P+I +KYE  QP GSFKSRGIGNLI  +     +N
Sbjct: 69  MASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQN 128

Query: 55  GLVKSHVLXXXXXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHW 114
             ++ HV                +Q+ LPCTVVVP +T++RMV++I+++GA+VI  GS  
Sbjct: 129 SSLQPHVFASSGGNAGLAAATASRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVL 188

Query: 115 KEADNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVR 174
           KE+D+YL+   + +   +  + P+Y HPFD+P +WEGH+TMV E+++ L  Q + +E+V+
Sbjct: 189 KESDDYLRSELMGNVNLEKVA-PIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVK 247

Query: 175 GIVCSVXXXXXXXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLA 234
           GIVCSV             E HGLAD IPV+AVET GC VL+ SL  GR V ++   S+A
Sbjct: 248 GIVCSVGGGGLYNGIVYGLEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVA 306

Query: 235 TSLGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHP 294
           TSL ++++       A +Y  KS+VL+   V++TCL +  +   + EPACGA+LH+GYHP
Sbjct: 307 TSLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHP 366

Query: 295 ELLENFLGGFSKDDIIVIIACGGSTTTFKDL 325
           E+LE  LG  +  D++++IACGGST    DL
Sbjct: 367 EILERELGPLTPQDVVIVIACGGSTMNLADL 397

>KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 341

 Score =  280 bits (717), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 145/334 (43%), Positives = 204/334 (61%), Gaps = 10/334 (2%)

Query: 1   MNNWYYKTPLLRQILNWKTTT--ELPQIFIKYENLQPGGSFKSRGIGNLIS-----LKSE 53
           M + + KTPLL       +      PQ  +K E LQP GSFKSRGIG +I+     ++SE
Sbjct: 1   MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSE 60

Query: 54  NGLVKSHVLXXXXXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSH 113
              +  HV                + + +PC+VVVP ST  RMVQKI N GAEV + G +
Sbjct: 61  GNKLP-HVFASSGGNAGLAAATTSRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRN 119

Query: 114 WKEADNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENV 173
           WKEAD +L+++ I S  N   ++ +Y HPFD P +WEGHS++V EIID+L+EQ I ++N+
Sbjct: 120 WKEADKFLKESII-SGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNI 178

Query: 174 RGIVCSVXXXXXXXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSL 233
           + IVCSV               H L  KIP+I VE+ GC V N+SL  G+    + ITS+
Sbjct: 179 KAIVCSVGGGGLYNGIIEGLSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSI 238

Query: 234 ATSLGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYH 293
           ATS+G+  I +   ENA+RY  KS+VL D+++I TCLR+  +   I EPACGA+LH+GY+
Sbjct: 239 ATSIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYY 298

Query: 294 PELLENFLGG-FSKDDIIVIIACGGSTTTFKDLT 326
           P++L   L   F+ +D+I++I CGGS T++ DL 
Sbjct: 299 PDILYQALNSDFTPEDVIIMIGCGGSATSYNDLA 332

>KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 377

 Score =  272 bits (696), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 139/331 (41%), Positives = 208/331 (62%), Gaps = 18/331 (5%)

Query: 5   YYKTPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKSENGLVKS----- 59
           + KTPLL+        ++ PQ+ +KYE LQP GSFKSRGIG+LIS K E  + KS     
Sbjct: 25  FSKTPLLKHQFK---RSKGPQVLLKYEFLQPSGSFKSRGIGHLISTKVEE-IKKSSPEKI 80

Query: 60  -HVLXXXXXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWKEAD 118
            HV                 ++ +PCTVVV  +T+ R+++KI++ GA+V++ G+HWKEAD
Sbjct: 81  GHVFASSGGNAGLAAAVASLELNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEAD 140

Query: 119 NYLQQNYIQ---SFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRG 175
           ++++++ ++   SF+ +    P+Y HPFD+P +WEGHS MV EI+D L    I +  ++G
Sbjct: 141 SFMKEHLMKKLDSFKYE----PIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKG 196

Query: 176 IVCSVXXXXXXXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLAT 235
           IVCS              + + LADKIP++ VET G +VL+ASL  G PV  +KI+S AT
Sbjct: 197 IVCSFGGGGLYNGLILGLQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCAT 256

Query: 236 SLGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPE 295
           SLG+  I    ++N  R+G+KS V+ D +VI TCL++ +D   + EP CGA+L+ GY+ +
Sbjct: 257 SLGTATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNID 316

Query: 296 LLENFLGG-FSKDDIIVIIACGGSTTTFKDL 325
            L+N LG     DD +++I CGGS+T+ +DL
Sbjct: 317 KLQNILGSDIKDDDYVILIGCGGSSTSLEDL 347

>KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}
          Length = 231

 Score =  228 bits (580), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 111/224 (49%), Positives = 152/224 (67%), Gaps = 4/224 (1%)

Query: 106 EVIIRGSHWKEADNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLRE 165
           EV +  ++ KEAD YLQ   I  +++    +P+YV+PFDDP +WEGHST++ EI++ L +
Sbjct: 4   EVFVHVANLKEADYYLQNVVIDLYKD---VQPIYVNPFDDPLIWEGHSTIIDEILNTLTQ 60

Query: 166 QNISVENVRGIVCSVXXXXXXXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPV 225
           +NI V +V+GI+CS              E + LA  IPV+AVET GC+VLN SL A +PV
Sbjct: 61  ENIEVGSVKGIICSFSGGGLYNGIMQGLEKYDLAYNIPVVAVETKGCDVLNLSLAANKPV 120

Query: 226 MLDKITSLATSLGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACG 285
            LD ITS+A SLGS+ + Q VF+N ++Y +KSLVL D D ++TC +Y+ DFG ++EPACG
Sbjct: 121 QLDSITSIAKSLGSSVVSQKVFDNVIKYHSKSLVLNDSDALDTCFKYLDDFGTVLEPACG 180

Query: 286 ASLHIGYHPELLENFLG-GFSKDDIIVIIACGGSTTTFKDLTIA 328
           AS+H  YH  +LE  L      DD+I+IIACGGS  TF+DL  A
Sbjct: 181 ASVHTAYHYNVLEEALDQKLRPDDVIIIIACGGSCATFQDLERA 224

>YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open
           reading frame, unlikely to produce a functional protein
           in S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL167W and adjacent
           ORF, YIL168W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 210

 Score =  224 bits (570), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 143/202 (70%), Gaps = 1/202 (0%)

Query: 135 SKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRGIVCSVXXXXXXXXXXXXXE 194
           SK LYVHPFD+  +WEGHST+V EII+ L+E +IS+  V+ +VCSV             +
Sbjct: 9   SKTLYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALVCSVGGGGLFSGIIKGLD 68

Query: 195 DHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLATSLGSTYIPQGVFENAVRYG 254
            + LA+KIPV+AVET GC+VLN SL  G PV L+K+TS+ATSL S YI    FE+  +YG
Sbjct: 69  RNQLAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSLASPYIASFAFESFNKYG 128

