Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F18502g1.4ON45045021570.0
TDEL0C069801.4ON4264548801e-114
Suva_3.1511.4ON4213524949e-57
YCL063W (VAC17)1.4ON4233644834e-55
Kpol_2002.71.4ON4744914856e-55
Smik_3.131.4ON4253574782e-54
Skud_3.21.4ON4263614591e-51
KNAG0C001901.4ON4424784558e-51
SAKL0C00440g1.4ON4624884471e-49
NDAI0A001301.4ON4783874192e-45
NCAS0B091201.4ON4333783681e-38
CAGL0B00308g1.4ON4303843191e-31
TPHA0E040201.4ON5404313062e-29
KLLA0C00462g1.4ON4603692926e-28
TBLA0A075801.4ON5133352663e-24
KAFR0D001201.4ON3994682544e-23
Kwal_33.130031.4ON4492631952e-15
KLTH0F00462g1.4ON4512611517e-10
KNAG0E041807.9ON819103830.14
Kpol_1020.24singletonOFF22095790.25
CAGL0I06446g7.527ON525112705.2
NOTE: 2 genes in the same pillar as ZYRO0F18502g were not hit in these BLAST results
LIST: AFR746C Ecym_1007

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F18502g
         (450 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]...   835   0.0  
TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa] ...   343   e-114
Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W ...   194   9e-57
YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}  VAC17Phospho...   190   4e-55
Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON} (10372.....   191   6e-55
Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)   188   2e-54
Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)      181   1e-51
KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4 Y...   179   8e-51
SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly s...   176   1e-49
NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4 YCL...   166   2e-45
NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa] ...   146   1e-38
CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar ...   127   1e-31
TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {O...   122   2e-29
KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly s...   117   6e-28
TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa] ...   107   3e-24
KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4 YC...   102   4e-23
Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W ...    80   2e-15
KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly s...    63   7e-10
KNAG0E04180 Chr5 complement(833612..836071) [2460 bp, 819 aa] {O...    37   0.14 
Kpol_1020.24 s1020 complement(54942..55604) [663 bp, 220 aa] {OF...    35   0.25 
CAGL0I06446g Chr9 complement(622713..624290) [1578 bp, 525 aa] {...    32   5.2  

>ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]
           {ON} similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 450

 Score =  835 bits (2157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/450 (92%), Positives = 415/450 (92%)

Query: 1   MPSLDDISERLFIRSQEAVLQLELWIRRQQHLSEIEHEHARDKIADQYNLYMAQLNSLCV 60
           MPSLDDISERLFIRSQEAVLQLELWIRRQQHLSEIEHEHARDKIADQYNLYMAQLNSLCV
Sbjct: 1   MPSLDDISERLFIRSQEAVLQLELWIRRQQHLSEIEHEHARDKIADQYNLYMAQLNSLCV 60

Query: 61  RSEYVRDKLNAGYQNRKPPIVNEQNYIEDLVYEFQDITVKLNELAQNQKEQVTPSSKHSN 120
           RSEYVRDKLNAGYQNRKPPIVNEQNYIEDLVYEFQDITVKLNELAQNQKEQVTPSSKHSN
Sbjct: 61  RSEYVRDKLNAGYQNRKPPIVNEQNYIEDLVYEFQDITVKLNELAQNQKEQVTPSSKHSN 120

Query: 121 GSVNSFQPRPLKITERYRTDIGATRQSPTRINGKLKNVNFVEESLPELFCPSKCTSLPGS 180
           GSVNSFQPRPLKITERYRTDIGATRQSPTRINGKLKNVNFVEESLPELFCPSKCTSLPGS
Sbjct: 121 GSVNSFQPRPLKITERYRTDIGATRQSPTRINGKLKNVNFVEESLPELFCPSKCTSLPGS 180

Query: 181 PLKMRSXXXXXXXXXXVAKSYDTGLNPNSRAKLKKQKEEEMLSVFKENQRLSITFCDDID 240
           PLKMRS          VAKSYDTGLNPNSRAKLKKQKEEEMLSVFKENQRLSITFCDDID
Sbjct: 181 PLKMRSPDRLPDRPLRVAKSYDTGLNPNSRAKLKKQKEEEMLSVFKENQRLSITFCDDID 240

Query: 241 EGSDSASDQNTVXXXXXXXXXXXXQYDVQSEKPPLRRYNSHDSVLSTKVQPISSAKCPTF 300
           EGSDSASDQNTV            QYDVQSEKPPLRRYNSHDSVLSTKVQPISSAKCPTF
Sbjct: 241 EGSDSASDQNTVISTSPIPPSHPIQYDVQSEKPPLRRYNSHDSVLSTKVQPISSAKCPTF 300

Query: 301 LTIPTANRPSMKSVTVSSAPIISSTGGKASSKDLLSSFISNTQDYDKKAXXXXXXXXXXX 360
           LTIPTANRPSMKSVTVSSAPIISSTGGKASSKDLLSSFISNTQDYDKKA           
Sbjct: 301 LTIPTANRPSMKSVTVSSAPIISSTGGKASSKDLLSSFISNTQDYDKKARNDNGNNNRFS 360

Query: 361 XXLIWNLFKQKSQKNRNPTPLRVPQQDVTSERKENQLLTTSHPSGVYSSCSRLLVKNQNS 420
             LIWNLFKQKSQKNRNPTPLRVPQQDVTSERKENQLLTTSHPSGVYSSCSRLLVKNQNS
Sbjct: 361 SNLIWNLFKQKSQKNRNPTPLRVPQQDVTSERKENQLLTTSHPSGVYSSCSRLLVKNQNS 420

Query: 421 SIISPTRQRITNGNTMYDELQEALDTELVL 450
           SIISPTRQRITNGNTMYDELQEALDTELVL
Sbjct: 421 SIISPTRQRITNGNTMYDELQEALDTELVL 450

>TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa]
           {ON} Anc_1.4 YCL063W
          Length = 426

 Score =  343 bits (880), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 208/454 (45%), Positives = 282/454 (62%), Gaps = 41/454 (9%)

Query: 4   LDDISERLFIRSQEAVLQLELWIRRQQHLSEIEHEHARDKIADQYNLYMAQLNSLCVRSE 63
           L+D+SERL  RSQEA+LQLELWI+RQQHL E+E + + DK+ +QYN+Y+AQLNSLCVRSE
Sbjct: 3   LEDLSERLLTRSQEAILQLELWIQRQQHLRELE-DSSIDKLGNQYNVYIAQLNSLCVRSE 61

Query: 64  YVRDKLNAGYQNRKPPIVNEQNYIEDLVYEFQDITVKLNELAQNQKEQVTPSSKHSNGSV 123
           YVRDKLN   + R+  I+N++ YIEDLV+EFQDITVKLNELAQ+Q    TPSSK +  S+
Sbjct: 62  YVRDKLNK-ERERRMSIINDRKYIEDLVFEFQDITVKLNELAQSQSIDSTPSSKSTRSSL 120

Query: 124 NSFQPRPLKITERYRTDIGATRQSPTRINGKLKNVNF--VEESLPELFCPSKCTSLPGSP 181
            SFQPRPLK+TER+  ++ A R+SP +    +K+V F  + +S  E    SKC SLPGSP
Sbjct: 121 GSFQPRPLKLTERHGPNVKALRESPLKNKSVIKSVKFSGLHDSKEE--AVSKCLSLPGSP 178

