Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F18480g1.5ON96096038560.0
KAFR0D001401.5ON10414405822e-61
Smik_3.141.5ON11133855673e-59
Skud_3.31.5ON11523885664e-59
Suva_3.1521.5ON11403895655e-59
TDEL0C069701.5ON9413545492e-57
YCL061C (MRC1)1.5ON10963905433e-56
NCAS0B091101.5ON10204715343e-55
TPHA0E040101.5ON9654515243e-54
NDAI0A001401.5ON10914655165e-53
Kpol_2002.81.5ON9854255121e-52
SAKL0C00462g1.5ON11773775122e-52
CAGL0B00330g1.5ON11363544971e-50
KLLA0C00484g1.5ON9253434843e-49
KNAG0C002201.5ON11614004821e-48
AFR745W1.5ON10183223962e-38
Ecym_10081.5ON11183443651e-34
TBLA0A075701.5ON12522503562e-33
KLTH0F00484g1.5ON9934853435e-32
Kwal_33.130051.5ON9703502845e-25
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F18480g
         (960 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weak...  1489   0.0  
KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON...   228   2e-61
Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON} ...   223   3e-59
Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YC...   222   4e-59
Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {O...   222   5e-59
TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1...   216   2e-57
YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}  M...   213   3e-56
NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_...   210   3e-55
TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5...   206   3e-54
NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}...   203   5e-53
Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON...   201   1e-52
SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {O...   201   2e-52
CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {O...   196   1e-50
KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON...   191   3e-49
KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON...   190   1e-48
AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic...   157   2e-38
Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON} ...   145   1e-34
TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_...   141   2e-33
KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON...   136   5e-32
Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON...   114   5e-25

>ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weakly
           similar to uniprot|P25588 Saccharomyces cerevisiae
           YCL061C MRC1 S-phase checkpoint protein found at
           replication forks required for DNA replication also
           required for Rad53p activation during DNA replication
           stress where it forms a replication-pausing complex with
           Tof1p and is phosphorylated by Mec1p protein involved in
           replication checkpoint
          Length = 960

 Score = 1489 bits (3856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 774/960 (80%), Positives = 774/960 (80%)

Query: 1   MDSLLEKLDPLSSKRRTTYKKVFEPQEEEETQQISNSPPPPILGNGFLFQNSTIDKVRNR 60
           MDSLLEKLDPLSSKRRTTYKKVFEPQEEEETQQISNSPPPPILGNGFLFQNSTIDKVRNR
Sbjct: 1   MDSLLEKLDPLSSKRRTTYKKVFEPQEEEETQQISNSPPPPILGNGFLFQNSTIDKVRNR 60

Query: 61  LRNAEDGAXXXXXXXXXXXXXXXXXXXXXXXIADLYEGAEELEEQNKERVRLPLSKKTSS 120
           LRNAEDGA                       IADLYEGAEELEEQNKERVRLPLSKKTSS
Sbjct: 61  LRNAEDGANKVQQKEQEQEQEQETQLNQTQVIADLYEGAEELEEQNKERVRLPLSKKTSS 120

Query: 121 ASQEKTQVIPWAPTVEGVENNVEQGTDIHEEKTQQVPNEISYDQKTQAIQSFQQTEVEPL 180
           ASQEKTQVIPWAPTVEGVENNVEQGTDIHEEKTQQVPNEISYDQKTQAIQSFQQTEVEPL
Sbjct: 121 ASQEKTQVIPWAPTVEGVENNVEQGTDIHEEKTQQVPNEISYDQKTQAIQSFQQTEVEPL 180

Query: 181 TQRISEPERTLDVPTYAATSEDQLDTQEQNPITQLDISNSLLFQATDSDIPKSPPQRLKM 240
           TQRISEPERTLDVPTYAATSEDQLDTQEQNPITQLDISNSLLFQATDSDIPKSPPQRLKM
Sbjct: 181 TQRISEPERTLDVPTYAATSEDQLDTQEQNPITQLDISNSLLFQATDSDIPKSPPQRLKM 240

Query: 241 HDIEKELEEKRQERDHRRNIEYRAPEKPVNVKRVFSKEAFLKNFXXXXXXXXXXXXXXXX 300
           HDIEKELEEKRQERDHRRNIEYRAPEKPVNVKRVFSKEAFLKNF                
Sbjct: 241 HDIEKELEEKRQERDHRRNIEYRAPEKPVNVKRVFSKEAFLKNFDEESSSEDELIELRSR 300

Query: 301 DIEKKHTEKDKSTLENTTESSQRQRVFSVYEYKLKGELDSKRCIQLXXXXXXXXXXXXXP 360
           DIEKKHTEKDKSTLENTTESSQRQRVFSVYEYKLKGELDSKRCIQL             P
Sbjct: 301 DIEKKHTEKDKSTLENTTESSQRQRVFSVYEYKLKGELDSKRCIQLDDDEDESDEDVEVP 360

Query: 361 LSRVSKATVLDIKARRSKQEPLSKIKQKKTTLNDLICTLKKASKKQITDHQNELMKSRGY 420
           LSRVSKATVLDIKARRSKQEPLSKIKQKKTTLNDLICTLKKASKKQITDHQNELMKSRGY
Sbjct: 361 LSRVSKATVLDIKARRSKQEPLSKIKQKKTTLNDLICTLKKASKKQITDHQNELMKSRGY 420

Query: 421 KLEDIEKQKEEIENLLEQEIARNKRLAXXXXXXXXXXXXXXXXYGSGNESENSAXXXXXX 480
           KLEDIEKQKEEIENLLEQEIARNKRLA                YGSGNESENSA      
Sbjct: 421 KLEDIEKQKEEIENLLEQEIARNKRLARRENEEDNSNDLEDRSYGSGNESENSAFSDIEF 480

Query: 481 XXXXXXXXXXXXXXXXXXXRVQKEKMQEAGDSDNISARXXXXXXXXXXXIQKGRTKNHKM 540
                              RVQKEKMQEAGDSDNISAR           IQKGRTKNHKM
Sbjct: 481 SGDSESDDGQEDDMNNDDERVQKEKMQEAGDSDNISAREDHSDEEDEDSIQKGRTKNHKM 540

Query: 541 LPAEDSDSEHDDTLPRNIIDLGPYGNNLQVNHEEDMENLPLXXXXXXXXXXXXKTNELXX 600
           LPAEDSDSEHDDTLPRNIIDLGPYGNNLQVNHEEDMENLPL            KTNEL  
Sbjct: 541 LPAEDSDSEHDDTLPRNIIDLGPYGNNLQVNHEEDMENLPLSDSAEIDAAEEEKTNELIM 600

Query: 601 XXXXXXXXXXXXXXQRLKDMKAKGLNKMLXXXXXXXXXXWKGVGGVXXXXXXXXXXXXXX 660
                         QRLKDMKAKGLNKML          WKGVGGV              
Sbjct: 601 EKIRKIEMRKKKKEQRLKDMKAKGLNKMLEMEAEESEDEWKGVGGVDGDLSDEHDSDLEE 660

Query: 661 MIDDFTKSNENFDDVRQLLAKENKELDEKMVNKILYDIKNGGFRKRGRNAXXXXXXXXXX 720
           MIDDFTKSNENFDDVRQLLAKENKELDEKMVNKILYDIKNGGFRKRGRNA          
Sbjct: 661 MIDDFTKSNENFDDVRQLLAKENKELDEKMVNKILYDIKNGGFRKRGRNALDLELSDDED 720

Query: 721 XXXRNYRLKRRELMKKSRIEGKDKEKAFRNAKSKAFLESMVDDIDESKNPFGDPEMDVED 780
              RNYRLKRRELMKKSRIEGKDKEKAFRNAKSKAFLESMVDDIDESKNPFGDPEMDVED
Sbjct: 721 EDLRNYRLKRRELMKKSRIEGKDKEKAFRNAKSKAFLESMVDDIDESKNPFGDPEMDVED 780

Query: 781 NTDVDTQENDYPKNKEKNTLSQEFVQXXXXXXXXXXXXXXXXXGEQITLGDEEQDVSSLK 840
           NTDVDTQENDYPKNKEKNTLSQEFVQ                 GEQITLGDEEQDVSSLK
Sbjct: 781 NTDVDTQENDYPKNKEKNTLSQEFVQRSLSFLSNNNSSREFELGEQITLGDEEQDVSSLK 840

Query: 841 RNSSIHALHNSSSPIKEDLEKENQDEDFITLPNFKPPSLIKSLAGGFDPNNKFQSGKKTV 900
           RNSSIHALHNSSSPIKEDLEKENQDEDFITLPNFKPPSLIKSLAGGFDPNNKFQSGKKTV
Sbjct: 841 RNSSIHALHNSSSPIKEDLEKENQDEDFITLPNFKPPSLIKSLAGGFDPNNKFQSGKKTV 900

Query: 901 TVSKSYRAVGGSRSSITYFGKMRKLVGPKNRNSTLSKGPRPASKPTMGKLWESQQNSFDT 960
           TVSKSYRAVGGSRSSITYFGKMRKLVGPKNRNSTLSKGPRPASKPTMGKLWESQQNSFDT
Sbjct: 901 TVSKSYRAVGGSRSSITYFGKMRKLVGPKNRNSTLSKGPRPASKPTMGKLWESQQNSFDT 960

>KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1041

 Score =  228 bits (582), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 157/440 (35%), Positives = 222/440 (50%), Gaps = 29/440 (6%)

Query: 549  EHDDTL--PRNIIDLGPYGNNLQV------NHEEDMENLPLXXXXXXXXXXXXKTNE--- 597
            E DD+L   RN I+LGPYG+NL +        ++  +N  +               +   
Sbjct: 603  EKDDSLFQNRNAINLGPYGDNLSLAPIRITTEKQSGKNFKVSRESGDERDEEIPEKDRIR 662

Query: 598  LXXXXXXXXXXXXXXXXQRLKDMKAKGLNKMLXXXXXXXXXXWKGVGGVXXXXXXXXXXX 657
            L                ++ K+MKAKG+   L          W G+GG+           
Sbjct: 663  LIEEKKQHELERQRKQMKKRKEMKAKGITNFLEEEAEESEDEWHGIGGIDGEMSDEYDSE 722

Query: 658  XXXMIDDFTKSNENFDDVRQLLAKENKELDEKMVNKILYDIKNGGFRKRGRNAXXXXXXX 717
               MIDD++K+N N D++RQ+LA ENKE D KMV KILYDIKNGGFRKR + A       
Sbjct: 723  VEKMIDDYSKANFNPDEIRQMLADENKETDIKMVEKILYDIKNGGFRKRRKGAMDLELSD 782

Query: 718  XXXXXXRNYRLKRRELMKKSRIEGKDKEKAFRNAKSKAFLESMVDDIDESKNPFG--DPE 775
                  + YRLKRRELM++ R+E  + E   +N KSKAF ESMVDDI E KNPF   +P+
Sbjct: 783  EEDDELKQYRLKRRELMRQKRLEVGEAETLVKNPKSKAFFESMVDDIVEVKNPFAVFEPQ 842

Query: 776  MDVEDNTDVDTQENDYPKN-------KEKNTLSQEFVQXXXXXXXXXXXXXXXXXGEQIT 828
                  TD  TQEN             +K  LS+EFVQ                    + 
Sbjct: 843  RSGTITTDDGTQENANSNEGAASQNPSKKVMLSEEFVQRTLSFLNSSKDMDQFAPARSMR 902

Query: 829  L-GDEE--QDVSSLKRNSSIHALHNSSSPIKE---DLEKENQDEDFITLPNFK--PPSLI 880
               ++E  +D+++LK+ SSI +   + + + +   D +KEN D+ F  L N +    S++
Sbjct: 903  AEANDELIEDLTALKKQSSIKSFKTTRASVSQEPTDFDKEN-DDSFDDLLNSRVGTSSIM 961

Query: 881  KSLAGGFDPNNKFQSGKKTVTVSKSYRAVGGSRSSITYFGKMRKLVGPKNRNSTLSKGPR 940
            K+ +   D N+KFQ G KTV VSK+Y++V  S++SITY GKMRKLV P+ + + LS    
Sbjct: 962  KTFSATVDINDKFQEGVKTVKVSKAYKSVSSSKASITYMGKMRKLVAPQKKVANLSSSDI 1021