Query: 255 AKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPELLENFL-GGFSKDDIIVII 313
            KS+VL D+DV+ TCLRY  D+  IVEPACGASLH+ YHPE+LE+ L     +DDI++II
Sbjct: 129 CKSVVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEILEDILEQKIYEDDIVIII 188

Query: 314 ACGGSTTTFKDLTIASKNFSIS 335
           ACGGS  T++DL  AS   ++S
Sbjct: 189 ACGGSCMTYEDLVKASSTLNVS 210

>YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading
           frame, unlikely to produce a functional protein in
           S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL168W and adjacent
           ORF, YIL167W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 127

 Score =  107 bits (266), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 58/124 (46%), Positives = 74/124 (59%), Gaps = 6/124 (4%)

Query: 4   WYYKTPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKSENGLV----KS 59
           +Y KTPL+RQ LN   T      ++K+E LQPGGSFKSRGIG+LI   +E  L     K 
Sbjct: 5   YYEKTPLIRQFLNNGKTNSW--FYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGSGKL 62

Query: 60  HVLXXXXXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWKEADN 119
            V                + M L C+VVVP +TK RMV+KI+++GA+VII G HW EAD 
Sbjct: 63  AVFSSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGEADE 122

Query: 120 YLQQ 123
           YL+ 
Sbjct: 123 YLRH 126

>SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 562

 Score = 70.9 bits (172), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 68/262 (25%), Positives = 112/262 (42%), Gaps = 16/262 (6%)

Query: 28  IKYENLQPGGSFKSRGIGNLISLKSENGLVKSHVLXXXXXXXXXXXXXXXKQMELPCTVV 87
           +K E+L P  SFK RG  N+I+   E+   +  V+               K + +P T+V
Sbjct: 83  LKREDLLPVFSFKLRGAYNMIAKLDESQKTQG-VIACSAGNHAQGVAYASKHLNIPATIV 141

Query: 88  VPTSTKQRMVQKIKNSGAEVIIRGSHWKEADNYLQQNYIQSFRNDGTSKPLYVHPFDDPK 147
           +P ST     Q +   G++V++ G+ + EA    +    +     G +    + PFD P 
Sbjct: 142 MPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECTKLTEERGLTN---IPPFDHPY 194

Query: 148 VWEGHSTMVHEIIDNLREQNISVENVRGIVCSVXXXXXXXXXXXXXEDHGLADKIPVIAV 207
           V  G  T+  EI+     Q  +   ++ + C+V             +   +A  I VI V
Sbjct: 195 VIAGQGTIAMEIL----RQVHNASKIKAVFCAVGGGGLITGVGAYLKR--IAPHIKVIGV 248

Query: 208 ETYGCNVLNASLNAGRPVMLDKITSLATSLGSTYIPQGVFENAVRYGAKSLVLEDKDVIE 267
           ETY    L+ SL AG+ V L  + + A       I +  F  A +     +VL + D I 
Sbjct: 249 ETYDAATLHTSLKAGKRVPLPNVGTFADGTSVRMIGEETFRVA-KDVVDEVVLVNTDEIC 307

Query: 268 TCLRYV-SDFGQIVEPACGASL 288
             ++ +  D   IVEP+   S+
Sbjct: 308 AAVKDIFEDTRSIVEPSGALSV 329

>KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086W ILV1 Threonine deaminase catalyzes
           the first step in isoleucine biosynthesis expression is
           under general amino acid control ILV1 locus exhibits
           highly positioned nucleosomes whose organization is
           independent of known ILV1 regulation
          Length = 567

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 77/298 (25%), Positives = 124/298 (41%), Gaps = 26/298 (8%)

Query: 7   KTPLLRQI-LNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKSENGLVKSHVLXXX 65
           +TP+ R + L+ +  T    + +K E+L P  SFK RG  N+I+ K +     + V+   
Sbjct: 69  ETPISRAVSLSSRLNT---NVKLKREDLLPVFSFKLRGAYNMIA-KLDETQKNAGVIACS 124

Query: 66  XXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWKEADNYLQQNY 125
                         M +P T+V+P ST     Q +   GA+V++ G  + EA        
Sbjct: 125 AGNHAQGVAFSSNHMNIPATIVMPVSTPSIKYQNVSRLGAQVVLYGDDFDEAK------- 177

Query: 126 IQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRGIVCSVXXXXX 185
           ++  R         + PFD P V  G  T+  EI+  +  QN S  N+  + C+V     
Sbjct: 178 LECARLAEERGMTDIPPFDHPYVIAGQGTIAMEILRQV--QNGS--NIGAVFCAVGGGGL 233

Query: 186 XXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLATSLGSTYIPQG 245
                   +   +A  I VI VETY    L+ SL  G+   L  + + A       I + 
Sbjct: 234 ISGIGSYLKR--IAPHIKVIGVETYDAATLDVSLKNGKRTPLPSVGTFADGTSVRLIGEE 291

Query: 246 VFENAVRYGAKSLVLEDKDVIETCLRYV-SDFGQIVEPA-----CGASLHIG-YHPEL 296
            F    +     ++L + D I   ++ V  D   IVEP+      G   ++   HPE+
Sbjct: 292 TFR-VCQDVVDEVILVNTDEICAAVKDVFEDTRSIVEPSGALAVAGLKKYVSQLHPEI 348

>KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7.367
           YER086W
          Length = 579

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 71/276 (25%), Positives = 114/276 (41%), Gaps = 22/276 (7%)

Query: 28  IKYENLQPGGSFKSRGIGNLISLKSENGLVKSHVLXXXXXXXXXXXXXXXKQMELPCTVV 87
           +K E+L P  SFK RG  N+I+ K ++ +    V+               K++ +P T+V
Sbjct: 100 LKREDLLPVFSFKLRGAYNMIA-KLDDNVRNQGVIACSAGNHAQGVAYAAKKLGIPATIV 158

Query: 88  VPTSTKQRMVQKIKNSGAEVIIRGSHWKEADNYLQQNYIQSFRNDGTSKPLYVHPFDDPK 147
           +P ST     Q +   G++V++ G+ + EA     +    S     T+ P    PFD P 
Sbjct: 159 MPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAK---LSEERGLTNIP----PFDHPY 211

Query: 148 VWEGHSTMVHEIIDNLREQNISVENVRGIVCSVXXXXXXXXXXXXXEDHGLADKIPVIAV 207
           V  G  T+  EI+  +   N     +  +   V             +   +A  I VI V
Sbjct: 212 VIAGQGTVAMEILRQVHNAN----KINAVFVPVGGGGLIAGVGAYLKR--IAPHIKVIGV 265

Query: 208 ETYGCNVLNASLNAGRPVMLDKITSLATSLGSTYIPQGVFENAVRYGAKSLVLEDKDVIE 267
           ETY    L+ SL  G+   L K+ + A       I +  F  A       +VL + D + 
Sbjct: 266 ETYDATTLHTSLQNGKRTELTKVGTFADGTSVRLIGEETFRVAQEV-VDEIVLVNTDELC 324