Query: 182 LKMRSXXXXXXXXXXVAKSYDTGLNPNSRAKLKKQKEEEMLSVFKENQRLSITFCDDIDE 241
           +++            +AKSYDTGLN  +  K K  ++ ++ S+F+ENQRLSIT  DD DE
Sbjct: 179 VRV----TGPTRSIRMAKSYDTGLNSKNTKKSKGSRDYDVPSIFRENQRLSITVFDDFDE 234

Query: 242 GSDSASDQNTVXXXXXXXXXXXXQYDVQSEKPPLRRYNSHDSVLSTKVQPISSAKCPTFL 301
            +DS SDQ+TV                  +  PLRR+NSH+S+LSTKVQPISS    +  
Sbjct: 235 DADSTSDQDTVISLVPAD---------DGKGLPLRRFNSHESILSTKVQPISSLPLFSSF 285

Query: 302 TIPTANRPSMKSVTVSSAPIISSTGGKASSKDLLSSFISNTQDYDKKAXXXXXXXXXXXX 361
            +P++NRPSMKSV VSSAP+ S T   ASS+DLLS+F++       KA            
Sbjct: 286 LLPSSNRPSMKSVRVSSAPVFSKTSAPASSRDLLSTFVTRP----GKASNATGIKQENKL 341

Query: 362 XLI--WNLFKQKSQKNRNPTPLRVPQQDVTSERKENQLLTTSHPSGVYSSC-SRLLVKN- 417
                WN FK  S  + +   +R  +Q  ++ R E+            + C S+ L K  
Sbjct: 342 GFFANWNFFKGPSSASHD---IRATKQKASASRPESN----------SADCRSKTLEKMA 388

Query: 418 -QNSSIISPTRQRITNGNTMYDELQEALDTELVL 450
            +  S  SP +  + +    Y++L+EAL TE++L
Sbjct: 389 PRRFSPRSPVKAPVFDSLISYEDLREALSTEIIL 422

>Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W
           (REAL)
          Length = 421

 Score =  194 bits (494), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 147/352 (41%), Positives = 196/352 (55%), Gaps = 31/352 (8%)

Query: 3   SLDDISERLFIRSQEAVLQLELWIRRQQHLSEIE--HEHARDKIADQYNLYMAQLNSLCV 60
           +L+DI+ERL  RS+EA+LQL+LWI+RQQ  S  E     + DK++ QYN YM+QLNSL V
Sbjct: 5   ALEDITERLLTRSEEAILQLDLWIQRQQRSSVCEPSDRDSLDKLSQQYNQYMSQLNSLYV 64

Query: 61  RSEYVRDKLNAGYQNRKPPIVNEQNYIEDLVYEFQDITVKLNELAQ--NQKEQVTPSSKH 118
           RSE VRDKL+     R     NE   IEDLV+EFQDITV+LN+LA   N+    +P S+ 
Sbjct: 65  RSESVRDKLSKEQWRRLNTEENEHKRIEDLVHEFQDITVRLNDLATVPNKASNDSPQSQS 124

Query: 119 SNGSVNSFQPRPLKITERYRTDIGATRQSPTRINGKLKNVNFVEESLPELFCPSKCTSLP 178
           +  S++SFQPRPLKI ER R  +  T   P + +     +N VE       CPSK  SLP
Sbjct: 125 TRSSLDSFQPRPLKIIERQRLCV-VTPSKPPKKSVVFNPINDVE-------CPSKTNSLP 176

Query: 179 GSPLKMRSXXXXXXXXXXVAKSYDTGLNPNSRAKLKKQKEEEMLSVFKENQRLSITFCDD 238
            SP K              AKS+DTGLN + +       E    S FK  QRLS+TF D+
Sbjct: 177 CSPKKQPG----KAHTLRAAKSHDTGLNKSKKPSSTDAYE----SFFKNKQRLSLTFFDE 228

Query: 239 IDEGSDSASDQNTVXXXXXXXXXXXXQYDVQSEKPPLRRYNSHDSVLSTKVQPISSAKCP 298
           + +  D  SDQ+T+                 +E  PLRRYNSH+S+LS K  P  S    
Sbjct: 229 M-DDEDLDSDQDTIILPNISTPSHMDMATKGAEFEPLRRYNSHESILSNKPAPAMSLSLG 287

Query: 299 TFLTIPTAN---RPSMKSVTVSSAPIISST------GGKA-SSKDLLSSFIS 340
           +F     +N     S+ +V V+  P ++++      G +A +SK LLSSFI+
Sbjct: 288 SFPFFKPSNPTFGTSVSNVQVNYRPKMAASMIPKRNGSRAPTSKALLSSFIA 339

>YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}
           VAC17Phosphoprotein involved in vacuole inheritance;
           degraded in late M phase of the cell cycle; acts as a
           vacuole-specific receptor for myosin Myo2p
          Length = 423

 Score =  190 bits (483), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 149/364 (40%), Positives = 198/364 (54%), Gaps = 37/364 (10%)

Query: 3   SLDDISERLFIRSQEAVLQLELWIRRQQH--LSEIEHEHARDKIADQYNLYMAQLNSLCV 60
           +L+DI+ERL IRSQEA+LQL+LWI+RQQ   + +   + + DK++ QYN YM+QLNSL V
Sbjct: 5   ALEDITERLLIRSQEAILQLDLWIQRQQRSSICQTTDQESLDKLSQQYNQYMSQLNSLYV 64

Query: 61  RSEYVRDKLNAGYQNRKPPIVNEQNYIEDLVYEFQDITVKLNELAQ--NQKEQVTPSSKH 118
           RSE VRDKL+   Q R     NE   IEDLV EFQDIT++LNELA   N+    +P S+ 
Sbjct: 65  RSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATVPNEAPNDSPQSQS 124

Query: 119 SNGSVNSFQPRPLKITERYRTDIGATRQSPTRINGKLKNVNFVEESLPELFCPSKCTSLP 178
           +  S+ SFQPRPLKI ER R  +    + P       K+V F    + E+ CPSK  SLP
Sbjct: 125 TRSSLGSFQPRPLKIIERQRLCMVTPSKPPK------KSVGF--NPINEVDCPSKTNSLP 176

Query: 179 GSPLKMRSXXXXXXXXXXVAKSYDTGLNPNSRAKLKKQKEEEMLSVFKENQRLSITFCDD 238
            SP K  +           AKS+DTGLN + +       E    S FK  QRLS+T   D
Sbjct: 177 CSPKKQPA----RNRTLRAAKSHDTGLNKSKKPSSSDTYE----SFFKNRQRLSLT-FFD 227

Query: 239 IDEGSDSASDQNTVXXXXXXXXXXXXQYDVQSEKPPLRRYNSHDSVLSTKVQPISSAKCP 298
             +  D  SDQ+T+                 +E  PLRRYNSH+S+LS K  P  S    
Sbjct: 228 EMDDEDFDSDQDTIILPNISTPPHVGVTAKGAEFEPLRRYNSHESILSNKPAPSKSLNLG 287