Query: 941  PASKPTMGKLWESQQNSFDT 960
              +     KL+  Q  SF++
Sbjct: 1022 KNTNSRTSKLFSRQDESFES 1041

 Score =  134 bits (338), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 163/543 (30%), Positives = 242/543 (44%), Gaps = 123/543 (22%)

Query: 1   MDSLLEKLDPLSSKRRTTYKKVFEPQEEEETQQISNSPPPPILGNGFLFQNSTIDKVRNR 60
           MD +   L  L  K+RTTYKK+ +  E + ++  SN+ PP + G GFLF N T+++++ R
Sbjct: 1   MDGIFGNLQALKPKKRTTYKKISDDLENDTSE--SNNDPPALTGEGFLFDNPTLNRIKKR 58

Query: 61  LRNAEDGAXXXXXXXXXXXXXXXXXXXXXXXIADLYEGAEEL--------EEQNKERVRL 112
           L   E                          I++LY G E+L        E+Q     +L
Sbjct: 59  LDGEEKDVVQYTMNFSQTQL-----------ISNLYGGGEDLDAPEVERREKQQLHEQQL 107

Query: 113 PLSKKTSSASQ-----------------EKTQVI----------PWAPTVEGVENNVEQG 145
            L+KK +S  Q                 + TQVI          P + T      +V Q 
Sbjct: 108 ELTKKRASKGQLHAFTKSSGNINDLRLMQPTQVIGSTQLAKEFSPVSRTYFKYVPDVNQS 167

Query: 146 TDIHEEKTQ---QVPNEISYDQK-----------TQAIQSFQQTE-VEPLTQRISEPERT 190
           T +    TQ   QV +    D +           TQ I + Q+T+ +   TQ IS    T
Sbjct: 168 TQVIHSATQDDTQVVSAREADTQATQMTQVLSASTQGIYNTQETQSITDSTQPISYSSST 227

Query: 191 LDVPT----YAATSED-QL------DTQEQNPI-----TQLDISNSL-----------LF 223
            D  T       T ED Q+      D     PI     TQ D S  L            +
Sbjct: 228 QDYKTNKFNRHPTPEDTQIIPREFDDDASTLPIPEGDKTQKDTSAVLKTQIDSTTEGTSY 287

Query: 224 QATDSDIPKSPPQRLKMHDIEKELEEKRQER---DHRRNIEYRAPEKPVNVKRVFSKEAF 280
            AT SD        LK+H+I++ELEE ++ +   ++++++  R P+  +    VF+KE++
Sbjct: 288 SATVSDT-------LKIHEIQRELEESQKTKTIPEYKQHV--RTPKNVI----VFTKESY 334

Query: 281 LKNFXXXXXXXXXXXX----XXXXDIEKKHTEKDKST----LENTTESSQ----RQRVFS 328
              F                     + K  +  DKS     L + T +S     +    +
Sbjct: 335 FDEFDSDDEEKEENLESEGDSQKVQLLKNTSPSDKSNDGKRLPDKTRTSPSFKPKLHGLN 394

Query: 329 VYEYKLKGELDSKRCIQLXXXXXXX----XXXXXXPLSRVSKATVLDIKARRSKQEPLSK 384
            YE KLK +L+S + I L                 P+S++SKATV DIKAR SK+ P+ K
Sbjct: 395 NYELKLKRQLNSDQQIDLNLDSDDEDGIDRMGEKGPISQMSKATVFDIKARLSKKRPIVK 454

Query: 385 IKQ-KKTTLNDLICTLKKASKKQITDHQNELMKSRGYKLEDIEKQKEEIENLLEQEIARN 443
           I    KTTL+ L   L+KAS++QI +HQ E+++ +G  LEDIEK+K+ +ENLLEQEI RN
Sbjct: 455 ISNDSKTTLHTLFNKLQKASRQQIIEHQKEVIEKKGLNLEDIEKEKKIVENLLEQEINRN 514

Query: 444 KRL 446
           K++
Sbjct: 515 KKI 517

>Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON}
            YCL061C (REAL)
          Length = 1113

 Score =  223 bits (567), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 151/385 (39%), Positives = 204/385 (52%), Gaps = 40/385 (10%)

Query: 616  RLKDMKAKGLNKMLXXXXXXXXXXWKGVGGVXXXXXXXXXXXXXXMIDDFTKSNENFDDV 675
            +LK++K KG+              W G+GG               MIDD++K+N N  ++
Sbjct: 729  KLKELKHKGVTNFFEMEAEESDDEWHGIGGADGEGSDEYDSDVEKMIDDYSKNNFNSHEI 788

Query: 676  RQLLAKENKELDEKMVNKILYDIKNGGFR-KRGRNAXXXXXXXXXXXXXRNYRLKRRELM 734
            R++LA ENKE+D KM+NKILYDIKNGGFR KR +N+             + YRLKRRELM
Sbjct: 789  REMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNSLELELSDDEDDVLQQYRLKRRELM 848

Query: 735  KKSRIEGKDKEKAFRNAKSKAFLESMVDDIDESKNPFGDPEMDVED----NTDVDTQEN- 789
            +K R+E  D  K  +N KSKAF ESMV+DI E KNPF   E   +D     TD+DT +N 
Sbjct: 849  RKRRLEIGDGTKLVKNPKSKAFFESMVEDIMEYKNPFRAEEESNQDITSTATDLDTLDNN 908

Query: 790  -----DYPKNKEKN---------TLSQEFVQXXXXXXXXXXXXXXXXXGEQITL---GDE 832
                 D  +N EK           +S++FVQ                  E   +    D+
Sbjct: 909  SLNVRDSTRNNEKGPVDDKSKKIIISEDFVQKSLSFLKSNNYNEFEMDKELAKMQHGNDD 968

Query: 833  E--QDVSSLKRNSSIHALHNSSS--------PIKEDLEKENQDEDFI------TLPNFKP 876
            E  +D+ +LK++SSI +  NS +            DLEK  +DED +       +  FK 
Sbjct: 969  EPIEDLFTLKQHSSIKSFTNSQTDSFTSRTVTTMIDLEKRTEDEDEMENGDSSLVSGFKH 1028

Query: 877  PSLIKSLAGGFDPNNKFQSGKKTVTVSKSYRAVGGSRSSITYFGKMRKLVGPKNRNSTLS 936
            PS++KS A   D N+KF+ G KTV +SKSY+ VG S++SITY GK RKL+ PK +  T  
Sbjct: 1029 PSIVKSFASRTDINDKFKEGNKTVKISKSYKMVGSSKASITYMGKTRKLMAPKRKAGTDQ 1088

Query: 937  KGPR-PASKPTMGKLWESQQNSFDT 960
               R   +K    KL+ES QNSFD+
Sbjct: 1089 NHHRHKKTKTKTSKLFESGQNSFDS 1113

 Score =  153 bits (387), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 165/551 (29%), Positives = 239/551 (43%), Gaps = 117/551 (21%)

Query: 1   MDSLLEKLDPLSSKRR-TTYKKV--FEPQEEEETQQ--ISNS--PPPPILGNGFLFQNST 53
           MD  L  L  L SK+R TTYKKV    P + + T     +N    PP + GNGFLF N+T
Sbjct: 1   MDDALNALSSLRSKKRVTTYKKVAIHIPDDNDNTDGNLYTNDIVAPPALTGNGFLFANAT 60

Query: 54  IDKVRNRLRNAEDGAXXXXXXXXXXXXXXXXXXXXXXXIADLYEGAEELEEQNKERVRLP 113
           +++V+NRL   +                          IA+LYEG E+LEE         
Sbjct: 61  LNRVKNRLEGGK-----APEQEHDNKDDEDEDVSSSQLIANLYEGGEDLEETKSNEN--D 113

Query: 114 LSKKTSSASQEKTQVIPWAPTVEGVENNVEQGTDIHEEKTQQVPNEISYDQKTQAIQSFQ 173
            + K    +  +TQ IP +   + V +       ++EEK  Q+  +  +  K    Q   
Sbjct: 114 CTGKNCMPTFTQTQRIPVSIQQDKVVDVPIHS--VNEEKPTQIIKDDCFVNKIPQAQKLS 171

Query: 174 QTEVEPL-TQRISE-----------PERTLDVPTYA--ATSEDQLDTQEQNPITQLDISN 219
            T ++P+ TQRI             P + ++ P+    ATS D LD Q   P   L I  
Sbjct: 172 TTTIKPVATQRIDSDDIITQSQQALPIKPIESPSQGKTATSND-LDVQSSKPPV-LTIGK 229

Query: 220 SLLF-------------------------------QATDSD-------IPKSP------- 234
           S LF                               Q T SD       IP++        
Sbjct: 230 SPLFQPLLTRGPVNQMDTPLESSPNNDETQLDVMPQNTQSDNKTQIDTIPQTTHYEDKTQ 289

Query: 235 ------------PQRLKMHDIEKELEEKRQERDHRRNIEYRAPEKPVNVKRVFSKEAFLK 282
                       P  LK+ +I+ EL  +   R+   N+EY  P+K +  K  FSKE+FL 
Sbjct: 290 MDTMSQTLQDGVPHTLKIREIQNELALEDSRRERASNVEYTKPQKTIATKLKFSKESFLA 349

Query: 283 NFXXXXXXXXXXXXXXXX------DIEKKHTEKD--KSTLENTTESSQRQRVFSVYEYKL 334
           +F                      + E+ H +K+   S  E T ++ +R  + S Y   L
Sbjct: 350 DFDDSSSNEDAEIKVESAHPKPLGNEEELHEDKNIEPSINEVTKKTDKRVPLLSSYANNL 409

Query: 335 KGELDSKRCIQLXXXXXXXXXXX-------------XXPLSRVSKATVLDIKARRSKQ-- 379
           K E+DS +CI L                          P+S++SKAT+L++KAR SKQ  
Sbjct: 410 KREIDSSKCITLDLDSGSDDDDNIVVDDRKLIKDEGALPISQLSKATILNLKARLSKQNQ 469

Query: 380 ----EPLSKIKQKKTTLNDLICTLKKASKKQITDHQNELMKSRGYKLEDIEKQKEEIENL 435
                PL   +  +   N L  TL+KAS+KQI DHQ E+++++G+KLED+ K+KE +ENL
Sbjct: 470 DISQRPLEG-RDARLDHNKLFNTLRKASRKQILDHQREVIETKGFKLEDMVKEKELVENL 528

Query: 436 LEQEIARNKRL 446
           LEQEI RNK++
Sbjct: 529 LEQEIIRNKKI 539

>Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YCL061C
            (REAL)
          Length = 1152

 Score =  222 bits (566), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 151/388 (38%), Positives = 207/388 (53%), Gaps = 47/388 (12%)

Query: 617  LKDMKAKGLNKMLXXXXXXXXXXWKGVGGVXXXXXXXXXXXXXXMIDDFTKSNENFDDVR 676
            LK+ K+KG+              W GVGG               MIDD++K++ N  ++R
Sbjct: 768  LKEFKSKGITNFFEMEAEESEDEWHGVGGADGEGSEEYDSEVEKMIDDYSKNSFNSHEIR 827

Query: 677  QLLAKENKELDEKMVNKILYDIKNGGFR-KRGRNAXXXXXXXXXXXXXRNYRLKRRELMK 735
            ++LA ENKE+D KM+N+ILYDIKNGGFR KR +N+             + YRLKRRELM+
Sbjct: 828  EMLAAENKEMDVKMINRILYDIKNGGFRNKRAKNSLELELSDDEDDVLQQYRLKRRELMR 887

Query: 736  KSRIEGKDKEKAFRNAKSKAFLESMVDDIDESKNPFGDPEMDVED----NTDVDTQEN-- 789
            K R+E  D  K  +N KSKAF ESMV+DI E KNPF   E   +D     TD+DTQ+N  
Sbjct: 888  KRRLEIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFKAEEESHQDLTSTATDLDTQDNDS 947

Query: 790  ----DYPKNKE---------KNTLSQEFVQXXXXXXXXXXXXXXXXXGE----QITLGDE 832
                D  +N E         K  +S++FVQ                  E    Q  +GDE
Sbjct: 948  IQIGDSTRNNEHRRVDDRSKKTIISEDFVQKSLSFLRSNNYDEFEMDKERARIQHDIGDE 1007