Query: 268 TCLRYV-SDFGQIVEPA-----CGASLHIG-YHPEL 296
             ++ V  D   I+EP+      G   +I   HPE+
Sbjct: 325 AAIKDVFEDTRSILEPSGALSVAGMKKYISVLHPEI 360

>Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}
           complement(41170..42870) [1701 nt, 567 aa]
          Length = 566

 Score = 61.6 bits (148), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 64/262 (24%), Positives = 109/262 (41%), Gaps = 16/262 (6%)

Query: 28  IKYENLQPGGSFKSRGIGNLISLKSENGLVKSHVLXXXXXXXXXXXXXXXKQMELPCTVV 87
           +K E+L P  SFK RG  N+++ K ++      V+               K + +P T+V
Sbjct: 87  LKREDLLPVFSFKLRGAYNMMA-KLDDSQKNQGVIACSAGNHAQGIAYAAKHLNIPATIV 145

Query: 88  VPTSTKQRMVQKIKNSGAEVIIRGSHWKEADNYLQQNYIQSFRNDGTSKPLYVHPFDDPK 147
           +P ST     Q +   G++V++ G+ + EA    +    +     G +    + PFD P 
Sbjct: 146 MPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECARLAEERGLTN---IPPFDHPY 198

Query: 148 VWEGHSTMVHEIIDNLREQNISVENVRGIVCSVXXXXXXXXXXXXXEDHGLADKIPVIAV 207
           V  G  T+  EI+  + + N     +  +   V             +   +A  I +I V
Sbjct: 199 VIAGQGTVAMEILRQVHKAN----KIGAVFVPVGGGGLIAGVGAYLKR--IAPHIKIIGV 252

Query: 208 ETYGCNVLNASLNAGRPVMLDKITSLATSLGSTYIPQGVFENAVRYGAKSLVLEDKDVIE 267
           ET+  N L  SL +G+ V L  + + A       I +  F    +     +VL + D I 
Sbjct: 253 ETFDANCLYTSLQSGKRVPLSSVGTFADGTAVRLIGEETFR-VCQEVVDEVVLVNTDEIC 311

Query: 268 TCLRYV-SDFGQIVEPACGASL 288
             ++ V  D   IVEP+   S+
Sbjct: 312 AAVKDVFEDTRSIVEPSGALSV 333

>Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/264 (24%), Positives = 109/264 (41%), Gaps = 16/264 (6%)

Query: 26  IFIKYENLQPGGSFKSRGIGNLISLKSENGLVKSHVLXXXXXXXXXXXXXXXKQMELPCT 85
           + +K E+L P  SFK RG  N+I+ K ++      V+               K +++P T
Sbjct: 95  VILKREDLLPVFSFKLRGAYNMIA-KLDDSQRNQGVIACSAGNHAQGVAFAAKHLKIPAT 153

Query: 86  VVVPTSTKQRMVQKIKNSGAEVIIRGSHWKEADNYLQQNYIQSFRNDGTSKPLYVHPFDD 145
           +V+P  T     Q +   G++V++ G+ + EA    +    +     G +    + PFD 
Sbjct: 154 IVMPVCTPSIKYQNVSRLGSQVVLFGNDFDEA----KAECTKLAEERGLTN---IPPFDH 206

Query: 146 PKVWEGHSTMVHEIIDNLREQNISVENVRGIVCSVXXXXXXXXXXXXXEDHGLADKIPVI 205
           P V  G  T+  EI+  +R    +V  +  +   V             +   +A  I VI
Sbjct: 207 PYVIAGQGTVAMEILRQVR----TVNKIGAVFVPVGGGGLIAGIGAYLKR--IAPHIKVI 260

Query: 206 AVETYGCNVLNASLNAGRPVMLDKITSLATSLGSTYIPQGVFENAVRYGAKSLVLEDKDV 265
            VETY    L+ SL   +   L  + + A       I +  F  A +     +VL + D 
Sbjct: 261 GVETYDAATLHNSLQRNQRTPLPAVGTFADGTSVRMIGEETFRVAQQV-VDEVVLVNTDE 319

Query: 266 IETCLRYV-SDFGQIVEPACGASL 288
           I   ++ V  D   IVEP+   S+
Sbjct: 320 ICAAVKDVFEDTRSIVEPSGALSV 343

>TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {ON}
           Anc_7.367 YER086W
          Length = 568

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 63/275 (22%), Positives = 114/275 (41%), Gaps = 20/275 (7%)

Query: 28  IKYENLQPGGSFKSRGIGNLISLKSENGLVKSHVLXXXXXXXXXXXXXXXKQMELPCTVV 87
           +K ++L P  SFK RG  N+++ K ++      V+               K +++P T+V
Sbjct: 89  LKRDDLLPVFSFKLRGAYNMMA-KLDDTQKNQGVIACSAGNHAQGVAYAAKHLKIPATIV 147

Query: 88  VPTSTKQRMVQKIKNSGAEVIIRGSHWKEADNYLQQNYIQSFRNDGTSKPLYVHPFDDPK 147
           +P ST     Q +   G++V++ G+ + EA    +    +     G +    + PFD P 
Sbjct: 148 MPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECARLAEERGLTN---IPPFDHPY 200

Query: 148 VWEGHSTMVHEIIDNLREQNISVENVRGIVCSVXXXXXXXXXXXXXEDHGLADKIPVIAV 207
           V  G  T+  EI   LR+ ++S   +  +   V             +   +A  I +I V
Sbjct: 201 VIAGQGTVAMEI---LRQVHMS-SKIGAVFVPVGGGGLIAGVGTYLKR--IAPHIKIIGV 254

Query: 208 ETYGCNVLNASLNAGRPVMLDKITSLATSLGSTYIPQGVFENAVRYGAKSLVLEDKDVIE 267
           ETY    L  SL +G+   L+ + S A       + +  F  A     + +++   ++  
Sbjct: 255 ETYDACALYTSLQSGKRAALESVGSFADGTAVRLLGEETFRVAQEVVDEVVLVNTDEICA 314

Query: 268 TCLRYVSDFGQIVEPA-----CGASLHIGY-HPEL 296
                  D   IVEP+      G   ++ + HPE+
Sbjct: 315 GIKDIFEDTRSIVEPSGALAVAGMKKYVSHLHPEI 349

>TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {ON}
           Anc_7.367 YER086W
          Length = 569

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/263 (24%), Positives = 101/263 (38%), Gaps = 28/263 (10%)

Query: 28  IKYENLQPGGSFKSRGIGNLISLKSENGLVKSHVLXXXXXXXXXXXXXXXKQMELPCTVV 87
           +K E+L P  SFK RG  N+I+ K ++      V+               K M +P T+V
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIA-KLDDSQKNQGVIACSAGNHAQGVAFAAKHMSIPATIV 148