Query: 299 TFLTIPTANRP-------SMKSVTVSSAPIISSTGGK-------ASSKDLLSSFISNTQD 344
           +F    +  RP       S+ +V V+  P +++T          +SSK LLSSFI+ +  
Sbjct: 288 SFSA--SFFRPSNPTFGTSISNVQVNCHPTVAATMAPSRNGPRISSSKALLSSFIARSDT 345

Query: 345 YDKK 348
           +  K
Sbjct: 346 HTVK 349

>Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON}
           (10372..11796) [1425 nt, 475 aa]
          Length = 474

 Score =  191 bits (485), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 174/491 (35%), Positives = 248/491 (50%), Gaps = 59/491 (12%)

Query: 1   MP--SLDDISERLFIRSQEAVLQLELWIRRQQHLSEIEHEHAR---DKIADQYNLYMAQL 55
           MP  ++DD+SERL +RSQEA+LQL+LWI+RQQ  +E +  H     +K+ D YNLYM+QL
Sbjct: 1   MPYSNIDDLSERLLVRSQEAILQLDLWIQRQQQWAESDDNHDENDLEKVTDTYNLYMSQL 60

Query: 56  NSLCVRSEYVRDKLNAGYQNRKPPI---------VNEQNYIEDLVYEFQDITVKLNELA- 105
           NSL +RS+ VRDKLN   ++R   I         +N Q+ IEDL++EFQDIT KLN LA 
Sbjct: 61  NSLYIRSQNVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDITRKLNVLAS 120

Query: 106 QNQKEQVTPSSKHSNGSVNSFQPRPLKITERYRTDIGATRQSPTRINGKLKNVNFVEESL 165
             ++   + SS   + S+ SFQP+PLKI+ +    +    +         K V F  E +
Sbjct: 121 SRRRCSSSKSSSSRSSSIGSFQPKPLKISLKRNKSLKEQNK---------KTVTFDVEEV 171

Query: 166 PELFCPSKCTSLPGSPLKMRSXXXXXXXXXXVAKSYDTGLNPNSRAKLKKQKEEEML-SV 224
            +L   S   SLPGSPL+              AKSYDTGLN     K KK K + +  S 
Sbjct: 172 TDLNINS-VISLPGSPLRNEQSSPPMNHHLRQAKSYDTGLNSKRSIKPKKSKIDSVYDST 230

Query: 225 FKENQRLSITFCD-DIDEGS-DSASDQNTVXXXXXXXXXXXXQY--DVQSEKPPLRRYNS 280
           FK  QRLSI+  D D +E    + SDQ TV            +   D ++   PLRRYNS
Sbjct: 231 FKNTQRLSISLFDIDTNENDITNISDQETVISSSSLTMDEPLEIIDDQKNNLKPLRRYNS 290

Query: 281 HDSVLSTKVQPISSAK---CPTFLTIPTANRPSMKSVTVSSAPIISSTGGK------ASS 331
           H+S+LSTK++PIS +K      F ++ T    +    T S+  + +    K       +S
Sbjct: 291 HESILSTKIRPISISKRFQIGPFRSVSTTTTSTNYDTTASNTDVKADDFYKPNLSNSTTS 350

Query: 332 KDLLS--SFISNTQDYDKKAXXXXXXXXXXXXXLI--WNLFK-------QKSQKNRNPTP 380
           KD+LS  S  ++ Q+ ++                   WN+F        +   K  N T 
Sbjct: 351 KDILSMYSIKNDVQNSNRGNIINNKKESNSSTSFFNKWNIFNFPLIASSEVGSKQENNTT 410

Query: 381 LRVPQQDVTSERKENQLLTTSHPSGVYSSCSRLLVKNQNSSIISPTRQRITNGNTM-YDE 439
            +       S+RK+ Q+ + S+    YS+   + +    S   SPT    T  NT+ + E
Sbjct: 411 AK----HFGSQRKK-QISSLSYNKANYST---MTIGPNGSMFCSPTIYEPTFSNTVSFQE 462

Query: 440 LQEALDTELVL 450
           L +AL+TEL L
Sbjct: 463 LHDALNTELDL 473

>Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)
          Length = 425

 Score =  188 bits (478), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 151/357 (42%), Positives = 197/357 (55%), Gaps = 33/357 (9%)

Query: 3   SLDDISERLFIRSQEAVLQLELWIRRQQHLS--EIEHEHARDKIADQYNLYMAQLNSLCV 60
           +L+DI+ERL IRSQEA+LQL+LWI+RQQ  S  +   +   DK++ QYN YM+QLNSL V
Sbjct: 5   ALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTTDQELLDKVSKQYNQYMSQLNSLYV 64

Query: 61  RSEYVRDKLNAGYQNRKPPIVNEQNYIEDLVYEFQDITVKLNELAQ--NQKEQVTPSSKH 118
           RSE VRDKL+   Q R     NE   IEDLV EFQDIT++LNELA   N+    +P S+ 
Sbjct: 65  RSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATAPNEVANDSPQSQS 124

Query: 119 SNGSVNSFQPRPLKITERYRTDIGATRQSPTRINGKLKNVNFVEESLPELFCPSKCTSLP 178
           +  S+ SFQPRPLKI ER R  +    + P +  G    +N V+       CPSK  SLP
Sbjct: 125 TRSSLESFQPRPLKIIERQRLCMVTPSKPPKKSVG-FNPINDVD-------CPSKTNSLP 176

Query: 179 GSPLKMRSXXXXXXXXXXVAKSYDTGLNPNSRAKLKKQKEEEMLSVFKENQRLSITFCDD 238
            SP K  +           AKS+DTGLN + +       E    S FK  QRLS+TF  D
Sbjct: 177 CSPKKQPA----KNHTLRAAKSHDTGLNKSKKPSSADAYE----SFFKNRQRLSLTF-FD 227

Query: 239 IDEGSDSASDQNTVXXXXXXXXXXXXQYDVQSEKPPLRRYNSHDSVLSTKVQPISSAKCP 298
             +  D  SDQ+TV                 +E  PLRRYNSH+S+LS K  P+ S    
Sbjct: 228 EMDDEDFDSDQDTVILPNISTPPHVNVTAKGAEFEPLRRYNSHESILSNKPAPLMSHSLG 287

Query: 299 TF-LTIPTANRP----SMKSVTVSSAPIISST------GGKA-SSKDLLSSFISNTQ 343
           +F ++    + P    S+ +V  +  P I++T      G  A SSK LLSSFI  ++
Sbjct: 288 SFPVSFFKPSNPTFGTSISNVQANCHPTITATMAPRRNGVHAPSSKALLSSFIGRSE 344

>Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)
          Length = 426

 Score =  181 bits (459), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 152/361 (42%), Positives = 192/361 (53%), Gaps = 47/361 (13%)

Query: 3   SLDDISERLFIRSQEAVLQLELWIRRQQHLS--EIEHEHARDKIADQYNLYMAQLNSLCV 60
           +L+DI+ERL IRSQEA+LQL+LWI+RQQ  S  +   + + DK++ QYN YM+QLNSL V
Sbjct: 5   ALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTSDQESLDKLSQQYNQYMSQLNSLYV 64

Query: 61  RSEYVRDKLNAGYQNRKPPIVNEQNYIEDLVYEFQDITVKLNELAQ--NQKEQVTPSSKH 118
           RSE VRDKL+   Q R     NE   IEDLV+EFQDIT +LNELA   +     +P S+ 
Sbjct: 65  RSESVRDKLSKEQQRRLITEDNEHQRIEDLVHEFQDITSRLNELATVPHGVSNDSPQSQS 124