Query: 833  E-QDVSSLKRNSSIHALHNSSS----------------PIKEDLEKENQDEDFITLPNFK 875
              +D+ +LK++SSI +  NS +                P +++ E EN+D   I    FK
Sbjct: 1008 GVEDLFTLKQHSSIKSFTNSPTDSLSSKRVNSMIDLEQPTEDNNEVENEDPSLI--GGFK 1065

Query: 876  PPSLIKSLAGGFDPNNKFQSGKKTVTVSKSYRAVGGSRSSITYFGKMRKLVGPK---NRN 932
             PS+IKS A   D N+KF+ G KTV +SK+Y+ VG S++SITY GK RKL+ PK   +R+
Sbjct: 1066 HPSIIKSFASRTDINDKFKEGNKTVKISKTYKTVGSSKASITYMGKTRKLMAPKKKADRD 1125

Query: 933  STLSKGPRPASKPTMGKLWESQQNSFDT 960
               +   + A K    KL+ES Q+SFD+
Sbjct: 1126 HHHNHHSK-AWKTQKSKLFESGQDSFDS 1152

 Score =  153 bits (386), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 156/540 (28%), Positives = 243/540 (45%), Gaps = 108/540 (20%)

Query: 1   MDSLLEKLDPLSSKRR-TTYKKVFEP----QEEEETQQISNS--PPPPILGNGFLFQNST 53
           MD++LE L  L+SK+R TTYKK+  P     ++ +   +SN+   PP + GNGFLF N+T
Sbjct: 56  MDNVLEVLSSLTSKKRVTTYKKIASPIPDGDDDVDGDLLSNNMGAPPALTGNGFLFGNAT 115

Query: 54  IDKVRNRLRNAEDGAXXXXXXXXXXXXXXXXXXXXXXXIADLYEGAEELEEQNKERVRLP 113
           +++V+NRL   +                          IA+LY+G E+LEE         
Sbjct: 116 LNRVKNRLEGID-----VPEDDRQIKDNENEDAVSTQLIANLYDGGEDLEETKSMGDNAS 170

Query: 114 LSKKTSSASQEKTQVIPWAPTVEGVE----NNVEQGTDIHEEKTQQVPNEISYDQK---- 165
           L    ++ +Q  TQ IP +   E V     +++ QG      +     +  +  QK    
Sbjct: 171 LKDGIAAFTQ--TQRIPVSIQSENVVDVPIHSINQGKSARIIRDDGFFSTAAQTQKIIPA 228

Query: 166 --------TQAIQS---FQQTEVEPLTQRISEPERTLDVPTYAATSEDQLDTQEQNPITQ 214
                   TQ I S     QT+  P T+ I EP+  +       T+ +  DTQ    I  
Sbjct: 229 TARIIPVATQRIHSRDTASQTQQVPFTKPI-EPQTQI-----IGTTANDSDTQPLR-IPV 281

Query: 215 LDISNSLLFQATDSDIPK---SPPQR---------------------------------- 237
           L    SLLFQ T   +P     PP +                                  
Sbjct: 282 LTAEASLLFQTTPDCVPTIRMDPPSQIEHDKYKTQLDTMTQTAHDEGKTQVDTMPQTIHD 341

Query: 238 -----LKMHDIEKELEEKRQERDHRRNIEYRAPEKPVNVKRVFSKEAFLKNFXXXXXXXX 292
                LK+ +++ EL  +  +R+  RN+EY+   + +     FSKE+FL +F        
Sbjct: 342 DVSHTLKIRELQSELALEDSKREKARNVEYKKSRRNIPTMINFSKESFLADFDNSSSDEG 401

Query: 293 XXXXXXXXDIEKK------HTEK--DKSTLENTTESSQRQRVFSVYEYKLKGELDSKRCI 344
                    ++++      H  K  + ++++N+ ES +   + S Y   LK E+DS +CI
Sbjct: 402 TDVQLEKSQLKQQQDDNEVHENKPSEPNSVKNSRESYKNVPLLSSYANNLKREIDSSKCI 461

Query: 345 -------------QLXXXXXXXXXXXXXPLSRVSKATVLDIKARRSKQ-EPLSKI----K 386
                                       P+SR+SKA +L++KAR SKQ + L+++    K
Sbjct: 462 ILDLDSDSDDDGDDYMGGNMSIKDESALPISRLSKAAILNLKARLSKQSQNLTQMPNKNK 521

Query: 387 QKKTTLNDLICTLKKASKKQITDHQNELMKSRGYKLEDIEKQKEEIENLLEQEIARNKRL 446
             K   N L   L+KAS+KQI DHQ E+++++G+KLED+ K+KE +ENLLEQEI RN+R+
Sbjct: 522 GAKVDHNKLFNILRKASRKQILDHQREVIETKGFKLEDMAKEKEIVENLLEQEILRNRRI 581

>Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {ON}
            YCL061C (REAL)
          Length = 1140

 Score =  222 bits (565), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 154/389 (39%), Positives = 206/389 (52%), Gaps = 47/389 (12%)

Query: 616  RLKDMKAKGLNKMLXXXXXXXXXXWKGVGGVXXXXXXXXXXXXXXMIDDFTKSNENFDDV 675
            +LK++K+KG+              W GVGG               MIDD++K+  N  ++
Sbjct: 755  KLKELKSKGVTNFFEMEAEESEDEWHGVGGADGEGSDEYDSEVEKMIDDYSKNKFNSHEI 814

Query: 676  RQLLAKENKELDEKMVNKILYDIKNGGFR-KRGRNAXXXXXXXXXXXXXRNYRLKRRELM 734
            R++LA ENKE+D KM+NKILYDIKNGGFR KR +N+             + YRLKRRELM
Sbjct: 815  REMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNSLELELSDDEDDVLQQYRLKRRELM 874

Query: 735  KKSRIEGKDKEKAFRNAKSKAFLESMVDDIDESKNPFG---DPEMDVEDN-TDVDTQEND 790
            +K R+E  D  K  +N KSKAF ESMV+DI E KNPFG   + + DV    TD+DTQ+ND
Sbjct: 875  RKRRLEIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFGAEKESDQDVTSTATDLDTQDND 934

Query: 791  YPK------NKEKN----------TLSQEFVQXXXXXXXXXXXXXXXXXGE--QITLGDE 832
              K      N E N           +S++FVQ                  E  +I  G+ 
Sbjct: 935  NTKPGDNTSNNEHNKHVGDKSKKLIISEDFVQKSLSFLKSNNYDEFEMDRELARIQHGNG 994

Query: 833  EQDVS---SLKRNSSIHALHNSSS----------------PIKEDLEKENQDEDFITLPN 873
            E DV    +LK++SSI +  NS +                  + + E EN D+  I    
Sbjct: 995  EGDVVDLFTLKQHSSIKSFTNSQTNSLSSRTMNTVINLEEHTEGNDEGENGDQSLI--GG 1052

Query: 874  FKPPSLIKSLAGGFDPNNKFQSGKKTVTVSKSYRAVGGSRSSITYFGKMRKLVGPKNRNS 933
            FK PS+IKS A   D N+KF+ G KTV +SKSY+ VG S++SITY GK RKL+ PK R +
Sbjct: 1053 FKHPSVIKSFASRTDINDKFKEGNKTVKISKSYKTVGSSKASITYMGKTRKLMAPK-RKT 1111

Query: 934  TLSKGPRPA--SKPTMGKLWESQQNSFDT 960
              +  P     SK    KL+E+ Q+SFD+
Sbjct: 1112 EENHHPNHIKKSKTQKSKLFENGQDSFDS 1140

 Score =  164 bits (416), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 166/533 (31%), Positives = 242/533 (45%), Gaps = 117/533 (21%)

Query: 1   MDSLLEKLDPLSSKRR-TTYKKVFEPQEEEETQQISNSP------PPPILGNGFLFQNST 53
           MD  L  L  L+SK+R TTYKKV  P  +E      N P      PP + GNGFLF N+T
Sbjct: 44  MDDALNALSSLTSKKRATTYKKVASPILDENYDTDGNLPIDGMNAPPALTGNGFLFGNAT 103

Query: 54  IDKVRNRL--RN--AEDGAXXXXXXXXXXXXXXXXXXXXXXXIADLYEGAEELE-----E 104
           +++V+NRL  RN   +DG                        IA+LY+G EELE     +
Sbjct: 104 LNRVKNRLEGRNELGQDG---------QDKENEDEDVFSTQLIANLYDGGEELESKSNGD 154

Query: 105 QNKERVRLPLSKKTSSASQEKTQVIPWAPTVEGVENNV---------------EQGTDIH 149
           +N ++V +      SS +Q  TQ IP + T +  E NV                +G+ I 
Sbjct: 155 KNNQKVNV------SSFTQ--TQRIPVSITQQNNEINVPIHSINEGEPTQKAKNRGSVIT 206

Query: 150 EEKTQQVPNEISYDQKTQ-AIQSFQQTEVEPLTQRI-----SEPERTLDVPTYAATSEDQ 203
             +TQ +P   +  Q TQ   Q          TQ+I     SE +   DV    AT+ D 
Sbjct: 207 TSQTQAIP--FTTAQITQKTTQCLNNHGATSQTQQIPPTKPSEAQTQADV----ATANDS 260

Query: 204 LDTQEQNPITQLDISNSLLFQATDSDIP---------------------------KSPPQ 236
            DTQ++ P+  L    S LFQ      P                           K PP 
Sbjct: 261 -DTQQKVPM--LTTETSPLFQTVPDQSPSTQMNTPPPTVHDDRTQMDTVAQTMQDKVPP- 316

Query: 237 RLKMHDIEKELEEKRQERDHRRNIEYRAPEKPVNVKRVFSKEAFLKNFXXXXXXXXXXXX 296
            LK+H+++ EL  +   R   +N EYR  +K + + + FSKE+FL +F            
Sbjct: 317 TLKIHELQSELALEDFNRKKAQNTEYRKLQKTIPIVKRFSKESFLADFDNSSSDEDTNFK 376

Query: 297 XXXXDIEKKH--------TEKDKSTLENTTESSQRQRVFSVYEYKLKGELDSKRCIQL-- 346
                 +++         ++ +    E   +  ++  + S Y   LK E+DS +CI L  
Sbjct: 377 LESSQPKQQQNGYEMIDISQSNPQPAEKENKKDKKVPLLSTYANNLKREIDSSKCITLDL 436

Query: 347 -----------XXXXXXXXXXXXXPLSRVSKATVLDIKARRSKQ-----EPLSKIKQKKT 390
                                   P+S++SKAT+ ++KAR SKQ     +  +K K  K+
Sbjct: 437 DSGSDKDNDNHMDTDKLNEDESALPISQLSKATIFNLKARLSKQNQKLAQGSNKNKDFKS 496

Query: 391 TLNDLICTLKKASKKQITDHQNELMKSRGYKLEDIEKQKEEIENLLEQEIARN 443
             N LI TL+KAS+KQI DHQ E+++++G+KLED+ K+KE +E+LLEQEI RN
Sbjct: 497 DHNKLINTLRKASRKQILDHQREIVETKGFKLEDMVKEKEIVEDLLEQEILRN 549

>TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1.5
           YCL061C
          Length = 941

 Score =  216 bits (549), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 138/354 (38%), Positives = 194/354 (54%), Gaps = 19/354 (5%)

Query: 615 QRLKDMKAKGLNKMLXXXXXXXXXXWKGVGGVXXXXXXXXXXXXXXMIDDFTKSNENFDD 674
           QRLK MK  G+  M           W+GVGGV              MIDDF+ +  N D 
Sbjct: 597 QRLKQMKESGVTNMFDMEAEESDDEWRGVGGVDGETIDDYDSDLEKMIDDFSNTTSNADQ 656

Query: 675 VRQLLAKENKELDEKMVNKILYDIKNGGFRKRGRNAXXXXXXXXXXXXXRNYRLKRRELM 734
           +RQLL  ENKE D K VNKIL+DIKNGGFRKR +N               NY+ ++ ELM
Sbjct: 657 IRQLLMAENKETDLKTVNKILHDIKNGGFRKRRQNNLQLELSDDEDDELLNYKKRKLELM 716