Query: 88  VPTSTKQRMVQKIKNSGAEVIIRGSHWKEADNYLQQNYIQSFRNDGTSKPLYVHPFDDPK 147
           +P ST     Q +   G++V++ G+ + EA         +  R         + PFD P 
Sbjct: 149 MPVSTPSIKYQNVSRLGSQVVLYGNDFDEAK-------AECTRLSEERGLTNIPPFDHPY 201

Query: 148 VWEGHSTMVHEIIDNLREQNISVENVRGIVCSVXXXXXXXXXXXXXEDHGLADKIPVIAV 207
           V  G  T+  EI+  +R  N +      + C                   +A  I +I V
Sbjct: 202 VIAGQGTVAMEILRQVR--NSAKIGAVFVPCGGGGLVAGIGAYLKR----IAPHIKIIGV 255

Query: 208 ETYGCNVLNASLNAGRPVMLDKITSLATSLG-------STYIPQGVFENAVRYGAKSLVL 260
           ET+    L+ SL  G+   L  + + A           +  I Q V +  V  G   +  
Sbjct: 256 ETFDSATLHTSLKNGKRTPLASVGTFADGTSVRMIGEETFRIAQDVVDEVVLVGTDEICA 315

Query: 261 EDKDVIETCLRYVSDFGQIVEPA 283
             KD+ E       D   IVEP+
Sbjct: 316 AIKDIFE-------DTRGIVEPS 331

>Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar to
           Ashbya gossypii ACR232C
          Length = 570

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 73/280 (26%), Positives = 119/280 (42%), Gaps = 22/280 (7%)

Query: 7   KTPLLR-QILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKSENGLVKSHVLXXX 65
           ++P+ R + L+ +  T++    +K E+L P  SFK RG  N+IS   ++   K  V+   
Sbjct: 72  ESPISRSEFLSSRLNTDVQ---LKREDLLPVFSFKLRGAYNMIS-HLDDVQKKCGVIACS 127

Query: 66  XXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWKEADNYLQQNY 125
                       K + +P T+V+P ST     Q +   GAEV++ G ++  A        
Sbjct: 128 AGNHAQGVAYSAKHLGIPATIVMPVSTPSIKYQNVSRLGAEVVLYGDNFDAAK------- 180

Query: 126 IQSFRNDGTSKPLY-VHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRGIVCSVXXXX 184
           ++  R     K LY + PFD P V  G  T+  EI+  +  QN S   +  + C+V    
Sbjct: 181 VECSRL-SEEKGLYDIPPFDHPYVIAGQGTIAMEILKQI--QNSS--KIGAVFCAVGGGG 235

Query: 185 XXXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLATSLGSTYIPQ 244
                    +    A  I VI VETY    L+ S+       L ++   A       I +
Sbjct: 236 LIAGVGAYIKR--AAPHIKVIGVETYDAATLHTSMQNNARTTLSQVGGFADGTSVRLIGE 293

Query: 245 GVFENAVRYGAKSLVLEDKDVIETCLRYV-SDFGQIVEPA 283
             F  A R     ++L + D I   ++ +  D   +VEP+
Sbjct: 294 ESFRVA-REVVDEVILVNTDEICAAIKDIFEDTRAVVEPS 332

>Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 60/263 (22%), Positives = 105/263 (39%), Gaps = 14/263 (5%)

Query: 26  IFIKYENLQPGGSFKSRGIGNLISLKSENGLVKSHVLXXXXXXXXXXXXXXXKQMELPCT 85
           + +K E+L P  SFK RG  N+I+ K ++      V+               K +++P T
Sbjct: 95  VILKREDLLPVFSFKLRGAYNMIA-KLDDSQRNQGVIACSAGNHAQGVAFAAKHLKIPAT 153

Query: 86  VVVPTSTKQRMVQKIKNSGAEVIIRGSHWKEADNYLQQNYIQSFRNDGTSKPLYVHPFDD 145
           +V+P  T     Q +   G++V++ G+ + EA    +    +     G +    + PFD 
Sbjct: 154 IVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECAKLAEERGLTN---IPPFDH 206

Query: 146 PKVWEGHSTMVHEIIDNLREQNISVENVRGIVCSVXXXXXXXXXXXXXEDHGLADKIPVI 205
           P V  G  T+  EI+  +R  N     +  +   V             +   +A  I VI
Sbjct: 207 PYVIAGQGTVAMEILRQVRTAN----KIGAVFVPVGGGGLIAGIGAYLKR--VAPHIKVI 260

Query: 206 AVETYGCNVLNASLNAGRPVMLDKITSLATSLGSTYIPQGVFENAVRYGAKSLVLEDKDV 265
            VETY    L+ SL   +   L  + + A       I +  F  A +   + +++   ++
Sbjct: 261 GVETYDAATLHNSLQRNQRTPLPVVGTFADGTSVRMIGEETFRVAQQVVDEVVLVNTDEI 320

Query: 266 IETCLRYVSDFGQIVEPACGASL 288
                    D   IVEP+   S+
Sbjct: 321 CAAVKDIFEDTRSIVEPSGALSV 343

>ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 569

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 64/262 (24%), Positives = 112/262 (42%), Gaps = 16/262 (6%)

Query: 28  IKYENLQPGGSFKSRGIGNLISLKSENGLVKSHVLXXXXXXXXXXXXXXXKQMELPCTVV 87
           +K E+L P  SFK RG  N+I+   EN   +  V+               + M +P T+V
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAKLDENQKNQG-VIACSAGNHAQGVAYAARHMNIPATIV 148

Query: 88  VPTSTKQRMVQKIKNSGAEVIIRGSHWKEADNYLQQNYIQSFRNDGTSKPLYVHPFDDPK 147
           +P ST     Q +   G++V++ G+ + EA    +    +     G +    + PFD P 
Sbjct: 149 MPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECAKLAEERGLTN---IPPFDHPY 201

Query: 148 VWEGHSTMVHEIIDNLREQNISVENVRGIVCSVXXXXXXXXXXXXXEDHGLADKIPVIAV 207
           V  G  T+  EI   LR+ + S++ +  +   V             +   +A  I ++ V
Sbjct: 202 VIAGQGTVAMEI---LRQVHNSLK-IGAVFVPVGGGGLIAGIGAYLKR--IAPHIKIVGV 255

Query: 208 ETYGCNVLNASLNAGRPVMLDKITSLATSLGSTYIPQGVFENAVRYGAKSLVLEDKDVIE 267
           ET+    L+AS+  G+  +L  + S A       I +  F  +       +VL + D I 
Sbjct: 256 ETHDAPTLSASMKTGKRELLKTVGSFADGTSVRIIGEETFRVSQEV-VDEIVLVNTDEIC 314

Query: 268 TCLRYV-SDFGQIVEPACGASL 288
             ++ +  D   I+EP+   S+
Sbjct: 315 AAVKDIFEDTRSIIEPSGALSV 336

>YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threonine
           deaminase, catalyzes the first step in isoleucine
           biosynthesis; expression is under general amino acid
           control; ILV1 locus exhibits highly positioned
           nucleosomes whose organization is independent of known
           ILV1 regulation
          Length = 576