Query: 119 SNGSVNSFQPRPLKITERYRTDIGATRQSPTRINGKLKNVNFVEESLPELFCPSKCTSLP 178
           +  S  SFQPRPLKI ER R  +    + P +  G    +N V+       CPSK  SLP
Sbjct: 125 TRSSSGSFQPRPLKIIERQRVCMVTPSKPPKKSVG-FNPINDVD-------CPSKTNSLP 176

Query: 179 GSPLKMRSXXXXXXXXXXVAKSYDTGLNPNSRAKLKKQKEEEMLSVFKENQRLSITFCDD 238
            SP K              AKS+DTGLN + +       E    S FK  QRLS+TF D+
Sbjct: 177 CSPKK----PPAKNRTLRAAKSHDTGLNKSKKMSSTDAYE----SFFKNKQRLSLTFFDE 228

Query: 239 IDEGSDSASDQNTVXXXXXXXXXXXXQYDVQSEKPPLRRYNSHDSVLSTKVQPISSAKC- 297
           + +  D  SDQ+T+                 +E  PLRRYNSH+S+LS K  PI S    
Sbjct: 229 M-DDEDLDSDQDTIILPNISTPPHMNVTAKGAEFEPLRRYNSHESILSNKPAPIMSLSLG 287

Query: 298 -----------PTFLTIPTANRPSMKSVTVSSAPIISST------GGKA-SSKDLLSSFI 339
                      PTF T       S  +V V   P I+ +      G  A SSK LLSSFI
Sbjct: 288 GFPGSFYKPSHPTFGT-------STSNVQVDCHPTITVSMASRRNGCYAPSSKALLSSFI 340

Query: 340 S 340
           +
Sbjct: 341 A 341

>KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4
           YCL063W
          Length = 442

 Score =  179 bits (455), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 158/478 (33%), Positives = 236/478 (49%), Gaps = 64/478 (13%)

Query: 1   MPSLDDISERLFIRSQEAVLQLELWIRRQQHLSEIEHEHARDK----IADQYNLYMAQLN 56
           M  L+D+++RL IRSQ+A+LQLELW+++Q+ L   +H     K    IA Q NL+++QLN
Sbjct: 1   MDCLEDVTDRLLIRSQDAILQLELWVQQQEKLLLTDHASVDRKKFEAIAQQRNLHLSQLN 60

Query: 57  SLCVRSEYVRDKLNAGYQNRKPPIVNEQNYIEDLVYEFQDITVKLNELAQNQKEQVTPSS 116
           SLC+RS Y+++KL A  +N        ++YIE+LVYEFQDI + LNEL++  ++  +P S
Sbjct: 61  SLCLRSRYIKEKL-ASERNICSIRKGRRSYIENLVYEFQDIAMSLNELSETNRKNGSPVS 119

Query: 117 KHSNGSVNSFQPRPLKITERYRTDIGATRQSPTRINGKLKNVNFVEESLPELFCP--SKC 174
           + +  S +SF+P+PL+I ER RT      +SPT+ N    ++    E+    F    + C
Sbjct: 120 QATTNSSDSFEPKPLRILERQRT---CNAKSPTKRNS--NHIKIPRETEKSDFTENVADC 174

Query: 175 --TSLPGSPLKMRSXXXXXXXXXXVAKSYDTGLNPNSRAKLKKQKEEEMLSVFKENQRLS 232
             +SLP SPL+             + KSY   LN       K      +++ F    RLS
Sbjct: 175 LHSSLPSSPLR---GSNGSQQTIRLTKSYHESLNGQ-----KPTSHSPLMNPFNAKNRLS 226

Query: 233 ITFCDDIDEG-----SDSASDQNTVXXXXXXXXXXXXQYDVQSEKPPLRRYNSHDSVLS- 286
           +   D+IDE       D  SDQ TV                 +   PLRRYNSH+S+LS 
Sbjct: 227 LYLFDNIDEKELTPCDDDNSDQETVMYNSPVVSKG-------AAFEPLRRYNSHESILSV 279

Query: 287 TKVQPI-SSAKCPTFLTIPTANRPSMKSVTVSSAPIISS-TGGKASSKDLLSSFISNTQD 344
            K  PI SSA+   F    T    S +SV VSS P+ +     ++ SKDLLSS       
Sbjct: 280 AKKAPIHSSAQKLQFYPSATNGTTSAQSVFVSSKPVYTKPLSVQSRSKDLLSSIAHAEAS 339

Query: 345 YDKKAXXXXXXXXXXXXXLIWNLFKQKSQK------------NRNPTPLRVPQQDVTSER 392
            D K                WNLF + S               +  + ++  ++ +T + 
Sbjct: 340 KDTKTTSVFNG---------WNLFGKSSTAAITSEVGTCAISQKKHSAIKTNRRYITGDT 390

Query: 393 KENQLLTTSHPSGVYSSCSRLLVKNQNSSIISPTRQRITNGNTMYDELQEALDTELVL 450
               + T++ P    SS  +    N+++S I+P    I +     +EL EAL+TEL+L
Sbjct: 391 L--VISTSNRPRLSRSSVRQPHGYNRHTSPITP----IVDHQVRQNELSEALETELLL 442

>SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 462

 Score =  176 bits (447), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 161/488 (32%), Positives = 225/488 (46%), Gaps = 64/488 (13%)

Query: 1   MPSLDDISERLFIRSQEAVLQLELWIRRQQHLSEIEHEHARDKIA----DQYNLYMAQLN 56
           M  L +IS++L +RSQEA+LQL+L+I+RQQ L E E     D        +Y   +AQLN
Sbjct: 1   MEGLHEISQKLLVRSQEAILQLDLYIQRQQRLYEYETLDQPDNGLLTKLQEYQTCLAQLN 60

Query: 57  SLCVRSEYVRDKLNAGYQNRKPPIVNEQNYIEDLVYEFQDITVKLNELAQNQKEQVTPSS 116
           SL +RSE++RD++ A   +R      + + I  LV EFQ IT KLNELA  Q        
Sbjct: 61  SLHIRSEHLRDRI-ASTDHR---ASQDGDSIGHLVTEFQKITTKLNELAATQDRAYQSPG 116

Query: 117 KHSNGSVNSFQPRPLKITERYR-----TDIGATRQSPTRINGKLKNVNFVEESLPELFCP 171
             S  SV+SF+P+PLKI ER +     +        P +I    KN  F ++ +      
Sbjct: 117 SQSTKSVSSFEPKPLKILERTKLQHPTSPTKRVATPPKKIAPLRKNPPFDKKVM--FSGH 174

Query: 172 SKCTSLPGSPLKMRSXXXXXXXXX--XVAKSYDTGLNPNSRAKLKKQKEEEMLSVFKENQ 229
           SK TSLPGSP    S             AKS D GLN   R   ++Q  +  L+ FKENQ
Sbjct: 175 SKSTSLPGSPSMAASSPVSIQQERFPRHAKSCDAGLNKQQR---RRQDSDNRLNFFKENQ 231