Query: 735 KKSRIE-GKDKEKAFRNAKSKAFLESMVDDIDESKNPFGD----PEMDVEDNTDVDTQEN 789
           +K R++ G D +K  +N++SKAF ESMV+DI + K+PF +     E D +    VD    
Sbjct: 717 RKRRLQFGADDKKLLKNSRSKAFFESMVEDIIDLKDPFSNQAETSEKDKKSEGLVDAS-- 774

Query: 790 DYPKNKEKNTLSQEFVQXXXXXXXXXXXXXXXXXGEQITLGDEEQDVSSLKRNSSIHALH 849
               NK+K+T+S EFVQ                       G+   D++SLK++S++  L+
Sbjct: 775 ----NKQKDTISHEFVQQSLSFLSSSRDFSEFEVARVSQEGERNTDLNSLKQDSTVKTLY 830

Query: 850 NSSSPIKEDLEKENQDEDFITLP-NFKPPSLIKSLAGGFDPNNKFQSGKKTVTVSKSYRA 908
             S+ I E    ++++ D   LP      S++KS     + N+K + G+KTVTVSKSYR 
Sbjct: 831 APSNIISESERADHEEFDNSVLPVESSYSSVVKSFGFDLNANDKLKEGRKTVTVSKSYRT 890

Query: 909 VGGSRSSITYFGKMRKLVGPKNRNSTLSKGPRPASK-PTMG--KLWESQQNSFD 959
           VGG+++SITY GKMRKLV PK  N+ +    R  SK  T+G  K++ + ++SF+
Sbjct: 891 VGGNKASITYLGKMRKLVAPKKSNAEV----RTTSKLSTLGNSKIFRNFESSFE 940

 Score =  141 bits (355), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 141/475 (29%), Positives = 219/475 (46%), Gaps = 67/475 (14%)

Query: 1   MDSLLEKLDPLSSKRRTTYKKVFEPQEEEETQQISNSP--PPPILGNGFLFQNSTIDKVR 58
           MD L E  D    KRR TY+K  + +++E T+     P  PP +LGNGFLF +ST+DKV+
Sbjct: 1   MDKLFESFDNAIKKRRATYQKAVQNEDDEYTED----PLVPPAVLGNGFLFNSSTLDKVK 56

Query: 59  NRL-RNAEDGAXXXXXXXXXXXXXXXXXXXXXXXIADLYEGAEELEEQNKERVRLPLSKK 117
           NRL ++ E G                        +++LYE  E+LE            K+
Sbjct: 57  NRLNKDQEQGTQAIDTTQV---------------LSNLYEDGEDLE------------KE 89

Query: 118 TSSASQEKTQVIP--WAPTVEGV-------ENNVEQGTDIHEEKTQQVPNEISYDQ---- 164
             S  Q K++ IP    P++E         EN+   G  +   K+  +   +  +     
Sbjct: 90  VPSILQSKSKPIPTILIPSIEREILKQPFNENHNFTGVTVPIAKSSAITKNLDREDLESP 149

Query: 165 ---KTQAIQSFQQTEVEPLTQRISEPERTL----DVPTYAATSEDQLDTQEQNPITQLDI 217
              +TQ I  F  ++V   TQ +     T      V T A   E+ L   E +  T  D 
Sbjct: 150 EIPETQPIPDFSASDVPTQTQVLKTTSETAADTGTVATAAIAYEESLTQVEVSEQTYPDQ 209

Query: 218 SNSL--LFQATDSDIPKSPPQRLKMHDIEKELEEKRQERDHRRNIEYRAPEKPVNVKRVF 275
            NS   + Q T +D    P  RLK+H+IE+    + Q       ++YRAP +P+   +VF
Sbjct: 210 RNSQEDIIQQTAAD--AVPITRLKIHEIEEMWSREVQTETKEHKVKYRAP-RPL---KVF 263

Query: 276 SKEAFLKNFXXXXXXXXXXXXXXXXDIEKKHTEKDKSTLENTTE----SSQRQRVFSVYE 331
           +KEAF+++F                         D  +   T++      +     + Y+
Sbjct: 264 TKEAFMQDFDKSSDSDSDVFDQEIKATSPIGRNNDSISEVGTSDVKVLKDKSSGALTAYQ 323

Query: 332 YKLKGELDSKRCIQLXXXXXXXXXXXXXPLSRVSKATVLDIKARRSKQEPLSKIKQKKTT 391
            +LK + +  + + L               S  +KATVL +KAR SK+ P  + +  K +
Sbjct: 324 RELKEKAEIAKGVMLLSESDDEEDLAVST-SHEAKATVLKLKARLSKRRPPVESQHGKAS 382

Query: 392 LNDLICTLKKASKKQITDHQNELMKSRGYKLEDIEKQKEEIENLLEQEIARNKRL 446
           L+ L+  L+ ++K+QI D Q E ++ +G K ED+EK+KE +ENLLEQEIARNKR+
Sbjct: 383 LSALMKNLRNSTKRQILDRQKEGIERQGLKFEDVEKEKEIVENLLEQEIARNKRI 437

>YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}
            MRC1S-phase checkpoint protein required for DNA
            replication; interacts with and stabilizes Pol2p at
            stalled replication forks during stress, where it forms a
            pausing complex with Tof1p and is phosphorylated by
            Mec1p; protects uncapped telomeres
          Length = 1096

 Score =  213 bits (543), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 150/390 (38%), Positives = 207/390 (53%), Gaps = 46/390 (11%)

Query: 616  RLKDMKAKGLNKMLXXXXXXXXXXWKGVGGVXXXXXXXXXXXXXXMIDDFTKSNENFDDV 675
            ++K++K +G+              W G+GG               MIDD++K+N N  ++
Sbjct: 706  KIKELKKRGVTNFFEMEAEESEDEWHGIGGADGEGSDDYDSDLEKMIDDYSKNNFNPHEI 765

Query: 676  RQLLAKENKELDEKMVNKILYDIKNGGFR-KRGRNAXXXXXXXXXXXXX-RNYRLKRREL 733
            R++LA ENKE+D KM+NKILYDIKNGGFR KR +N+              + YRLKRREL
Sbjct: 766  REMLAAENKEMDIKMINKILYDIKNGGFRNKRAKNSLELELSDDDEDDVLQQYRLKRREL 825

Query: 734  MKKSRIEGKDKEKAFRNAKSKAFLESMVDDIDESKNPFGDPE---MDVEDN-TDVDTQEN 789
            M+K R+E  D  K  +N KS AF ESMV+DI E KNPFG  E   +D+    TD+DTQ+N
Sbjct: 826  MRKRRLEIGDDAKLVKNPKSSAFFESMVEDIIEYKNPFGAEEEYNLDITSTATDLDTQDN 885

Query: 790  -----DYPKNKE---------KNTLSQEFVQXXXXXXXXXXXXXXXXXGE--QITLGDEE 833
                 D   N E         K  +S++FVQ                  E  +I  G++E
Sbjct: 886  SINVGDNTGNNEQKPVDQKNKKVIISEDFVQKSLSFLKSNNYEDFETDKELSRIQHGNDE 945

Query: 834  --QDVSSLKRNSSIHALHNSSSPIKE--------DLEKENQDEDFI------TLPNFKPP 877
              +D+ +LK+NSSI +  NS +            DLEK  +DED +       +  FK P
Sbjct: 946  AIEDLYTLKQNSSIKSFTNSQTDSTTSKTVNTIIDLEKRPEDEDEVENGDTSLVGVFKHP 1005

Query: 878  SLIKSLAGGFDPNNKFQSGKKTVTVSKSYRAVGGSRSSITYFGKMRKLVGPKNR------ 931
            S+IKS A   D N+KF+ G KTV + KSY+ VG S++SITY GK RKL+ PK +      
Sbjct: 1006 SIIKSFASRTDINDKFKEGNKTVKILKSYKTVGSSKASITYMGKTRKLIAPKRKTEGSHR 1065

Query: 932  --NSTLSKGPRPASKPTMGKLWESQQNSFD 959
              +   +K  +  +K    KL+ES Q+SFD
Sbjct: 1066 YHHDHHNKKMKMKTKTKSNKLFESGQDSFD 1095

 Score =  169 bits (429), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 172/546 (31%), Positives = 249/546 (45%), Gaps = 123/546 (22%)

Query: 1   MDSLLEKLDPLSSKRRTT-YKKVFEPQEEEETQQISNSP-----PPPILGNGFLFQNSTI 54
           MD  L  L  L++K+RTT YKKV  P  +E      N P     PP + GNGFLF N+T+
Sbjct: 1   MDDALHALSSLTAKKRTTTYKKVAVPILDENDNTNGNGPNDIDNPPELTGNGFLFANATL 60

Query: 55  DKVRNRLRNAEDGAXXXXXXXXXXXXXXXXXXXXXXXIADLYEGAEELEEQNKERVRLPL 114
           ++V+NRL                              I++LY+G EELE+   E      
Sbjct: 61  NRVKNRLE-----GKKAPEQNHNNGKDRSENSLPTQLISNLYDGGEELEKS--EVKDNSY 113

Query: 115 SKKTSSASQEKTQVIPWA------------------PTV----EGVENNVEQG-----TD 147
           S+K  S+S  +TQ IP +                  PT     +G+ N   Q      T 
Sbjct: 114 SEKNVSSSFTQTQRIPVSIQQDKVFNVPIHSVNDGKPTQLIKEDGLVNETSQALKTPLTT 173

Query: 148 IHEEKTQQVPNEISYDQKTQAIQSFQ-QTEV-------------------------EPLT 181
                TQ++ +  +  Q TQ I+S + Q+++                          PL 
Sbjct: 174 GRPGATQRIDSSGATSQ-TQPIKSIEPQSQIITTSSNHSNALSPKIPIIPTELIGTSPLF 232

Query: 182 QRISE--PERTLDVPTYAATSED--------QLDTQEQNPITQLDISNSLLFQATDSDIP 231
           Q I    P+  +DVP   A  ED        Q   QEQ   TQ+D     + Q    ++P
Sbjct: 233 QSIQNRGPDTQMDVPPQTAHDEDKTQAIGIPQATHQEQK--TQIDT----VAQTLQDEVP 286

Query: 232 KSPPQRLKMHDIEKELEEKRQERDHRRNIEYRAPEKPVNVKRVFSKEAFLKNFXXXXXXX 291
            +    LK+ +I+ EL  +  +R+  RN+EY+ P+KP+  K+ FSKE+FL +F       
Sbjct: 287 HT----LKIREIQSELASEDSKREKARNVEYKKPQKPIPTKKFFSKESFLADFDDSSSNE 342

Query: 292 XXXXXXXXXDIEKKH---------TEKDKSTLENTTESS----QRQRVFSVYEYKLKGEL 338
                     +E  H           ++KS   N T+ +    +R  + S Y   LK E+
Sbjct: 343 DDDIK-----LENAHPKPVQNDDELHENKSVELNLTDETRINEKRVPLLSSYANNLKREI 397

Query: 339 DSKRCIQLXXXXXX-------------XXXXXXXPLSRVSKATVLDIKARRSKQ-EPLS- 383
           DS +CI L                          P+S++SKAT+L++KAR SKQ + LS 
Sbjct: 398 DSSKCITLDLDSDSDEYGDDDMDSIKLSKDESVLPISQLSKATILNLKARLSKQNQKLSQ 457

Query: 384 ---KIKQKKTTLNDLICTLKKASKKQITDHQNELMKSRGYKLEDIEKQKEEIENLLEQEI 440
              K K  K   N L+ TL+KAS+KQI DHQ E+++++G KLED+ K+KE +ENLLEQEI
Sbjct: 458 RPNKSKDPKVDHNVLLNTLRKASRKQILDHQKEVIETKGLKLEDMAKEKEIVENLLEQEI 517

Query: 441 ARNKRL 446
            RNKR+
Sbjct: 518 LRNKRI 523

>NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_1.5
            YCL061C
          Length = 1020

 Score =  210 bits (534), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 166/471 (35%), Positives = 225/471 (47%), Gaps = 29/471 (6%)