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 59/263 (22%), Positives = 105/263 (39%), Gaps = 14/263 (5%)

Query: 26  IFIKYENLQPGGSFKSRGIGNLISLKSENGLVKSHVLXXXXXXXXXXXXXXXKQMELPCT 85
           + +K E+L P  SFK RG  N+I+ K ++      V+               K +++P T
Sbjct: 95  VILKREDLLPVFSFKLRGAYNMIA-KLDDSQRNQGVIACSAGNHAQGVAFAAKHLKIPAT 153

Query: 86  VVVPTSTKQRMVQKIKNSGAEVIIRGSHWKEADNYLQQNYIQSFRNDGTSKPLYVHPFDD 145
           +V+P  T     Q +   G++V++ G+ + EA    +    +     G +    + PFD 
Sbjct: 154 IVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECAKLAEERGLTN---IPPFDH 206

Query: 146 PKVWEGHSTMVHEIIDNLREQNISVENVRGIVCSVXXXXXXXXXXXXXEDHGLADKIPVI 205
           P V  G  T+  EI+  +R  N     +  +   V             +   +A  I +I
Sbjct: 207 PYVIAGQGTVAMEILRQVRTAN----KIGAVFVPVGGGGLIAGIGAYLKR--VAPHIKII 260

Query: 206 AVETYGCNVLNASLNAGRPVMLDKITSLATSLGSTYIPQGVFENAVRYGAKSLVLEDKDV 265
            VETY    L+ SL   +   L  + + A       I +  F  A +   + +++   ++
Sbjct: 261 GVETYDAATLHNSLQRNQRTPLPVVGTFADGTSVRMIGEETFRVAQQVVDEVVLVNTDEI 320

Query: 266 IETCLRYVSDFGQIVEPACGASL 288
                    D   IVEP+   S+
Sbjct: 321 CAAVKDIFEDTRSIVEPSGALSV 343

>Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 65/264 (24%), Positives = 108/264 (40%), Gaps = 16/264 (6%)

Query: 26  IFIKYENLQPGGSFKSRGIGNLISLKSENGLVKSHVLXXXXXXXXXXXXXXXKQMELPCT 85
           + +K E+L P  SFK RG  N+I+ K ++      V+               K +++P T
Sbjct: 95  VILKREDLLPVFSFKLRGAYNMIA-KLDDSQRNQGVIACSAGNHAQGVAFAAKHLKIPAT 153

Query: 86  VVVPTSTKQRMVQKIKNSGAEVIIRGSHWKEADNYLQQNYIQSFRNDGTSKPLYVHPFDD 145
           +V+P  T     Q +   G++V++ G+ + EA    +    +     G +    + PFD 
Sbjct: 154 IVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECAKLAEERGLTN---IPPFDH 206

Query: 146 PKVWEGHSTMVHEIIDNLREQNISVENVRGIVCSVXXXXXXXXXXXXXEDHGLADKIPVI 205
           P V  G  T+  EI+  +R  N     +  +   V             +   +A  I VI
Sbjct: 207 PYVIAGQGTVAMEILRQVRTAN----KIGAVFVPVGGGGLIAGIGAYLKR--VAPHIKVI 260

Query: 206 AVETYGCNVLNASLNAGRPVMLDKITSLATSLGSTYIPQGVFENAVRYGAKSLVLEDKDV 265
            VET+    L+ SL   +   L  + S A       I +  F  A +     +VL + D 
Sbjct: 261 GVETFDAPTLHNSLQRNQRTPLPVVGSFADGTSVRMIGEETFRVAQQV-VDEVVLVNTDE 319

Query: 266 IETCLRYV-SDFGQIVEPACGASL 288
           I   ++ V  D   IVEP+   S+
Sbjct: 320 ICAAVKDVFEDTRSIVEPSGALSV 343

>KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {ON}
           Anc_7.367 YER086W
          Length = 577

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 116/282 (41%), Gaps = 34/282 (12%)

Query: 28  IKYENLQPGGSFKSRGIGNLISLKSENGLVKSHVLXXXXXXXXXXXXXXXKQMELPCTVV 87
           +K E+L P  SFK RG  N+++ K ++      V+               K +++P T+V
Sbjct: 98  LKREDLLPVFSFKLRGAYNMMA-KLDDTQKNQGVIACSAGNHAQGVAFAAKHLDIPATIV 156

Query: 88  VPTSTKQRMVQKIKNSGAEVIIRGSHWKEADNYLQQNYIQSFRNDGTSKPLYVHPFDDPK 147
           +P ST     Q +   G++V++ G+ + EA    +    +  +  G +    + PFD P 
Sbjct: 157 MPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECTKLSKERGLTN---IPPFDHPY 209

Query: 148 VWEGHSTMVHEIIDNLREQNISVENVRGIVCSVXXXXXXXXXXXXXEDHGLADKIPVIAV 207
           V  G  T+  EI   LR+ +I+ +     V                    +A  I +I V
Sbjct: 210 VIAGQGTVAMEI---LRQVHIANKIGAVFVPVGGGGLVAGVGAYLKR---IAPHIKIIGV 263

Query: 208 ETYGCNVLNASLNAGRPVMLDKITSLA--TSLG-----STYIPQGVFENAVRYGAKSLVL 260
           ET+  + L  SL  GR   L  + + A  TS+      +  I Q V +  V      +  
Sbjct: 264 ETFDASTLYTSLQRGRRTSLPSVGTFADGTSVKLIGEETFRISQDVVDEVVLVNTDEICA 323

Query: 261 EDKDVIETCLRYVSDFGQIVEPA-----CGASLHIGY-HPEL 296
             KD+ E       D   IVEP+      G   +I + HPE+
Sbjct: 324 AVKDIFE-------DTRSIVEPSGALAVAGMKKYITHLHPEI 358

>ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER086W
           (ILV1)
          Length = 560

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 67/272 (24%), Positives = 109/272 (40%), Gaps = 19/272 (6%)

Query: 13  QILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKSENGLVKSHVLXXXXXXXXXX 72
           ++L+ K  T    + +K E+L P  SFK RG  N+IS   E     + V+          
Sbjct: 70  KLLSAKLDT---NVCLKREDLLPVFSFKLRGAYNMISNLDEYQ-KSAGVIACSAGNHAQG 125

Query: 73  XXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWKEADNYLQQNYIQSFRND 132
                +++ +   +V+PTST       +   GAEV++ G  + EA         +  R  
Sbjct: 126 VAFSARELGIRAMIVMPTSTPSIKYNSVAAMGAEVVLYGKDFDEAK-------AECARLA 178

Query: 133 GTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRGIVCSVXXXXXXXXXXXX 192
              K   + PFD P V  G  T+  EI+     Q  +   +  + C V            
Sbjct: 179 QLHKLTDIPPFDHPYVIAGQGTIATEIL----RQVHNASQIGAVFCGVGGGGLIAGIGSY 234