Query: 230 RLSITFCDDIDEGSDSASDQNTVXXXXXXXXXXXXQYDVQSEKPPLRRYNSHDSVLSTK- 288
           RLSI+F DD     D +SD++TV             +    +  PLRRYNSH+SVLS K 
Sbjct: 232 RLSISFFDD---EIDYSSDEDTVISVSPPETTSFKGF---PKAEPLRRYNSHESVLSRKE 285

Query: 289 VQPIS-SAKCPTFLTIPTAN---RPSMKSVTVSSAPIISSTG-------GKASSKDLLSS 337
           V P +  A+   F      N   +P  +SV+++  P+ S+            +SKDLL+ 
Sbjct: 286 VLPAALPARAGWFSLWAGRNNKPKPMAESVSINDKPVYSTAALLRSHSKTTETSKDLLAQ 345

Query: 338 FISNTQDYDKKAXXXXXXXXXXXXXLI--WNLFKQK---------SQKNRNPTPLRV--- 383
           F+S      K+              +   W LF               N  P+  R+   
Sbjct: 346 FVSAAPKQKKQTTSWFGPAEEPKRSIFSGWKLFNNSVLVTSETGLQDSNSKPSAKRIGAA 405

Query: 384 -PQQDVTSERKENQLLTTSHPSGVYSSCSRLLVKNQNSSIISPTRQRITNGNTMYDELQE 442
            P + V   R++  L ++S           L++    S  +SP  + + N    YD L E
Sbjct: 406 APAKRVPLGRRKTHLPSSS-----------LIMGPNGSRFVSPPNEPVLNNKVSYDALHE 454

Query: 443 ALDTELVL 450
           AL TE  L
Sbjct: 455 ALCTEFRL 462

>NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4
           YCL063W
          Length = 478

 Score =  166 bits (419), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 136/387 (35%), Positives = 202/387 (52%), Gaps = 76/387 (19%)

Query: 3   SLDDISERLFIRSQEAVLQLELWIRR---QQHLS------EIEHEHARDKIADQYNLYMA 53
           +L DI+ERL IRSQEA+LQL+LWI+R   QQ LS       I ++H  ++   QYN+Y+A
Sbjct: 4   TLQDITERLLIRSQEAILQLDLWIQREKKQQELSTLNNSNNITYDHVDNQ---QYNVYLA 60

Query: 54  QLNSLCVRSEYVRDKLNAGYQNRKPPIVNEQNYIEDLVYEFQDITVKLNELAQNQKEQVT 113
           QLNSL VR +Y+RDK      N+     +EQ YIE+LVYEF+ IT+KLN+L+  +K + T
Sbjct: 61  QLNSLIVRVQYIRDKFLHNI-NQLDSTQDEQKYIENLVYEFKQITLKLNDLS--KKNKTT 117

Query: 114 PSSKH------SNGSVNSFQPRPLKITERYRTDIGATRQSPTRINGKLKNVNFVEESLPE 167
            SS++      S  S+ SF+P+PLKI +R + D    ++    IN    ++   +E+L  
Sbjct: 118 SSSENSSKTASSKSSMESFEPKPLKIIKRTKND----QKVSNTINND-HDLIMQDENL-- 170

Query: 168 LFCPSKCTSLPGSPLKMRS--XXXXXXXXXXVAKSYDTGLNPNSRAK-----LKKQKEEE 220
                +  SLP SP++  S            + KS D     N+        ++K + + 
Sbjct: 171 ----QRPNSLPSSPIEKSSYVTISQNEQNLRLMKSQDFSTKKNTSRNTNYNTIRKFENDT 226

Query: 221 MLSVFKENQRLSITFCDDIDEG-----------------SDSASDQNTVXXXXXXXXXXX 263
           +   FK  QRLSI   D+ D+                  +D+ SDQ TV           
Sbjct: 227 INQFFKSQQRLSIGIFDNDDDNIYSTNMGTATRITGEYLTDNNSDQATVISQGTIKRN-- 284

Query: 264 XQYDVQSEKPPLRRYNSHDSVLSTKVQ--PI--------SSAKCPTFLTIPTANRPSMKS 313
                  +  PLRRYNSH+S+LS K+   P+         ++K P + +I    RPSM+S
Sbjct: 285 -----DDDFTPLRRYNSHESILSQKISSTPLIDNNNNLTFNSKLPLYSSIR---RPSMQS 336

Query: 314 VTVSSAPIISSTGGKASSKDLLSSFIS 340
           + V+S PI + +    +SKDLLSSF++
Sbjct: 337 IHVTSNPIFARSSQGKTSKDLLSSFVT 363

>NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa]
           {ON} Anc_1.4 YCL063W
          Length = 433

 Score =  146 bits (368), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 135/378 (35%), Positives = 186/378 (49%), Gaps = 66/378 (17%)

Query: 1   MPSLDDISERLFIRSQEAVLQLELWIRRQQHL-----------------SEIEHEHARDK 43
           M  L DISERL +RSQEA+LQL++WI+RQ+ L                 + ++      +
Sbjct: 1   MSLLQDISERLLVRSQEAILQLDVWIQRQRRLQELMEGEEEQEQGGDTNTNMDIRGTLPQ 60

Query: 44  IADQYNLYMAQLNSLCVRSEYVRDKL----NAGYQNRKPP---IVNEQNYIEDLVYEFQD 96
             +QYN YMAQLNSL VR E++RD L    N G +N++      V+EQ YI+DLV+EFQD
Sbjct: 61  FLEQYNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSVDEQKYIQDLVHEFQD 120

Query: 97  ITVKLNELAQNQK-EQVTPSSKHSNGSVNSFQPRPLKITERYRTDIGATRQSPTRINGKL 155
           IT KL+EL+  +     +  S  +  S+ SF+P+PL+I  R  T     +Q+        
Sbjct: 121 ITQKLSELSTVRNPSTASSRSTSTKSSIESFKPKPLRIISRSNTHSHLHQQTSLD----- 175

Query: 156 KNVNFVE-ESLPELFCPSKCTSLPGSPLKMRSXXXXXXXXXXVAKSYDTGLNPNSRAKLK 214
           K V+F E ES   +       SL  +   +R+            KS D       R+  K
Sbjct: 176 KKVSFNEDESNSSISHSRSMESLHENSKSLRN-----------TKSMDVL----KRSTFK 220

Query: 215 KQKEEEMLSVFKENQRLSIT-FCDDIDEGSD--------SASDQNTVXXXXXXXXXXXXQ 265
              +   L      QRLSI  F DD+    D        S SDQ TV             
Sbjct: 221 NHSDFSKL--LNSRQRLSINIFDDDLIANEDGNEFYNQYSDSDQATVISHGTPIRG---- 274

Query: 266 YDVQSEKPPLRRYNSHDSVLSTKVQPISSAKCPTFLTIPTANRPSMKSVTVSSAPIISST 325
               ++ P LRRYNSH+S+LS + +P  S +    L   +  +PSM+SV V+S PI S  
Sbjct: 275 ----ADTPLLRRYNSHESILSFR-KPTQSRQPNQILPYSSVRQPSMQSVAVNSNPIFSRM 329

Query: 326 GGKASSKDLLSSFISNTQ 343
              A+SKDLLSSFI+  Q
Sbjct: 330 RPNATSKDLLSSFINKPQ 347

>CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar to
           uniprot|P25591 Saccharomyces cerevisiae YCL063w
          Length = 430