Query: 510  GDSDNISARXXXXXXXXXXXIQKGRTKNHKMLPAEDSDSEHDDTLPRNIIDLGPYGNNL- 568
             D+ +IS++            Q  R + H +   ++SD E++     N IDLG YG NL 
Sbjct: 556  ADNSSISSKNEISDEDEDSIFQLTRKEKHPVRIIQESDDENEIN-KINTIDLGVYGGNLD 614

Query: 569  -------QVNHEEDMENLPLXXXXXXXXXXXXKTNELXXXXXXXXXXXXXXXXQRLKDMK 621
                   Q    ED E+               + + L                 R K+MK
Sbjct: 615  NPNPLSSQTEPNEDDEDE--KSTYENKEITEEERHALILAEKKRIQLIEKKNAARTKEMK 672

Query: 622  AKGLNKMLXXXXXXXXXXWKGVGGVXXXXXXXXXXXXXXMIDDFTKSNENFDDVRQLLAK 681
             KG+NK+           W G+GG               MIDD++KSN N D++RQ+LA 
Sbjct: 673  KKGVNKLFEMEAEESEDEWHGIGGADGEVSDEYDSEVEKMIDDYSKSNFNPDEIRQMLAL 732

Query: 682  ENKELDEKMVNKILYDIKNG--GFRKRGRNAXXXXXXXXXXXXXRNYRLKRRELMKKSRI 739
            ENKE+D  M+ KILYDIKNG    R+RG                R Y  ++RELMKK  +
Sbjct: 733  ENKEMDLNMITKILYDIKNGGFRKRRRGGLDLELSDDDEDDEELREYHKRKRELMKKRML 792

Query: 740  EGKDKEKAFRNAKSKAFLESMVDDIDESKNPFGDPEMDVEDNTDVDTQENDYPK-----N 794
            E  D +K  +N KSKAF ESMV+DI + KN FGD E   + +T++DTQE          +
Sbjct: 793  EIGDDKKLIKNPKSKAFFESMVEDIVDEKNAFGDIESIEKSSTELDTQEEKEQDVTPGVD 852

Query: 795  KEKNTLSQEFVQXXXXXXXXXXXXXXXXXGEQIT---LGDEEQDVSSLKRNSSIHALHNS 851
            K+KN +S+EFVQ                  E +     G+  +D+ SLK+ S+I    N 
Sbjct: 853  KKKNVISEEFVQKTLSFLRSGRDLEEFNIEEDLAKEQHGENVEDLFSLKQRSTIKEFRNP 912

Query: 852  SSPIKEDLEKENQDEDFITLPNFKPPSLIKSLAGGFDPNNKFQSGKKTVTVSKSYRAVGG 911
            S     DL    ++ +   L  FKPPS+IKS +   D N KF+ G KTVT+SK Y+ VG 
Sbjct: 913  SQTNTIDLINNVENVESSPLGGFKPPSVIKSFSSRTDINEKFKDGNKTVTISKVYKTVGS 972

Query: 912  SRSSITYFGKMRKLVGP---KNRNSTLSKGPRPASKPTMGKLWESQQNSFD 959
            S++SITY GK RKL+ P   KNR    SK      KPT   L+ S   SF+
Sbjct: 973  SKASITYLGKSRKLMPPKKNKNREKIGSK-----IKPTRSSLFSSHDESFE 1018

 Score =  142 bits (358), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 161/508 (31%), Positives = 252/508 (49%), Gaps = 88/508 (17%)

Query: 1   MDSLLEKLDPLSSKRRTTYKKVFEP--QEEEETQQISNSPPPPILGNGFLFQNSTIDKVR 58
           M+S+ E+      +R+TTYKK+ E    +EE   +  +   PP++GNGF+F N+ IDK+ 
Sbjct: 1   MESIFEEFSLPKKQRKTTYKKIHEEPNNDEEALTEAVDVMAPPVIGNGFIFGNALIDKI- 59

Query: 59  NRLRNAEDGAXXXXXXXXXXXXXXXXXXXXXXXIADLYEGAEELEEQNKERVRLPLSKKT 118
              RN  DG                        I +LY+ AEELEE+  E  +  ++K+ 
Sbjct: 60  ---RNRLDG---------KENKEDTPVPTQTQMIDNLYKDAEELEEETIEYEKEAINKE- 106

Query: 119 SSASQEKTQVIPWAPTVEGVENNVEQGTDIHEEKTQ--------------------QVPN 158
               QE  Q    A   E +EN ++  +D + ++TQ                    QV N
Sbjct: 107 ----QEVVQTQLIAKEKEEIEN-IKNPSDAYLQETQPIEEKSFLLGTNKELETQETQVIN 161

Query: 159 EI----------SYDQK-----TQAIQSFQQTEVEPLTQRIS---EPERTLDVPTYA--- 197
            +          S ++K     TQ IQ F +T VE  +  +S   +   T+++P +A   
Sbjct: 162 PVLSESQPSENRSSNEKIPFTFTQKIQDFVET-VENYSTDLSLSKDETITINLPNHATDN 220

Query: 198 ATSE--DQLDTQEQNPITQLD---ISNSLL--FQATDSDIPK----------SPPQRLKM 240
           +TS+   ++  + Q  +T +D   I+N+ L   +AT +D+P            P   LK+
Sbjct: 221 STSKRAHRISQELQRTMTDMDTQVINNTNLDVIEATMADLPNLNEPQSTVADIPSTGLKI 280

Query: 241 HDIEKELEEKRQERDHRRNIEYRAPEKPVNVKRV-FSKEAFLKNFXXXXXXXXXXXXXXX 299
           H+I+KELE +R  ++ +   EY+ P K + V  + FSK + L  F               
Sbjct: 281 HEIQKELERERNSKELK---EYKKPSKEIKVIPIKFSKTSLLDGFDNSSSDDELEVQK-- 335

Query: 300 XDIEKKHTEKDKSTLENTTESSQRQRVFSVYEYKLKGELDSKRCIQLXXXXXXXXXXXXX 359
            D++   T++   +        ++    + YE KLK +L  K+ IQL             
Sbjct: 336 -DMKITRTKEKPESSIKPKIKPKKLTGLNTYENKLKKKLLEKKHIQLDSDSDNDSDIAKR 394

Query: 360 -PLSRVSKATVLDIKARRSKQEPLSKIKQKKTTLNDLICTLKKASKKQITDHQNELMKSR 418
            P+SR SKAT+L++KAR SK++P+   K   T+L+ L   LK+AS+KQI DHQ EL+++R
Sbjct: 395 FPISRTSKATLLNLKARLSKKKPVKSNKSTNTSLDVLFQNLKQASRKQILDHQRELVENR 454

Query: 419 GYKLEDIEKQKEEIENLLEQEIARNKRL 446
           G+KLEDIEK+KE +ENLLE+EI RNKR+
Sbjct: 455 GFKLEDIEKEKEIVENLLEEEIKRNKRI 482

>TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5
           YCL061C
          Length = 965

 Score =  206 bits (524), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 149/451 (33%), Positives = 218/451 (48%), Gaps = 31/451 (6%)

Query: 533 GRTKNHKMLPAEDSDSEHD-------DTLPRNIIDLGPYGNNLQVNHEEDMENLPLXXXX 585
           G+ K+ K    +DSDSE +       + +  N IDLG YG+N+     E      L    
Sbjct: 522 GKRKHKKTEIVDDSDSEIEAQIVDSKEIITANTIDLGHYGDNIIQQSRE-----TLNETE 576

Query: 586 XXXXXXXXKTNELXXXXXXXXXXXXXXXXQRLKDMKAKGLNKMLXXXXXXXXXXWKGVGG 645
                   + N +                +RLK+MK  G++KM           W G+GG
Sbjct: 577 ESDEEDEERYNAIISEGIRKQKELEKREAKRLKEMKTSGVSKMFEVEAEESEDEWHGIGG 636

Query: 646 VXXXXXXXXXXXXXXMIDDFTKSNENFDDVRQLLAKENKELDEKMVNKILYDIKNGGFRK 705
           V              MIDD+++ N N  ++R++LAKENKE D  +VNKILYDIKNGGFR 
Sbjct: 637 VDSDFSDAYDSEVEKMIDDYSRQNFNPSEIREMLAKENKETDLALVNKILYDIKNGGFRT 696

Query: 706 RGRNAXXXXXXXXXXXXXRNYRLKRRELMKKSRIEGKDKEKAFRNAKSKAFLESMVDDID 765
           R R               + YR KRR LM++ R++ +  +K  +N KSKAF ES+VDDI 
Sbjct: 697 RKRRDRDLEFSDDDDDDLKAYRAKRRALMREKRLDIEGDKKIVKNPKSKAFFESIVDDII 756

Query: 766 ESKNPFGDPEMDVED-------NTDVDTQE---NDYPKNKEKNTLSQEFVQXXXXXXXXX 815
           E+KNPF D    +E          D+D  E    +  K K+K  +S+EFVQ         
Sbjct: 757 ETKNPFDDMNTSIEQIVEKETPTVDIDNDEKLATNVTKKKKKIVISEEFVQRSLSFLNSC 816

Query: 816 XXXXXXXXGEQITLGDEE---QDVSSLKRNSSIHALH----NSSSPIKEDLEKENQDEDF 868
                     Q   G++     D+ +LKR SSI  L     + SS I  +L ++      
Sbjct: 817 REQDEFEINNQHNGGEKATSTADLYTLKRYSSIKTLQSVTSSRSSSIASNLNEQPSQSSG 876

Query: 869 ITLPNFKPPSLIKSLAGGFDPNNKFQSGKKTVTVSKSYRAVGGSRSSITYFGKMRKLVGP 928
               + +  S++ S +   D N+KF+ G K+V VS +Y+ VG +R+SITY G  R+LV P
Sbjct: 877 SLFNDLRKTSVLNSFSSDVDINSKFKEGTKSVKVSNAYKTVGSARASITYMGTSRRLVAP 936

Query: 929 KNRNSTLSKGPRPASKPTMGKLWESQQNSFD 959
           K   S L+   +  S+ T  +L+++Q+ SF+
Sbjct: 937 K--KSRLTTSSKANSRTTPSRLFDNQEGSFE 965

 Score =  112 bits (279), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 146/479 (30%), Positives = 221/479 (46%), Gaps = 72/479 (15%)

Query: 1   MDSLLEKLDPLSSKRRTTYKKVFEP--QEEEETQQI-SNSPPPPI--LGNGFLFQNSTID 55
           MDSL ++L+    K+RTTY K+     +EE+E++ I  N     I  L  G LF NS + 
Sbjct: 1   MDSLFDQLNHFK-KKRTTYDKIPHDLLEEEQESEDILKNKTAKEISQLDGGILFGNSILG 59

Query: 56  KVRNRLRNAED------GAXXXXXXXXXXXXXXXXXXXXXXXIADLYEGAEELEEQN--- 106
           ++RNRL N ++                               I +LY+G E+LE +    
Sbjct: 60  QIRNRLNNIDNEDKDKGKEASESITSKDNEQDSTQIFPQTQIINNLYDGGEDLENEIFHN 119

Query: 107 --------KERVRLPLSKKTSSASQEKTQVIPWAPTVEG----VENNVEQGTDIHEEKTQ 154
                    + + +  +    S   EKTQVI     +      V NN +  T +  E TQ
Sbjct: 120 SFKKTQIITDNILIETNTNDKSTQYEKTQVITINERLSDKPLDVVNNTQ--TVLVIENTQ 177

Query: 155 QVPNEISYDQKTQAIQSFQQTEVEPLTQRISEPERTLDVPTYAATSEDQLDTQEQNPITQ 214
            +P+EI    KTQ +         P+TQ    P +T+ V T A  +E   DTQE  P   
Sbjct: 178 PLPSEI----KTQVVNEVNS--ALPVTQ----PTQTI-VATQA--NEVTYDTQELMPTV- 223

Query: 215 LDISNSLLFQATDSDIPKSPPQRLKMHDIEKELEE-KRQERDHRRNIEYRAPEKPVNVKR 273
               + +  ++T           LK+ DIEKELEE +R  ++     E++  E    + +
Sbjct: 224 ----DDVAMRSTG----------LKITDIEKELEEEQRLAKETEFGTEFKFKESESKISK 269