Query: 193 XEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLATSLGSTYIPQGVFENAVR 252
            +   +A  I +I VET+    L+ +L  GR  ML  +   A       + +  F  A R
Sbjct: 235 LKR--IAPHIKIIGVETHDAPTLHTALKQGRRTMLPAVGCFADGTSVRMMGEETFRVA-R 291

Query: 253 YGAKSLVLEDKDVIETCLRYV-SDFGQIVEPA 283
                +VL + D +   ++ +  D   IVEP+
Sbjct: 292 DVVDEVVLVNTDELCAAIKDIFEDTRAIVEPS 323

>NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {ON}
           Anc_7.367
          Length = 570

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 64/262 (24%), Positives = 101/262 (38%), Gaps = 16/262 (6%)

Query: 28  IKYENLQPGGSFKSRGIGNLISLKSENGLVKSHVLXXXXXXXXXXXXXXXKQMELPCTVV 87
           +K E+L P  SFK RG  N+I+ K ++      V+               K + +P T+V
Sbjct: 91  LKREDLLPVFSFKLRGAYNMIA-KLDDSQRNQGVIACSAGNHAQGVAFAAKHLNIPATIV 149

Query: 88  VPTSTKQRMVQKIKNSGAEVIIRGSHWKEADNYLQQNYIQSFRNDGTSKPLYVHPFDDPK 147
           +P ST     Q +   G++V++ G+ + EA    +    +     G +    + PFD P 
Sbjct: 150 MPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECTKLAEERGLTN---IPPFDHPY 202

Query: 148 VWEGHSTMVHEIIDNLREQNISVENVRGIVCSVXXXXXXXXXXXXXEDHGLADKIPVIAV 207
           V  G  T+  EI+  +   N        +                     +A  I +I V
Sbjct: 203 VIAGQGTVAMEILRQVHNANKIGAVFVPVGGGGLVAGVGAYLKR------IAPHIKIIGV 256

Query: 208 ETYGCNVLNASLNAGRPVMLDKITSLATSLGSTYIPQGVFENAVRYGAKSLVLEDKDVIE 267
           ET+    L  SL  GR   L  +   A       I +  F  A       +VL + D I 
Sbjct: 257 ETHDAATLQTSLKHGRRTPLSVVGPFADGTSVRLIGEETFRVAQEV-VDEVVLVNTDEIC 315

Query: 268 TCLRYV-SDFGQIVEPACGASL 288
             ++ V  D   IVEP+   S+
Sbjct: 316 AAVKDVFEDTRSIVEPSGALSV 337

>NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON}
           Anc_7.367
          Length = 569

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 63/275 (22%), Positives = 108/275 (39%), Gaps = 20/275 (7%)

Query: 28  IKYENLQPGGSFKSRGIGNLISLKSENGLVKSHVLXXXXXXXXXXXXXXXKQMELPCTVV 87
           +K E+L P  SFK RG  N+I+ K ++      V+               K + +P T+V
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIA-KLDDSQRNQGVIACSAGNHAQGVAYAAKHLGIPATIV 148

Query: 88  VPTSTKQRMVQKIKNSGAEVIIRGSHWKEADNYLQQNYIQSFRNDGTSKPLYVHPFDDPK 147
           +P ST     Q +   G++V++ G+ + EA    +    +     G +    + PFD P 
Sbjct: 149 MPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECTKLAEERGLTN---IPPFDHPY 201

Query: 148 VWEGHSTMVHEIIDNLREQNISVENVRGIVCSVXXXXXXXXXXXXXEDHGLADKIPVIAV 207
           V  G  T+  EI+  +   N     +  +   V             +   +A  I VI V
Sbjct: 202 VIAGQGTVAMEILRQVHNAN----KIGAVFVPVGGGGFIAGVGAYLKR--IAPHIKVIGV 255

Query: 208 ETYGCNVLNASLNAGRPVMLDKITSLATSLGSTYIPQGVFENAVRYGAKSLVLEDKDVIE 267
           ET+    L+ SL   +   L  + + A       I +  F  A +   + +++   ++  
Sbjct: 256 ETFDAATLHTSLKHNKRTPLPTVGTFADGTSVRVIGEETFRVAQQVVDEVVLVNTDEICA 315

Query: 268 TCLRYVSDFGQIVEPA-----CGASLHI-GYHPEL 296
                  D   IVEP+      G   +I   HPE+
Sbjct: 316 AVKDIFEDTRSIVEPSGALAVAGMKKYITNLHPEI 350

>CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086w ILV1 anabolic serine and threonine
           dehydratase precursor
          Length = 571

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 66/276 (23%), Positives = 111/276 (40%), Gaps = 22/276 (7%)

Query: 28  IKYENLQPGGSFKSRGIGNLISLKSENGLVKSHVLXXXXXXXXXXXXXXXKQMELPCTVV 87
           +K E+L P  SFK RG  N+I+ K ++      V+               + +++P T+V
Sbjct: 92  LKREDLLPVFSFKLRGAYNMIA-KLDDTQRNQGVIACSAGNHAQGVAYAARHLDIPATIV 150

Query: 88  VPTSTKQRMVQKIKNSGAEVIIRGSHWKEADNYLQQNYIQSFRNDGTSKPLYVHPFDDPK 147
           +P ST     Q +   G++V++ G+ + EA    +    +     G +    + PFD P 
Sbjct: 151 MPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECTKLAEERGLTN---IPPFDHPY 203

Query: 148 VWEGHSTMVHEIIDNLREQNISVENVRGIVCSVXXXXXXXXXXXXXEDHGLADKIPVIAV 207
           V  G  T+  EI+  +   N     +  +   V             +   +   I +I V
Sbjct: 204 VIAGQGTVAMEILRQVYNSN----KIGAVFVPVGGGGLIAGVGAYLKR--VTPHIKIIGV 257

Query: 208 ETYGCNVLNASLNAGRPVMLDKITSLATSLGSTYIPQGVFENAVRYGAKSLVLEDKDVIE 267
           ET+    L+ SL   +   L  + + A       I +  F  A R     +VL + D I 
Sbjct: 258 ETHDAATLHTSLQRNKRTNLASVGTFADGTSVRIIGEETFRVA-REVVDEIVLVNTDEIC 316

Query: 268 TCLRYV-SDFGQIVEPA-----CGASLHIG-YHPEL 296
             ++ V  D   IVEP+      G   +I   HPE+
Sbjct: 317 AAVKDVFEDTRSIVEPSGALAVAGMKKYITQLHPEI 352

>TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON}
           Anc_7.367 YER086W
          Length = 575

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 66/281 (23%), Positives = 113/281 (40%), Gaps = 26/281 (9%)