 Score =  127 bits (319), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 117/384 (30%), Positives = 193/384 (50%), Gaps = 58/384 (15%)

Query: 1   MPSLDDISERLFIRSQEAVLQLELWI---RRQQHLSEIEHE-HARDKIADQYNLYMAQLN 56
           M SL++I+ERL  RS EA+ QL+ WI    + +H+SE +    + +++ D+Y  ++ +LN
Sbjct: 1   MASLEEITERLLERSNEAIEQLDEWILLQNKNRHISENKSGLDSIERLDDKYTEFLEKLN 60

Query: 57  SLCVRSEYVRDKL----NAGYQNRKPPIVNEQNYIEDLVYEFQDITVKLNELAQNQKE-- 110
           SL +RS+Y++DK+    NA    RK  +    + I++L+ EF++IT+ LNE+AQ   E  
Sbjct: 61  SLYIRSQYIKDKIRTEKNAKATKRKSEL--NTSRIQELMLEFKEITLSLNEIAQQDDETN 118

Query: 111 --QVTPSSKHSNGSVNSFQPRPLKITERYRTDIGATRQSPTRINGKLKNVNFVEESLPEL 168
             Q++P+S  +  S+ SF P+PLKI  R      +  +SP     K +N++F    + E 
Sbjct: 119 SKQLSPASTSTKSSLESFTPKPLKILNR-----ASMIRSPINSPPKKRNISFC--PIHEN 171

Query: 169 FCPSKCTSLPGSPLKMRSXXXXXXXXXXVAKSYDTGLNPNSRAKLKKQKEEEMLSVFKEN 228
              ++  SLP SP +  +           A+S+ TGL      K +K  + ++   FK+ 
Sbjct: 172 LSVTEYESLPSSPNR-SNLLEEQEQVLHPARSFQTGLRT---EKARKPDKNQLDKYFKDK 227

Query: 229 QRLSITFCD--DIDEG----SDSASDQNTVXXXXXXXXXXXXQYDVQSEKPPLRRYNSHD 282
           QRLS+T     D D+G    ++  SD+ TV               +  +  P+RR NSH+
Sbjct: 228 QRLSLTLFGSADADDGESLNNNDYSDEETVIFTSSSNIETDA---ITDDMKPIRRCNSHE 284

Query: 283 SVLST--KVQPISSAKC-------PTFLTIPTANR-----PSMKSVTVSSAPIISSTG-- 326
           SVLS   K  P ++          P    + T+N      PS++++ VS    +S     
Sbjct: 285 SVLSVHNKFVPKNNNNLQFQNRLEPFGRYLATSNNRNFTIPSIQNIQVSGTSTLSRFSRE 344

Query: 327 --------GKASSKDLLSSFISNT 342
                   G  +SKDLL+S ++ T
Sbjct: 345 QDREMTQLGSKTSKDLLTSVMTAT 368

>TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {ON}
           Anc_1.4 YCL063W
          Length = 540

 Score =  122 bits (306), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 125/431 (29%), Positives = 196/431 (45%), Gaps = 111/431 (25%)

Query: 4   LDDISERLFIRSQEAVLQLELWIRRQQHLSEIEHEH-----------------ARDKIAD 46
           L+++SE+L IRSQEA+LQL+LWI RQQ   +  ++H                 A + +  
Sbjct: 8   LEELSEKLLIRSQEAILQLDLWILRQQ---QQHNDHRFGTATDTGNKTKDSNEALNALRS 64

Query: 47  QYNLYMAQLNSLCVRSEYVRDKLNAGYQNRKPPIVNEQNYIEDLVYEFQDITVKLNELAQ 106
            Y+LYM+QLNSL VRSE++RDKLN+   N     ++ +N IE+LV+EFQ+I  KLN+LA 
Sbjct: 65  TYDLYMSQLNSLYVRSEFIRDKLNSEKNNVNKFNLDHRN-IEELVFEFQNIREKLNQLAA 123

Query: 107 NQK--EQVTPSSKHSNGSVNSFQPRPLKITERYRTDIGATRQSPTRINGKLKNVNFVEES 164
           + K  +   P +   + S+ S   +PLK+  ++   +    +    +  K K+V F +E+
Sbjct: 124 SSKLDKHSPPKTSTRSSSMESMNLKPLKVVAKHEKRMSKELE----LKNKEKSVTFGKET 179

Query: 165 LPELFCPSKCTSLPGSPLKMRSXXXXX-------XXXXXVAKSYDTGLNPNSRA------ 211
              L      T+  G  L ++                   A SYDTGLN  S++      
Sbjct: 180 RISL-----TTNGIGGKLMIKDDSDASPQLIDKKYKVLRNAISYDTGLNSKSKSNKRSNR 234

Query: 212 KLKKQKEEEMLSVFKENQRLSITFCDD-IDEGSDS--------------------ASDQN 250
           + +K+ +    S+FK  QR SI+  +D +D  +++                     SDQ 
Sbjct: 235 EYRKKNDAAYDSLFKNKQRFSISLFEDYVDTTTNTNYNEFNPTVDASINTELIENNSDQE 294

Query: 251 TVXXXXX-----------XXXXXXXQYDV-------QSEKPPLRRYNSHDSVLSTKVQ-- 290
           TV                       Q D        + +K  LRR NSH+S+LSTK++  
Sbjct: 295 TVISSSHLPCITNEPLDDYILSNSIQLDKNNNSGNNEGKKSHLRRCNSHESILSTKLENT 354

Query: 291 ---PISSAKCPTFLTIPTANRPSMKSVTVSSA--------------------PIISSTGG 327
               + S     F+   +  RP++ SV+ +S                     P+ SST G
Sbjct: 355 FYKNVGSNFYDRFI-FSSFYRPTVASVSTTSTNIEPFLSDGKNESPNKNLQLPLTSSTRG 413

Query: 328 KASSKDLLSSF 338
             +S++LLS F
Sbjct: 414 -VTSRELLSKF 423

>KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 460

 Score =  117 bits (292), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 112/369 (30%), Positives = 186/369 (50%), Gaps = 44/369 (11%)

Query: 1   MPSLDDISERLFIRSQEAVLQLELWIRRQQHLSEIEHEHARDKIADQYNLYMAQLNSLCV 60
           M  +  ++ERL IR  EAV+QLEL I+R+    +  + H   ++ + Y+ ++A+L+SL +
Sbjct: 1   MEDMRYVAERLVIRCNEAVMQLELSIQRKMCEFDPNNSHCFIQVQEYYS-FLARLSSLKL 59

Query: 61  RSEYVRDKLNAGYQNRKPP--IVNEQNYIEDLVYEFQDITVKLNELAQNQKEQVTPSSKH 118
           R+E+V++ L      RK P  +  E   +E L+YEFQDIT+ LNE+A+   +  T S++ 
Sbjct: 60  RAEHVQESLR---HQRKDPNDVCIEYETLEKLIYEFQDITMSLNEVAR-AYQSPTKSARS 115

Query: 119 SNGSVNSFQP-RPLKITERYRTDIGAT---RQSPTRI-----NGKL---KNVNFVEESLP 166
            +   +S  P + LKI ER R  +  T   ++S +++     N  L   +NV F E+ L 
Sbjct: 116 GSSKESSVIPLKTLKIIERNRDSLIGTSPMKKSLSQLKKEEHNQSLPAKRNVRFQEDDLD 175