Query: 274 VFSKEAFLKNFXXXXXXXXXXXXXXXXDIEKKHTEKDKS-TLENTTESSQRQRVFSV--- 329
            FSKE FL +F                   +K    DKS  L    +S    +V S+   
Sbjct: 270 KFSKEDFLNHFDDSSSSEDETSKN------EKGPNVDKSEVLHPDNKSKTLLKVKSINGL 323

Query: 330 --YEYKLKGELDSKRCIQLXXXXXXXXXXXXXPLSRVSKATVLDIKARRSKQEPLSKIKQ 387
             YE+ L+ + ++++ I+                S  SKA +L+I+A +SKQ+P    K 
Sbjct: 324 GNYEHNLRRKANNEQIIEFSESDEDSDTNISP--SYASKAVILNIRANKSKQQPKVSQKS 381

Query: 388 KKTTLNDLICTLKKASKKQITDHQNELMKSRGYKLEDIEKQKEEIENLLEQEIARNKRL 446
            +TTL  L   LK+ASK+QI  +Q ELM+ +G  LE++EK+ E +ENLLEQEIARN+++
Sbjct: 382 DQTTLLMLYNNLKRASKEQIVSYQKELMEKKGINLEELEKENEIVENLLEQEIARNQKI 440

>NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1091

 Score =  203 bits (516), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 155/465 (33%), Positives = 219/465 (47%), Gaps = 63/465 (13%)

Query: 546  SDSEHDDTLPRNIIDLGPYGNNLQVNH---------------EEDMENLPLXXXXXXXXX 590
            S+ + D    RN IDLG YG+NL   +                E+++  PL         
Sbjct: 638  SEDDEDTISKRNAIDLGAYGDNLTTANVKSQDDDDLEVDDDKNENLDTQPLELTEQERI- 696

Query: 591  XXXKTNELXXXXXXXXXXXXXXXXQRLKDMKAKGLNKMLXXXXXXXXXXWKGVGGVXXXX 650
                  ++                 + K+M  KG+ K            W G+GG+    
Sbjct: 697  ------DIIEAEKTKIKMQQEKMRHKEKEMMKKGVTKFFEMEAEESEDEWHGIGGIDGEM 750

Query: 651  XXXXXXXXXXMIDDFTKSNENFDDVRQLLAKENKELDEKMVNKILYDIKNGGFRKRGRNA 710
                      MIDD++K+N + +++R++LA ENKE+D  M+NKILYDIKNGGFRKR R  
Sbjct: 751  SDEYDSDVEKMIDDYSKANFDPNEIREMLAAENKEMDLNMINKILYDIKNGGFRKRKRGG 810

Query: 711  -XXXXXXXXXXXXXRNYRLKRRELMKKSRIE-GKDKEKAFRNAKSKAFLESMVDDIDESK 768
                          R Y LKR+ELM+K R+E G D++K  +N KSKAF ESMV+DI + K
Sbjct: 811  LELELSEDEDDDALREYHLKRKELMRKRRLELGDDEKKLVKNPKSKAFFESMVEDITDDK 870

Query: 769  N-----PFGDPEMDVEDNTDVDTQENDYPKNKEKN----------TLSQEFVQXXXXXXX 813
            N     P G+      +NT  D +E D    KE             +S+EFVQ       
Sbjct: 871  NAFNDEPLGETSTQEINNTQDDMKEEDAAVVKENGDSKRIKKKKTIISEEFVQRTLSFLK 930

Query: 814  XXXXXXXXXXGEQIT---LGDEEQDVSSLKRNSSIHAL----HNSSSPIKEDLEKENQDE 866
                       E +     G + +++ SLK+ SSI       +NSS  IK D    + D+
Sbjct: 931  SSREDEEFAMNENLAKEQHGTKVENLLSLKQQSSIKVFQSPSNNSSKVIKLDDINNDDDD 990

Query: 867  DFIT-LPNFKPPSLIKSLAGGFDPNNKFQSGKKTVTVSKSYRAVGGSRSSITYFGKMRKL 925
            D  + +  FK PS++KS     D N KFQ G KTVT+SKSYR VG S++SITY GK RKL
Sbjct: 991  DEDSPIALFKVPSILKSFGSKTDINEKFQDGNKTVTISKSYRTVGSSKASITYLGKSRKL 1050

Query: 926  VGPKNR-----------NSTLSKGPRPASKPTMGKLWESQQNSFD 959
            + P +            N+ ++KG R      +G L+ +  +SF+
Sbjct: 1051 MAPTHSKMKPLRSRVTDNNKITKGER-----NIGSLFSTGDDSFE 1090

 Score = 97.8 bits (242), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 85/252 (33%), Positives = 124/252 (49%), Gaps = 25/252 (9%)

Query: 220 SLLFQATDSDIPKSPPQRLKMHDIEKELEEKRQERDHRRNIEYRAPEKPVNVKRV-FSKE 278
           S     T +D   S    L +H  +KELEE+ Q  ++ +  EY+   KP+    V F+K+
Sbjct: 283 STALVGTVADDKLSSGSNLAIHKFQKELEEEEQLANNSKYKEYKGISKPILTNIVKFTKD 342

Query: 279 AFLKNFXXXXXXXXXXXXXXXXDIEKKHTEKDKSTL-----ENTTESS------------ 321
           +FL+ F                + ++   E   S        N+T SS            
Sbjct: 343 SFLQGFDNSSSSSSEEEGDKVKETKRNGKENTSSNSYSTKNNNSTASSDGTTIKPKIKSP 402

Query: 322 ---QRQRVFSVYEYKLKGELDSKRCIQLXXXXXXXXXXXXX-PLSRVSKATVLDIKARRS 377
               +    S YE KLK  L+SK  +QL              P+SR SKAT+L IKAR S
Sbjct: 403 KKFSKLNTLSRYENKLKTVLNSKNQLQLGSDDESSDDTENSLPVSRTSKATILTIKARLS 462

Query: 378 KQEPLSKIKQKKTT---LNDLICTLKKASKKQITDHQNELMKSRGYKLEDIEKQKEEIEN 434
           KQ+    +++  T    LN L   LKK+S+KQI ++Q EL++++G   EDIE +KE +EN
Sbjct: 463 KQKSKKNVQKDGTVNTNLNKLFENLKKSSRKQILENQRELIENKGLNFEDIEMEKELVEN 522

Query: 435 LLEQEIARNKRL 446
           LLEQEI RN+++
Sbjct: 523 LLEQEIKRNQKI 534

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 44/69 (63%), Gaps = 8/69 (11%)

Query: 1  MDSLLEKLDPLSSKRRTTY-KKVFEPQ-EEEETQQI------SNSPPPPILGNGFLFQNS 52
          MDSL++ L P++  R+TTY KK  +P  EE+E   I        +  P ILG GFLF+NS
Sbjct: 1  MDSLIDDLKPVTKVRKTTYNKKSLDPSIEEQEEDGILTDVTSGGNVTPTILGTGFLFKNS 60

Query: 53 TIDKVRNRL 61
          TIDKVR RL
Sbjct: 61 TIDKVRARL 69

>Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON}
           complement(11914..14871) [2958 nt, 986 aa]
          Length = 985

 Score =  201 bits (512), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 150/425 (35%), Positives = 207/425 (48%), Gaps = 40/425 (9%)

Query: 557 NIIDLGPYGNNLQVNHEEDMENLPLXXXXXXXXXXXXKTNELXXXXXXXXXXXXXXXXQR 616
           N I+LG YG+NL   +  +  N+                 E+                Q+
Sbjct: 578 NTINLGHYGDNLSQENNNERNNIDSDESEDEELYK-----EMVKKEIDRRRDQERKQRQK 632

Query: 617 LKDMKAKGLNKMLXXXXXXXXXXWKGVGGVXXXXXXXXXXXXXXMIDDFTKSNENFDDVR 676
           L+++K KG+  M           W G+GGV              MIDD++K N N  ++R
Sbjct: 633 LRELKDKGITDMFEVEAEESEDEWHGIGGVDGELSDEYDSEVEKMIDDYSKENFNAGEIR 692

Query: 677 QLLAKENKELDEKMVNKILYDIKNGGFRKRGRNAXXXXXXXXXXXXXRNYRLKRRELMKK 736
           + LA ENK++D KMVN+IL DIKNGGFRKR RNA             + YR KRR+LMK+
Sbjct: 693 EKLAAENKDMDLKMVNRILNDIKNGGFRKR-RNALEIELSDDEDDDLKAYRAKRRQLMKE 751

Query: 737 SRIEGKDKEKAFRNAKSKAFLESMVDDIDESKNPFGDPEMDVEDNT-----DVDTQENDY 791
            R+E    +K   N KS AFLESMVDDI E KNPF + + ++ D+T     + D   N+ 
Sbjct: 752 KRLETDHNKKLMTNKKSHAFLESMVDDIVEVKNPFDERDDNIMDDTPETDAEGDVNSNEL 811

Query: 792 PKNKEKNTLSQEFVQXXXXXXXXXXXXXXXXXGEQITLGDEEQ-----DVSSLKRNSSIH 846
              K+K  LS+ FVQ                      L  E+      D+ +LK + SI 
Sbjct: 812 LNKKKKFILSEAFVQKSLSFLSSSRNLEEFEMNN--NLAKEQHSHAATDMFALKSHCSIK 869

Query: 847 AL------HNSSSPIKEDLEKENQDEDFITLP--NFKPPSLIKSLAGGFDPNNKFQSGKK 898
           +L      HN+S   K DL      E+ ++ P    K  S+IKS +   D ++KF+ G K
Sbjct: 870 SLESLPGSHNNSISSKLDL----LHEEIVSTPFSGLKQTSVIKSFSSSIDIDSKFKDGNK 925

Query: 899 TVTVSKSYRAVGGSRSSITYFGKMRKLVGPKNRNSTLSKGPRPASK----PTMGKLWESQ 954
           TV VSKSYR VG +++SITY GK RKLV PK       K  +P S      +  +L++ Q
Sbjct: 926 TVKVSKSYRTVGSAKASITYLGKARKLVPPK------KKEHKPHSHKSKTASASRLFDEQ 979

Query: 955 QNSFD 959
            NSF+
Sbjct: 980 DNSFE 984

 Score =  126 bits (317), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 136/468 (29%), Positives = 213/468 (45%), Gaps = 47/468 (10%)

Query: 1   MDSLLEKLDPLSSKRRTTYKKVFEPQEEEETQQISNSPPPPILGNGFLFQNSTIDKVRNR 60
           MD + + LD L  K+RTTYKKV +   E+E +    +   P LG   LF NS + ++RNR
Sbjct: 1   MDFVFDGLDALKGKKRTTYKKVTDGDVEDEPKISEFNIELPGLGQSILFNNSKLKQIRNR 60

Query: 61  LRNAEDGAXXXXXXXXXXXXXXXXXXXXXXXIADLYEGAEELEEQNKERVRLPLSKKTSS 120
           L    + +                       I++LYEG E+LEE+ + R       + + 
Sbjct: 61  LEGNNNDSENDSSQAETQVIADTQI------ISNLYEGGEDLEEKEERRFL-----QRTQ 109

Query: 121 ASQEKTQVIPWAPTVEG--VENNVEQGTDIHEEKTQQVPNEISYDQKTQAIQSFQQTEVE 178
             ++ TQ+I  + T     +E+N         + TQ+  N  + D +   IQ  +  ++ 
Sbjct: 110 IVEDHTQIIDASVTYSSKTIESN-------KMDNTQKYIN--ASDSEPTQIQISKVDKLL 160

Query: 179 PLTQRISEPERTLDVPTYAATSEDQLDTQE----QNPITQLDISNSLLFQATDSDIPKSP 234
            +T  +   ++ LD        E Q    +    Q   TQ+D +        D +I  S 
Sbjct: 161 KITDNLDSQKKVLDTTLETQELETQYGKTQVDKTQVDKTQVDKTQIFPTLVADDEIKHSS 220

Query: 235 P------------QRLKMHDIEKELEEKRQ-ERDHRRNIEYRAPEKPVNVKRVFSKEAFL 281
                          LK+++IE++L+E+ Q  ++     EY+    PV  K  FSK  FL
Sbjct: 221 TAVQTVDDNTHSNSELKINEIERQLDEEDQILKEKSMGTEYKRNIAPVMSKVKFSKNDFL 280