Query: 25  QIFIKYENLQPGGSFKSRGIGNLISLKSENGLVKSHVLXXXXXXXXXXXXXXXKQMELPC 84
           QI +K E+L P  SFK RG  N+++ K +    K  V+               K + +P 
Sbjct: 88  QIQLKREDLLPVFSFKMRGAYNMVA-KLDETQRKQGVIACSAGNHAQGVAYAAKHLGIPA 146

Query: 85  TVVVPTSTKQRMVQKIKNSGAEVIIRGSHWKEADNYLQQNYIQSFRNDGTSKPLYVHPFD 144
           T+V+P ST     + +   G++V++ G+ +  +    +       R       + + PFD
Sbjct: 147 TIVMPVSTPSIKYENVSRLGSQVVLYGNDFDSSKGECE-------RLCEERGLVNIPPFD 199

Query: 145 DPKVWEGHSTMVHEIIDNLREQNISVENVRGIVCSVXXXXXXXXXXXXXEDHGLADKIPV 204
            P V  G  T+  EI   LR+   S +     V                    +A  I +
Sbjct: 200 HPYVIAGQGTVAMEI---LRQVKNSAKIGAVFVPVGGGGLVAGIGAYLKR---IAPHIKI 253

Query: 205 IAVETYGCNVLNASLNAGRPVMLDKITSLATSLGSTYIPQGVFENAVRYGAKSLVLEDKD 264
           + VETY    L  SL+ G+   L+ + + A       I +  F  + +     +VL + D
Sbjct: 254 VGVETYDAATLKTSLDNGKRTELNTVGTFADGTAVKMIGEETFRVS-KDVVDEIVLVNTD 312

Query: 265 VIETCLRYV-SDFGQIVEPACGASL--------HIGYHPEL 296
            +   ++ +  D   IVEP+   S+        H+  HPE+
Sbjct: 313 ELCAAVKDIFEDTRSIVEPSGALSVAGLKKYVQHL--HPEI 351

>Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {ON}
           YER086W (ILV1) - threonine deaminase [contig 101] FULL
          Length = 562

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 59/257 (22%), Positives = 97/257 (37%), Gaps = 16/257 (6%)

Query: 28  IKYENLQPGGSFKSRGIGNLISLKSENGLVKSHVLXXXXXXXXXXXXXXXKQMELPCTVV 87
           +K E+L P  SFK RG  N+++  +E G     V+               + + +P  +V
Sbjct: 83  LKREDLLPVFSFKLRGAYNMMAKLAE-GQGNKGVIACSAGNHAQGVAFASRHLNIPAIIV 141

Query: 88  VPTSTKQRMVQKIKNSGAEVIIRGSHWKEADNYLQQNYIQSFRNDGTSKPLYVHPFDDPK 147
           +P +T     Q +   G +V++ G+ + EA        I+  R         + PFD P 
Sbjct: 142 MPVNTPSIKYQNVSRLGGQVVLYGNDFDEAK-------IECARISEERGLTNIPPFDHPY 194

Query: 148 VWEGHSTMVHEIIDNLREQNISVENVRGIVCSVXXXXXXXXXXXXXED-HGLADKIPVIA 206
           V  G  T+  EI   LR+    V N   I                      +A  I ++ 
Sbjct: 195 VIAGQGTVAMEI---LRQ----VHNASKIGAVFVPVGGGGLVAGVAAYLKRIAPHIKIVG 247

Query: 207 VETYGCNVLNASLNAGRPVMLDKITSLATSLGSTYIPQGVFENAVRYGAKSLVLEDKDVI 266
           VETY    L  SL+AG    L  + + A       I +  F     +  + +++   ++ 
Sbjct: 248 VETYDSATLKTSLDAGCRTPLTSVGTFADGTSVRMIGEETFRICEDFVDEVVLVNTDEIC 307

Query: 267 ETCLRYVSDFGQIVEPA 283
                   D   IVEP+
Sbjct: 308 AAVKDIFEDTRSIVEPS 324

>SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {ON}
           similar to uniprot|P36007 Saccharomyces cerevisiae
           YKL218C SRY1 3-hydroxyaspartate dehydratase deaminates
           L- threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia required for survival in the presence of
           hydroxyaspartate
          Length = 320

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 65/279 (23%), Positives = 106/279 (37%), Gaps = 25/279 (8%)

Query: 7   KTPLL-RQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGN-LISLKSENGLVKSHVLXX 64
           KTP+L  + +N +   E   ++ K EN Q  G+FK RG  N L+ L  E     + V+  
Sbjct: 22  KTPVLTSRTVNAELGAE---VYFKCENFQRIGAFKFRGAMNTLLKLTQEQ--RAAGVVAF 76

Query: 65  XXXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWKEADNYLQQN 124
                        K + +P T+V+P       V+     GA ++         D Y +  
Sbjct: 77  SSGNHAQAIALSAKLLGVPATIVMPNDAPAAKVRATAGYGANIV-------RYDRYTEDR 129

Query: 125 YIQSFRNDGTSKPL-YVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRGIVCSVXXX 183
             Q  R     K L  V P+D P V  G  T   E+I+ + E ++           V   
Sbjct: 130 E-QIGRALAEEKGLTLVPPYDHPDVIAGQGTAAKELIEEVGELDL---------LFVPLG 179

Query: 184 XXXXXXXXXXEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLATSLGSTYIP 243
                         L+ +  +I VE    N    SL +G  V +D   ++A    + ++ 
Sbjct: 180 GGGLLSGSALAAKRLSPRCEIIGVEPEAGNDGQQSLRSGSIVHIDTPETIADGAQTQHLG 239

Query: 244 QGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEP 282
           Q  FE      A  L   D +++++   +      +VEP
Sbjct: 240 QYTFEVIHANVADILTASDAELVDSMRFFAERMKIVVEP 278

>KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 573

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 59/257 (22%), Positives = 92/257 (35%), Gaps = 16/257 (6%)

Query: 28  IKYENLQPGGSFKSRGIGNLISLKSENGLVKSHVLXXXXXXXXXXXXXXXKQMELPCTVV 87
           +K E+L P  SFK RG  N+++  SE       V+               + + +P  +V
Sbjct: 94  LKREDLLPVFSFKLRGAYNMMAKLSE-AQKNQGVIACSAGNHAQGVAFASRHLNIPAIIV 152

Query: 88  VPTSTKQRMVQKIKNSGAEVIIRGSHWKEADNYLQQNYIQSFRNDGTSKPLYVHPFDDPK 147
           +P +T     Q +   G +V++ G+ + EA         +  R         + PFD P 
Sbjct: 153 MPVNTPSIKYQNVSRLGGQVVLYGNDFDEAKT-------ECTRISEERGLTNIPPFDHPY 205

Query: 148 VWEGHSTMVHEIIDNLREQNISVENVRGIVCSVXXXXXXXXXXXXXED-HGLADKIPVIA 206
           V  G  T+  EI   LR+    V N   I                      +A  I +I 
Sbjct: 206 VIAGQGTVAMEI---LRQ----VHNAAKIGAVFVPVGGGGLVAGVAAYLKRIAPHIKIIG 258