Query: 167 ---ELFCPSKCTSLPGSP----LKMRSXXXXXXXXXXVAKSYDTGLNPNSRAKLKKQKEE 219
               L    +  SLPGSP    L              +AKSYD GLN     + KK  + 
Sbjct: 176 ILHHLHSVKRANSLPGSPMPDTLLESQMFSREHKTLRMAKSYDVGLN----GRAKKNADW 231

Query: 220 EMLSVFKENQRLSITFCDDIDEGSDSASDQNTVXXXXXXXXXXXXQYDVQSEKPPLRRYN 279
           E    FK   RLS++  DD++  +D++ ++  +            Q + Q     +RR N
Sbjct: 232 EF---FKNKNRLSLSVFDDVN--TDASDEETVISVSPPNISYYLSQNEDQYPSKQVRRCN 286

Query: 280 SHDSVLSTKV----QPISSAKCPTFLTI----PTANRPSMKSVTVSSAPIISSTGGKASS 331
           SH+S+LS K+     P +    PT+ ++        +P++ S + S++    + G    S
Sbjct: 287 SHESILSRKILSPSTPANLIMRPTYQSVWQKKAIVTKPTI-SCSTSNSTASPTIGSPHLS 345

Query: 332 KDLLSSFIS 340
           KD+LS F++
Sbjct: 346 KDMLSQFVT 354

>TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa]
           {ON} Anc_1.4 YCL063W
          Length = 513

 Score =  107 bits (266), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 98/335 (29%), Positives = 153/335 (45%), Gaps = 52/335 (15%)

Query: 5   DDISERLFIRSQEAVLQLELWIRRQQHL----------SEIEHEHARDKIADQYNLYMAQ 54
           +++S RL  ++QEAVLQL+LWI+ QQ            SE   +  RD     YN YM Q
Sbjct: 5   EEVSIRLLTKAQEAVLQLDLWIKDQQGFQNRDGLRASTSESLEQAERD-----YNRYMFQ 59

Query: 55  LNSLCVRSEYVRDKL------NAGYQNRKPPIVNEQNYIEDLVYEFQDITVKLNELAQNQ 108
           LNSL +R++Y+RDK+      N    +      N   Y++ LV EF  +++K+NEL+  Q
Sbjct: 60  LNSLYLRAQYIRDKIEKQNAYNLADSDVAGNDTNSHAYVQQLVTEFYSLSIKMNELSAIQ 119

Query: 109 KEQVTPS------SKHSNGSV----NSFQPRPLKITERYRTDIGATRQSPTRINGKLKNV 158
           +     S      S HSN S+    + FQPRPLKI +R + +          +   LK  
Sbjct: 120 ENVTNGSSPLSNKSSHSNDSLSKITDGFQPRPLKILQRQKHNNNQNTHPQPDLESPLKLK 179

Query: 159 NFVEESLPELFCPSKCTSLPGSPL---KMRSXXXXXXXXXXVAKSYDTGLNPNSRAKLKK 215
           +    S  +L   +K  S P       K ++            +S++      +  + K 
Sbjct: 180 H--RSSYNKLLSSNKKESKPYKNFNSKKSKNNELLSDISPVKIQSFEEPTFSVANTRNKN 237

Query: 216 QKEEEMLSVFKENQRLSITFCDDIDEGSD-----SASDQNTVXXXXXXXXXXXXQYDVQS 270
             +    S+FK N RLSI F D  D   +       SDQ+T+               +++
Sbjct: 238 SMDPLHYSLFKTNNRLSIQFPDGYDNDDEYDDPTCISDQDTIFVSTPKIASS-----IKN 292

Query: 271 EKPPLRRYNSHDSVLSTK------VQPISSAKCPT 299
              PLR++NSH+S+LS +      +QP+ + K P+
Sbjct: 293 TSEPLRKFNSHESILSVEKSNMKFIQPLPALKPPS 327

>KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4
           YCL063W
          Length = 399

 Score =  102 bits (254), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 129/468 (27%), Positives = 213/468 (45%), Gaps = 89/468 (19%)

Query: 1   MPSLDDISERLFIRSQEAVLQLELWIRRQQHLSEIEHEHARDKIADQYNLYMAQLNSLCV 60
           M SL  +S+ L  RS+EAV QLE W+++Q+ L +   E+              QLNSLC 
Sbjct: 1   MASL--VSDTLLQRSEEAVSQLESWLKQQEQLHQTTAEY-------------KQLNSLCA 45

Query: 61  RSEYVRDKLNAGYQNRKPPIVNEQN----YIEDLVYEFQDITVKLNELAQNQKEQVTPSS 116
           +S+Y+ + L     +  P  + EQ      +E L++EF +I+ KLNE+  +   Q T   
Sbjct: 46  KSKYISNLLKDD-SSSIPHDLMEQKERSFIVESLIHEFNEISTKLNEIVTHTSPQST--- 101

Query: 117 KHSNGSVNSFQPRPLKITERYRTDIGATRQSPTRINGKLKNVNFVEESLPELFCPSKCTS 176
                 ++SF+P+PL +  + +     TR SP    G+L+    +  +L  +   +KC S
Sbjct: 102 ------IDSFEPKPLNLLRKNKILESPTRSSPV-TRGRLERK--ISINLFPMHTTTKCNS 152

Query: 177 LPGSPLKMRSXXXXXXXXXXVAKSYDTGLNPNSRAKLKKQKEEEMLSVFKENQRLSITFC 236
           +P SP K +S            KSY  GLN             + ++ FKEN RLSI+F 
Sbjct: 153 VPTSP-KCKSTSTLNQRTLRNIKSYHYGLNG------------DYINPFKENNRLSISFF 199

Query: 237 DDIDEGSDSASDQNTVXXXXXXXXXXXXQYD--VQSEKPPLRRYNSHDSVLSTK--VQPI 292
           +    G ++ +D N+                  + + K  L+R NS DSV   +  ++  
Sbjct: 200 N----GDNTFNDNNSDSESDIDDDDTVLVTSPFLTNPKQKLKRSNSQDSVFWNENYLRKP 255

Query: 293 SSAK----CPTFLTIPTANRPSMKSVTVSSAPIISSTGGK--ASSKDLLSSFISNTQDYD 346
           S  K     P+ LT PTA         +SS  +     G+  +SSK LL+SF+ +     
Sbjct: 256 SFQKQLNLFPSTLTKPTAE--------LSSTQVFLKNTGRLGSSSKALLTSFVKDNLQQQ 307

Query: 347 KKAXXXXXXXXXXXXXLIWNLFKQKSQKNRNPTPLRVPQQDVTSERK---ENQLLTTSHP 403
           ++               I+N    +  K++         Q + +ER+   +N ++ +   
Sbjct: 308 QRTHNASSFNN------IFNSVTSEIGKSK-----LDKSQIIHTERRVLSDNSIVIS--- 353

Query: 404 SGVYSSCSRLLVKNQNSSI--ISPTRQRITNGNTMYDELQEALDTELV 449
           + + S  SR    N+ SS+  ISPT++ I N +  Y +L +AL+TE +
Sbjct: 354 TLITSKKSRF---NRFSSVDNISPTKKPIINNDVQYSDLNDALNTEFL 398

>Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W -
           Hypothetical ORF [contig 123] FULL
          Length = 449

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 79/263 (30%), Positives = 125/263 (47%), Gaps = 40/263 (15%)

Query: 1   MPSLDDISERLFIRSQEAVLQLELWIRRQQHLSEIEH------EHARDKIADQYNLYMAQ 54
           M  L  I++    RS+EA+++LE  + +Q+ L E E       E +   I  QY  Y+ Q
Sbjct: 1   MEQLAKIAQCALERSEEALVRLEKCVGKQRRLYESERSDQCLSEESSSTIV-QYYSYLGQ 59

Query: 55  LNSLCVRSEYVRDKLNAGYQNRKPPIVNE-QNYIEDLVYEFQDITVKLNELAQNQKEQVT 113
           LN L ++++ ++D +     NR   + N  Q  IE L ++++ +    NEL   +K    
Sbjct: 60  LNCLYIKAQSLKDMMG----NRCGHLPNSTQEAIERLEHDYKALCNHANELGIREKNLED 115

Query: 114 PSSKHSNGSVNSFQPRPLKITERYRTDIGATRQSPTRI------------NGKLKNVNFV 161
             S  S  SV+SFQP+PLKI ER    +  T  SPT++            +G  KN +++
Sbjct: 116 SPSCLSPASVSSFQPKPLKIIERR---LAQTNTSPTKVCTATVMAKSFCRSGTDKNSDYI 172

Query: 162 EESLPELFCPSKCTSLPGSPLKMRSXXXXXXXXXXVAKSYDTGLNPNSRAKLKKQKEEEM 221
            + + +    + C +   SP    +          V KS  TGLN +S         E  
Sbjct: 173 PDEIGKT---NSCNT--NSPCT--NEAKKEPKFIRVVKSCGTGLNKHS------NPHENR 219

Query: 222 LSVFKENQRLSITFCDDIDEGSD 244
           LS F++ QRLSI+F +D +  SD
Sbjct: 220 LSFFRDRQRLSISFIEDDEYLSD 242

>KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 451

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 75/261 (28%), Positives = 121/261 (46%), Gaps = 29/261 (11%)

Query: 1   MPSLDDISERLFIRSQEAVLQLELWIRRQQHLSE--IEHEHARDKIAD---QYNLYMAQL 55
           M  L +I++     SQ A+ +L+  + RQ+ L E     +   DK +    QY  Y+ QL
Sbjct: 1   MEQLQEIAQESLALSQSALARLDSCLERQRRLYESGFPDQCLSDKSSTNMAQYYEYIGQL 60

Query: 56  NSLCVRSEYVRDKLNAGYQNRKPPIVNEQNYIEDLVYEFQDITVKLNELAQNQKEQVTPS 115
            SL  +++ + D +     + K     +Q  IE+L+ EFQ       E+A+N +  ++ S
Sbjct: 61  YSLYTKAQKLSDTVI--LSDSKSLSSVQQRAIENLIQEFQ-------EIAKNDENFISYS 111

Query: 116 SKHSNGSVN-----SFQPRPLKITERYRTDIGATRQSPTRINGKLKNVNFVEESLPELFC 170
            + S  S++     SFQP+PLKI +R +  + +  +   R +  L +    E +L     
Sbjct: 112 MRESPNSMSVQSICSFQPKPLKILQRRQAQLESPTKRSFRPSMSLLDNRGDETNLATASD 171

Query: 171 PSKCTSLPGSPLKMR----SXXXXXXXXXXVAKSYDTGLNPNSRAKLKKQKEEEMLSVFK 226
            S+   L  SP  +     S           AKS D GLN  S         E  L+ FK
Sbjct: 172 RSQERLLGSSPSSIHFFRPSHTNADTLFIRSAKSCDAGLNRRSNP------HENRLNFFK 225

Query: 227 ENQRLSITFCDDIDEGSDSAS 247
           + QRLSI+F +D ++ SD A+
Sbjct: 226 DRQRLSISFIEDEEDVSDEAT 246

>KNAG0E04180 Chr5 complement(833612..836071) [2460 bp, 819 aa] {ON} 
          Length = 819

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 48/103 (46%), Gaps = 8/103 (7%)

Query: 31  HLSEIEHEHARDKIADQYNLYMAQLNSLCVRSEYVRDKLNAGYQNRKPPIVNEQNYIEDL 90
           H+  I H     K++D+Y LY        VR+E + ++    Y  +K   VN   YI D+
Sbjct: 374 HIPPILHCATGSKLSDRYILYFGGFE---VRTEAMLNQATGKYHLKKKAFVNNVGYILDV 430

Query: 91  V-YEFQDITVKLNELAQNQK-EQVT---PSSKHSNGSVNSFQP 128
           + Y+F  + + L   A N   E++T   P   H+  S++   P
Sbjct: 431 MTYKFSKMELLLEPNASNGSLEKLTNFPPRFGHAQMSLDESAP 473

>Kpol_1020.24 s1020 complement(54942..55604) [663 bp, 220 aa] {OFF}
           complement(54942..55604) [663 nt, 221 aa]
          Length = 220

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 44/95 (46%), Gaps = 10/95 (10%)

Query: 87  IEDLVYEFQDITVKLNELAQNQKEQVTPSSKHSNGSVNSFQPRPLKITERYRTDIGATRQ 146
           IED VY  +DITV L+++    K +   S+ + N   N F+         Y  DIG    
Sbjct: 93  IEDKVYFGKDITV-LSKVTDYPKNKFIKSNSYGNFLSNEFE---------YINDIGVYHD 142

Query: 147 SPTRINGKLKNVNFVEESLPELFCPSKCTSLPGSP 181
               + GK K  + V+ES+ ++F   K T    SP
Sbjct: 143 DELSVLGKKKGKDEVQESVVDIFERLKRTREYHSP 177

>CAGL0I06446g Chr9 complement(622713..624290) [1578 bp, 525 aa] {ON}
           weakly similar to uniprot|Q12346 Saccharomyces
           cerevisiae YPR171w
          Length = 525

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 49/112 (43%), Gaps = 17/112 (15%)

Query: 3   SLDDISERLFIRSQE--AVLQLELWIRRQQHLSEIEHEH---ARDKIADQYNLYMAQLNS 57
            LD   +R F+ S+E   +LQ     ++QQHLSE  H H    R  I D+++  +     
Sbjct: 71  GLDKEDDRKFLVSEEDYKLLQKIKMEQQQQHLSERHHRHIEPVRHIIPDRHSKPIFHNEP 130

Query: 58  LCVRSEYVRDKLNAGYQNR------------KPPIVNEQNYIEDLVYEFQDI 97
           + VR E   +      +NR             PP++  + Y +D+  +  D+
Sbjct: 131 VIVREESEDEAPPLPSRNRASSENVVKSTTSAPPLLPRRRYKDDITAKKLDV 182

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.127    0.352 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,185,732
Number of extensions: 1883384
Number of successful extensions: 6622
Number of sequences better than 10.0: 48
Number of HSP's gapped: 6782
Number of HSP's successfully gapped: 50
Length of query: 450
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 337
Effective length of database: 40,524,141
Effective search space: 13656635517
Effective search space used: 13656635517
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)