Query: 282 KNFXXXXXXXXXXXXXXXXDIEKKHTEKDKSTLENTTESSQRQRVF---SVYEYKLKGEL 338
           ++F                  E    E     LEN+     ++  F   S YE  LK ++
Sbjct: 281 EHFDSSSSEEDEEGVVKLSSTE---PETAAMNLENSLPQFSKESKFIGLSNYENILKKDI 337

Query: 339 DSKRCIQLXXXXXXXXXXXXXPLSRVSKATVLDIKARRSKQEPLSKIKQKKTTLNDLICT 398
           + + CI+               +SR SKAT+L IKA  S+ +P       K  L +L   
Sbjct: 338 NKQNCIEFSDSEDETEVTS--KVSRASKATILSIKANLSRHKPAQSSINNKNALGNLFSD 395

Query: 399 LKKASKKQITDHQNELMKSRGYKLEDIEKQKEEIENLLEQEIARNKRL 446
           LKKA+K QI DH+ E+M+ +GYK+E+IEK+KE +ENLLEQEI RN+++
Sbjct: 396 LKKATKAQILDHKKEIMEQKGYKMEEIEKEKEIVENLLEQEIERNRKI 443

>SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {ON}
            some similarities with uniprot|P25588 Saccharomyces
            cerevisiae YCL061C MRC1 S-phase checkpoint protein found
            at replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 1177

 Score =  201 bits (512), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 138/377 (36%), Positives = 191/377 (50%), Gaps = 35/377 (9%)

Query: 615  QRLKDMKAKGLNKMLXXXXXXXXXXWKGVGGVXXXXXXXXXXXXXXMIDDFTKSNENFDD 674
            Q+ K+MK KG++KM           W GVGG               M+DD+TK+  +  +
Sbjct: 805  QKRKEMKRKGVSKMFEMEAEESEDEWHGVGGADGELSDEYDSELEKMVDDYTKTTFDPAE 864

Query: 675  VRQLLAKENKELDEKMVNKILYDIKNGGFRKRGRNAXXXXXXXXXXXXXRNYRLKRRELM 734
            +RQ+LA E+KE DEK+VNKIL+DIKNGGFR+RG+ A             + Y  KRREL+
Sbjct: 865  IRQMLAAEDKEYDEKIVNKILHDIKNGGFRRRGKGALDIELSDDEDDELQRYHAKRRELL 924

Query: 735  KKSRIEGKDKEKAFRNAKSKAFLESMVDDIDESKNPF-----GDPEMD-VEDNTDVD--T 786
            ++  +E  +  K   N KS AF ESMV+D+ ESKNPF      DP+   + +N  VD  +
Sbjct: 925  RQKVLENGEASKLVSNPKSHAFFESMVEDLVESKNPFSIGETADPDSGAISENDKVDNAS 984

Query: 787  QENDYP--------KNKEKNTLSQEFVQXXXXXXXXXXXXXXX-------XXGEQITLGD 831
            +    P          +++  +SQEFVQ                         +  TLGD
Sbjct: 985  EHGTQPDAGGQPVRTERKRIKISQEFVQRSLSFLNSKDELDNEFELDRRLAKHQHSTLGD 1044

Query: 832  EE---QDVSSLKRNSSIHALHNSS--SPIKEDLEKENQDEDFITLPNFKPPSLIKSLAGG 886
            +    +D+ +LK+NS I  LH  +  S    DLE +           FK PS+I S +  
Sbjct: 1045 DNDDLEDLFTLKQNSCIKTLHTPARTSSRTVDLEVDGNS----PANGFKLPSVISSFSSR 1100

Query: 887  FDPNNKFQSGKKTVTVSKSYRAVGGSRSSITYFGKMRKLVGPKNRNSTLSK--GPR-PAS 943
             D N KF+ G KTV VSKSY+ +GGSR+SITY GK+RKL  PK + S      G R P +
Sbjct: 1101 IDINEKFKEGTKTVKVSKSYKTIGGSRASITYLGKVRKLNAPKRKESGRKPVFGHRHPEA 1160

Query: 944  KPTMGKLWESQQNSFDT 960
             P    L+    +SF+ 
Sbjct: 1161 APKRAGLFADNDDSFEA 1177

 Score =  111 bits (277), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 148/545 (27%), Positives = 233/545 (42%), Gaps = 137/545 (25%)

Query: 14  KRRTTYKK---VFEPQEE--EETQQISNSPPPPILGNGFLFQNSTI-DKVRNRLRNAEDG 67
           K++TTY K   V+  QEE  EE +Q      P +    FLF NSTI DKV++RL    + 
Sbjct: 15  KKKTTYVKDIEVYATQEENDEEKKQ------PQLSSASFLFGNSTIVDKVKSRLNGVSN- 67

Query: 68  AXXXXXXXXXXXXXXXXXXXXXXXIADLYEGAEELEEQNKERVRLPLSKKTSSA------ 121
                                   I + Y+G E+LE+   + V  P  ++ S+       
Sbjct: 68  --------EETDGERGDALPQTQVIPNYYDG-EDLEQ---DFVSPPKPRRVSNTGHGQDC 115

Query: 122 ---SQEKTQVIPWAPTVEGVENNVEQGTDIHEEKTQQVPNEISYDQKTQAIQSFQQTEVE 178
              S+E+TQ++P   T       V     +   +T  +P  I+     +++    + EV+
Sbjct: 116 DCDSEEQTQLMPTQETGAYESQVVPVIAPVQVSET--IPVSINDGLLGESLFKTSKDEVK 173

Query: 179 P----LTQRISEP----ERTLDVPTYAATSEDQLDTQEQNPITQLDISNSLL-------- 222
                 T+ ++EP     + +  P Y  + + QL+TQE     ++D +  +L        
Sbjct: 174 GNGGNTTRNLAEPCYGLTQIIPSPQYKNSQQMQLETQEAGETQEVDKTQRILEATARDPT 233

Query: 223 ------FQATDSDI----------------------PKSP-------PQRLKMHDIEKEL 247
                   AT +D                       P +P        QRL +H+IEK+L
Sbjct: 234 LSEEDFVAATVADGSEAVTTQLDTCVPDTSALGDVQPTAPDQSAHRNSQRLLIHEIEKDL 293

Query: 248 EEKRQERDHRRNIEYRAPEKPVNVKRVFSKEAFLKNFXXXXXXXXXXXXXXXXD------ 301
           +   +E   +R  E +  +  + VK+ F KEAFL NF                +      
Sbjct: 294 DA--EEEREKRITEAKPHDVVLVVKKKFDKEAFLNNFDCSSSEGEEQEQEEQEEQTHLES 351

Query: 302 -----------------IEKKHTEKDKS---------TLENTTESSQRQR---------V 326
                            ++ K +E   S         T+  TT+  +  R          
Sbjct: 352 EPASKRRKLFTSVPGNPLDSKDSEAGGSGNFASAIAATIGTTTDEGRSTRKDKEEAGWVP 411

Query: 327 FSVYEYKLKGELDSKRCIQLXXXXXXXXXXXXXPLSRVSKATVLDIKARRSKQEPLSKIK 386
            + Y+ +LK  LDSK  I L             P S++SKA VL+IKAR SK++ + K +
Sbjct: 412 LNSYKNQLKARLDSKEHIDLDSSSDEDENSV--PASKMSKAAVLEIKARTSKRQGIKKTR 469

Query: 387 QKKTT-----LNDLICTLKKASKKQITDHQNELMKSRGYKLEDIEKQKEEIENLLEQEIA 441
           Q+ +T     L +L  +LKKA+KKQI DH+ E+ + RG  LEDIE++K+E+ENLLEQEI 
Sbjct: 470 QQPSTPRAPSLKELFSSLKKANKKQILDHRREITEKRGLNLEDIEREKKEVENLLEQEIE 529

Query: 442 RNKRL 446
           RN+++
Sbjct: 530 RNRKI 534

>CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {ON}
            similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061c
          Length = 1136

 Score =  196 bits (497), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 130/354 (36%), Positives = 188/354 (53%), Gaps = 19/354 (5%)

Query: 615  QRLKDMKAKGLNKMLXXXXXXXXXXWKGVGGVXXXXXXXXXXXXXXMIDDFTKSNENFDD 674
            ++L+++  KG+N+            W+G+GGV              MIDD++K+  +   
Sbjct: 793  KKLQELANKGVNQYFEEEAEESDDEWRGIGGVDGDDFGEYDSEVEKMIDDYSKTEVDLTS 852

Query: 675  VRQLLAKENKELDEKMVNKILYDIKNGGFRKRGRNAXXXXXXXXXXXXXRNYRLKRRELM 734
            +RQ +  ENKE+D K+VNKILYDIKNGGFRKRGRN              + +R KRRELM
Sbjct: 853  LRQKIMDENKEMDLKLVNKILYDIKNGGFRKRGRNDMELEFSDDEDAELQEFRRKRRELM 912

Query: 735  KKSRIEGKDKEKAFRNAKSKAFLESMVDDIDESKNPFGDPEMDVEDNTDVDTQE------ 788
            K+  +E +D +K  +N KSKAF ESM+ D+ E KN F D    +E   +  TQE      
Sbjct: 913  KQRMLENEDTDKLTKNPKSKAFFESMIVDLVEDKNNFDDLSDQIELKEENITQEDNEKEY 972

Query: 789  NDYPKNKE-KNTLSQEFVQXXXXXXXXXXXXXXXXXGEQITLGDEEQDVSSLKRNSSIHA 847
            N+   NK  K  +S++FVQ                    ++      D+++LK NSS+  
Sbjct: 973  NEAKSNKRGKIRISEDFVQKTLSFLHNDESTQEFQPSFIMSKEKGIGDMNALKSNSSLSF 1032

Query: 848  LHNSSSPIKEDLEKENQDEDFITLPNFKPPSLIKSLAGGFDPNNKFQSGKKTVTVSKSYR 907
                S+  K   ++E+  E+F    +FK PS+I+S +  F  ++KF+ G K+V VS SY+
Sbjct: 1033 CSKLSTSRKIINDEEDVIEEF---ESFKRPSIIQSFSSKFTIDDKFKDGNKSVKVSTSYK 1089

Query: 908  AVGGSRSSITYFGKMRKLVGPKNRNSTLSKGP--RPASKPTMGKLWESQQNSFD 959
             VGGS++SITY GK RKLV PKN       GP  R  +     +L+  Q + FD
Sbjct: 1090 TVGGSKASITYLGKTRKLVPPKN-------GPTVRKRNSNNTSRLFNIQNDPFD 1136

 Score = 82.4 bits (202), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 63/86 (73%)

Query: 361 LSRVSKATVLDIKARRSKQEPLSKIKQKKTTLNDLICTLKKASKKQITDHQNELMKSRGY 420
           LS  SKAT+L++K R SK++P+ K+  +K + N L   L+KA+K+QI  H+ ELM+SRG 
Sbjct: 532 LSNKSKATLLNLKVRLSKKKPVKKVHNEKDSTNLLFNNLRKATKQQIMLHRKELMESRGL 591

Query: 421 KLEDIEKQKEEIENLLEQEIARNKRL 446
             ED+EKQK  +E+LLE+EI RN ++
Sbjct: 592 NFEDLEKQKVMVEDLLEKEIERNLKI 617

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 43/85 (50%), Gaps = 18/85 (21%)

Query: 1  MDSLLEKLDPLSSKRRTTYKKVF--------EPQEEEETQQI------SNSPPPPILGN- 45
          MD L ++L+ +  K+RTTYKKV         E   E+ + QI      ++S    +L N 
Sbjct: 1  MDFLFDELEQVKIKKRTTYKKVQVVGTGQGDEIAREDTSNQIVPNNASTSSDSERLLNNV 60

Query: 46 ---GFLFQNSTIDKVRNRLRNAEDG 67
             GFL  +  +D +R+RL  ++D 
Sbjct: 61 NKKGFLLTSDKLDTIRSRLAQSKDS 85

>KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON}
           weakly similar to uniprot|P25588 Saccharomyces
           cerevisiae YCL061C MRC1 S-phase checkpoint protein found
           at replication forks required for DNA replication also
           required for Rad53p activation during DNA replication
           stress where it forms a replication-pausing complex with
           Tof1p and is phosphorylated by Mec1p protein involved in
           replication checkpoint
          Length = 925