Query: 207 VETYGCNVLNASLNAGRPVMLDKITSLATSLGSTYIPQGVFENAVRYGAKSLVLEDKDVI 266
           VETY    L  SL AG    L  + + A       I +  F          +++   ++ 
Sbjct: 259 VETYDSATLKTSLEAGTRTPLSTVGTFADGTSVRMIGEETFRICQDLVDDVILVNTDEIC 318

Query: 267 ETCLRYVSDFGQIVEPA 283
                   D   IVEP+
Sbjct: 319 AAVKDIFEDTRSIVEPS 335

>YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}
           SRY13-hydroxyaspartate dehydratase, deaminates
           L-threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia; required in the presence of hydroxyaspartate;
           highly similar to mouse serine racemase (Srr) but has no
           serine racemase activity
          Length = 326

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 69/164 (42%), Gaps = 12/164 (7%)

Query: 1   MNNWYYKTPLL-RQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKSENGLVKS 59
           +  +  KTP+L  ++LN +      QI+ K EN Q  G+FK RG  N +S  S+    K 
Sbjct: 16  IKEYVNKTPVLTSRMLNDRLGA---QIYFKGENFQRVGAFKFRGAMNAVSKLSDEKRSKG 72

Query: 60  HVLXXXXXXXXXXXXXXXKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWKEADN 119
            V+               K + +P T+V+P       V      GA  IIR + + E   
Sbjct: 73  -VIAFSSGNHAQAIALSAKLLNVPATIVMPEDAPALKVAATAGYGAH-IIRYNRYTEDRE 130

Query: 120 YLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNL 163
            + +   Q     G +    + P+D P V  G  T   E+++ +
Sbjct: 131 QIGR---QLAAEHGFA---LIPPYDHPDVIAGQGTSAKELLEEV 168

>Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON}
           YDL028C (REAL)
          Length = 765

 Score = 33.5 bits (75), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 45/85 (52%), Gaps = 13/85 (15%)

Query: 200 DKIPVIAVETYGCNVLNASL--NAGRPVMLDKITS---LATSLGSTYIPQGVFENAVRYG 254
           +KIP  A+E     ++ A L  N  +   +DK+ S   L   + S  I + + +NAVRYG
Sbjct: 684 EKIPKSAIE-----LMKACLYRNPDKRWTVDKVLSSTFLQPFMISGSIMEDLIKNAVRYG 738

Query: 255 A-KSLVLED--KDVIETCLRYVSDF 276
           + K  +  D   DV+ET LR  SD+
Sbjct: 739 SEKPQISHDDLNDVVETVLRKFSDY 763

>KNAG0J02670 Chr10 (497838..499340) [1503 bp, 500 aa] {ON}
          Anc_4.69 YGR155W
          Length = 500

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (55%)

Query: 24 PQIFIKYENLQPGGSFKSRGIGNLISLKSENGLV 57
          PQ+++K E   PGGS K R   N+I      GL+
Sbjct: 31 PQVYVKLELYNPGGSTKDRIAKNMIEYAESQGLI 64

>KLLA0F09317g Chr6 (861757..863238) [1482 bp, 493 aa] {ON} similar
          to uniprot|P32582 Saccharomyces cerevisiae YGR155W CYS4
          Cystathionine beta-synthase catalyzes the synthesis of
          cystathionine from serine and homocysteine the first
          committed step in cysteine biosynthesis
          Length = 493

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%)

Query: 8  TPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKSENGLV 57
          TPL+R     K     P+++ K E   PGGS K R   ++I    E G++
Sbjct: 16 TPLIRLQKLPKAIGIKPKVYAKLELYNPGGSIKDRIAKSMIEAAEEEGII 65

>TBLA0E03230 Chr5 complement(810836..813559) [2724 bp, 907 aa] {ON}
           Anc_6.56 YOR165W
          Length = 907

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 25/58 (43%), Gaps = 4/58 (6%)

Query: 99  KIKNSGAEVIIRGSHWKEADN----YLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGH 152
           K KNS     IRG+ WK  DN    YL+++ I S   D           D PK W+  
Sbjct: 580 KEKNSNIYKQIRGNAWKTLDNIIHDYLKEDSILSILKDKFETKFRYDENDTPKFWKNE 637

>KLTH0B03014g Chr2 (235495..238068) [2574 bp, 857 aa] {ON} weakly
           similar to uniprot|Q07895 Saccharomyces cerevisiae
           YLR001C Hypothetical ORF
          Length = 857

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 44/94 (46%), Gaps = 8/94 (8%)

Query: 204 VIAVETYGCNVLNASLNAGRPVMLDKITSLATSLGSTYIPQGVF----ENAVRYGAKSLV 259
           V+  E YG      +LN  RP +++K T  A  +    + + +     +NAV Y   SL+
Sbjct: 97  VLDFEKYGSGTHVLTLNDSRPHLIEKRTDGAWKINGVSVLKEILKPSMQNAVLYSITSLI 156

Query: 260 ---LEDKDVIETCLRYVSDFGQIVEPACGASLHI 290
              LE +D+IE     +S F  +++     +L +
Sbjct: 157 SGTLELEDLIEKSAN-ISSFSMLLDRVVFGNLQV 189

>CAGL0C01661g Chr3 complement(177284..178411) [1128 bp, 375 aa] {ON}
           similar to uniprot|P38332 Saccharomyces cerevisiae
           YBR246w
          Length = 375

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%)

Query: 126 IQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRGI 176
           + S+R  G    L + PFDD  V   HST   E+   +R+  +S+E V  +
Sbjct: 54  LHSYRTYGAVLDLKLSPFDDTLVATAHSTGNVELWRIVRDDGVSLERVSNL 104

>CAGL0E03157g Chr5 (291237..292742) [1506 bp, 501 aa] {ON} highly
          similar to uniprot|P32582 Saccharomyces cerevisiae
          YGR155w CYS4 cystathionine beta-synthase
          Length = 501

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 19/34 (55%)

Query: 24 PQIFIKYENLQPGGSFKSRGIGNLISLKSENGLV 57
          P++F K E   PGGS K R   ++I    E G++
Sbjct: 30 PRVFAKLELYNPGGSIKDRIAKSMIEYAEEQGII 63

>AGR012C Chr7 complement(738927..740405) [1479 bp, 492 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YGR155W
          (CYS4)
          Length = 492

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 19/34 (55%)

Query: 24 PQIFIKYENLQPGGSFKSRGIGNLISLKSENGLV 57
          PQ++ K E   PGGS K R    +I    E+G++
Sbjct: 31 PQVYAKLELYNPGGSIKDRIAKTMIERAEESGII 64

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,594,977
Number of extensions: 1355229
Number of successful extensions: 3383
Number of sequences better than 10.0: 67
Number of HSP's gapped: 3328
Number of HSP's successfully gapped: 67
Length of query: 335
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 225
Effective length of database: 40,868,139
Effective search space: 9195331275
Effective search space used: 9195331275
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)