 Score =  191 bits (484), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 125/343 (36%), Positives = 172/343 (50%), Gaps = 32/343 (9%)

Query: 620 MKAKGLNKMLXXXXXXXXXXWKGVGGVXXXXXXXXXXXXXXMIDDFTKSNENFDDVRQLL 679
           +K+ GLNK+L          W GVGG               MIDDF+KS  +   +R+ L
Sbjct: 610 LKSTGLNKILEMEAEESEDEWHGVGGADGENSDDYDSDLDTMIDDFSKSKFDTASIRERL 669

Query: 680 AKENKELDEKMVNKILYDIKNGGFRKRGRNAXXXXXXXXXXXXXRNYRLKRRELMKKSRI 739
           A ENKE+DE+M+NKIL+DI  GGFRKRGR A             R +R KRRE+MK+  +
Sbjct: 670 ALENKEMDERMINKILHDINTGGFRKRGRGALDLELSDDEDELLRQFREKRREIMKQKLL 729

Query: 740 EGKDKEKAFRNAKSKAFLESMVDDIDESKNPFGDPEMDVEDNTDVDTQENDYPKNKEKNT 799
           E  D      N+KSKAF +SMV+DI     P      +  D              K+K  
Sbjct: 730 ENVD--GVVNNSKSKAFFDSMVEDITRKSIPAVTSFSNTRDEM-----------GKKKIV 776

Query: 800 LSQEFVQXXXXXXXXXXXXXXXXXGEQITLGDEEQDVSSLKRNSSIHAL----HNSSSPI 855
           +S+EFVQ                   +    D  +D+ SLK+ S+I +L     N +S  
Sbjct: 777 ISEEFVQSSLSFLSAKDDDINEFEVTEAA-HDATEDLESLKQRSNIKSLDSPQRNRNSAF 835

Query: 856 KEDLEKENQDEDFITLPNFKPPSLIKSLAGGFDPNNKFQSGKKTVTVSKSYRAVGGSRSS 915
            +D++  + D        FK PS++KS +   D N+KF++G KTVT+SKSYR   GSRS+
Sbjct: 836 FDDVDGTSLD--------FKLPSIVKSFSSNSDVNDKFKTGIKTVTISKSYRVASGSRSA 887

Query: 916 ITYFGKMRKLVGPKNRNSTLSKGPRPASKPTMGKLWESQQNSF 958
           IT+ GK RKL  P+ R ST      P  +     L++S  +SF
Sbjct: 888 ITFLGKKRKLKAPQGRKST------PLVRKPTSSLFDSNSDSF 924

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/88 (37%), Positives = 53/88 (60%), Gaps = 3/88 (3%)

Query: 362 SRVSKATVLDIKARRSKQEPLSKIKQKKTT---LNDLICTLKKASKKQITDHQNELMKSR 418
           S+ SKA +L IKA+RS+ +         +T   L +L  +LK  ++ QI + + E+   +
Sbjct: 336 SQSSKAALLLIKAKRSRNKATKAKNMHVSTVDSLKELFTSLKTKNRDQILEFRREISGKK 395

Query: 419 GYKLEDIEKQKEEIENLLEQEIARNKRL 446
           G  LE IE +K ++E LLEQE+ RN+R+
Sbjct: 396 GISLEAIEDEKIQVEKLLEQELERNRRV 423

>KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1161

 Score =  190 bits (482), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 133/400 (33%), Positives = 198/400 (49%), Gaps = 23/400 (5%)

Query: 557  NIIDLGPYGNNLQVNHE-EDMENLPLXXXXXXXXXXXXKTNELXXXXXXXXXXXXXXXXQ 615
            N IDLG YGNNL++  E  + E L                 E                  
Sbjct: 746  NAIDLGDYGNNLEIRAELNNTEKLDTKCMLDEKEHARAVDKE-----RLKTIMKEKKLML 800

Query: 616  RLKDMKAKGLNKMLXXXXXXXXXXWKGVGGVXXXXXXXXXXXXXXMIDDFTKSNENFDDV 675
            +  ++K KG++             W G+GG+              MIDD+++++ + +++
Sbjct: 801  KRAELKEKGVSNFFEEEAEESEDEWHGIGGIDGEVSDEYDSEVEKMIDDYSRADMDPEEI 860

Query: 676  RQLLAKENKELDEKMVNKILYDIKNGGFRKRGRNAXXXXXXXXXXXXXRNYRLKRRELMK 735
            R+LL  ENKE+D KMVNKIL+DIKNG FRKRGR+              R YR KR ELMK
Sbjct: 861  RKLLVSENKEMDVKMVNKILFDIKNGNFRKRGRDTLELELSDEEDDDLRQYRQKRNELMK 920

Query: 736  KSRIEGKDKEKAFRNAKSKAFLESMVDDIDESKNPFG----DPEMDVEDNTDVDTQENDY 791
            +  ++  D +K  +N K+KAF +S+V+DI E KNPFG    +   D ++ T +DTQ  + 
Sbjct: 921  QRLLDLGDDKKLVKNVKTKAFFDSLVEDIVEVKNPFGVMSDNETQDTDETTTIDTQTRES 980

Query: 792  PKNKE---------KNTLSQEFVQXXXXXXXXXXXXXXXXXGEQITLGDEEQDVS---SL 839
              NKE         K  LS+EFVQ                  + +     + DVS   +L
Sbjct: 981  VSNKEEKPTQEKGKKTVLSEEFVQRSLSFLNSNRNLTEFEQNQDLARLQHDDDVSDLYTL 1040

Query: 840  KRNSSIHALHNSSSPIK-EDLEKENQDEDFITLPNFKPPSLIKSLAGGFDPNNKFQSGKK 898
            K+ SS+ +  +  S  +  +++  +     +    F+PPS+IKS     + ++KF++GKK
Sbjct: 1041 KKQSSVKSFKSVGSKNEIINVDANDNSGTAVATATFRPPSIIKSFNSKLNVDDKFRNGKK 1100

Query: 899  TVTVSKSYRAVGGSRSSITYFGKMRKLVGPKNRNSTLSKG 938
            TV   KSY+AVGGS++S+TY  K+RKL  PK+     S G
Sbjct: 1101 TVKTFKSYKAVGGSKTSVTYMNKVRKLTAPKSLKKLHSTG 1140

 Score = 83.6 bits (205), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 78/257 (30%), Positives = 129/257 (50%), Gaps = 26/257 (10%)

Query: 198 ATSEDQLDTQEQNPITQLDISNSLLFQATDSDIPKSPPQRLKMHDIEKELEEKRQERDHR 257
           AT  D+L+TQE              FQ T +D  KS    LK+H+I+ +++E+ +     
Sbjct: 390 ATMRDRLETQE--------------FQPTVADDVKSGGNTLKIHEIQTQIDEETRNM-LN 434

Query: 258 RNIEYRAPEK-PVNVKRVFSKEAFLKNFXXXXXXXXXXXXXXXXDIEKKHTEKDKSTLEN 316
           R +E+R     P  V+  F+KE+F+ +F                +     T   +++  N
Sbjct: 435 RGVEHRKSRGVPSRVEVRFTKESFMADFEESDSASDMESDSDQINDTTPETGSSQNSDSN 494

Query: 317 T----TESSQRQRV--FSVYEYKLKGELDSKRCIQLXXXXXXXXXX---XXXPLSRVSKA 367
                TE+ + +RV   S YE  L+ +++   C+ L                 +S+ SKA
Sbjct: 495 KARKPTEAPKTKRVTGLSSYETILRNKVNDDECLDLGSDDTYSSEEEYDKESKVSQASKA 554

Query: 368 TVLDIKARRSKQEPLSKIKQ-KKTTLNDLICTLKKASKKQITDHQNELMKSRGYKLEDIE 426
            VL+IKA+  K++ + K     KTTL+ L   LKK +++QI  HQ E++ ++G   +D+E
Sbjct: 555 AVLNIKAKALKKKAIVKAANTNKTTLDSLFSDLKKKNRQQILSHQAEIIGTKGINHKDLE 614

Query: 427 KQKEEIENLLEQEIARN 443
           ++KE +E+LLEQEI RN
Sbjct: 615 REKEIVEDLLEQEILRN 631

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 52/103 (50%), Gaps = 3/103 (2%)

Query: 1   MDSLLEKLDPLSSKRRTTYKKVFEPQEEEETQQISNSPPPPILGNGFLFQNSTIDKVRNR 60
           MD LLE+ + +  KRRTTYKKV +    +E     +  P  + GNGFLF N+T+DK++NR
Sbjct: 1   MDDLLERFNSVKVKRRTTYKKV-QQNSTDEAAGDDDCVPTSLAGNGFLFGNATVDKIKNR 59

Query: 61  LRNAEDGAXXXXXXXXXXXXXXXXXXXXXXXIADLYEGAEELE 103
           L N +                          ++ LY+G E+LE
Sbjct: 60  LNNED--HPNSSIDVTKSSSEDQIPVSQSQLLSTLYDGGEDLE 100

>AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL061C (MRC1)
          Length = 1018

 Score =  157 bits (396), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 105/322 (32%), Positives = 162/322 (50%), Gaps = 17/322 (5%)

Query: 616 RLKDMKAKGLNKMLXXXXXXXXXXWKGVGGVXXXXXXXXXXXXXXMIDDFTKSNENFDDV 675
           R ++MK KG+ KML          W G+GG               MIDD++  + N D +
Sbjct: 677 RRREMKKKGITKMLEMEAEESEDEWHGIGGSDNELSEDYDSEVEKMIDDYSVHSSNADHL 736

Query: 676 RQLLAKENKELDEKMVNKILYDIKNGGFRKRGRNAXXXXXXXXXXXXXRNYRLKRRELMK 735
           R +LAK  ++ DE +VNKIL+DI  GGFR+RG+ A             + +R KRREL+K
Sbjct: 737 RAILAKNERQHDENIVNKILHDISTGGFRRRGKGALDLEMSENEDQELQQFRQKRRELLK 796

Query: 736 KSRIEGKDKEKAFRNAKSKAFLESMVDDIDESKNPFGDPEMDVEDNTDVDTQENDYPKNK 795
           +  +E  D  K   N KS AF ++MVDD+ E+   FG+     + N D   ++ D     
Sbjct: 797 QKILENGDTSKLVSNPKSYAFFQTMVDDVTEAS--FGNT---FDANID---EKTDPSAAG 848

Query: 796 EKNTLSQEFVQXXXXXXXXXXX-----XXXXXXGEQITLGDEEQDVSSLKRNSSIHALHN 850
            K  +S++FV+                             +E QD+ +LK+NS+I  L  
Sbjct: 849 RKIVISEQFVKETLSFLSSKSGDSEIPAETKSISSSTVEREEIQDLHTLKQNSNIKHLKG 908

Query: 851 SSSPIKEDLEKENQDE-DF-ITLPNFKPPSLIKSLAGGFDPNNKFQSGKKTVTVSKSYRA 908
           S     +  E  + DE D+  +L  F+  S  KS   G + ++KF+SG K V + K+ + 
Sbjct: 909 SLELPAQMAELSSGDEGDYGFSLDRFR--SAAKSFNNGTNVDDKFKSGTKAVRILKANKT 966

Query: 909 VGGSRSSITYFGKMRKLVGPKN 930
           +GGS+++IT+ G+ R+L+ PKN
Sbjct: 967 IGGSKAAITFIGRKRRLIPPKN 988

 Score = 71.2 bits (173), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 123/486 (25%), Positives = 205/486 (42%), Gaps = 75/486 (15%)

Query: 5   LEKLDPL--SSKRRTTYKKVFEPQEEEETQQISNSPPPPILGNGFLFQNSTIDKVRNRLR 62
           +E LD L  S++++TTYKKV     E+   + S++ P  +      F++S +D+VR RL 
Sbjct: 1   MELLDGLCVSARKKTTYKKVRLGIAEQSKDEPSSNKPAAV------FRSSLLDRVRTRL- 53

Query: 63  NAEDGAXXXXXXXXXXXXXXXXXXXXXXXIADLYEG------------------------ 98
           N EDG                          D+Y+G                        
Sbjct: 54  NVEDGHAPSSDALEPESGLTD----------DVYDGENLEVSFDVGDAEDDCLPTQADGK 103

Query: 99  AEELE-------EQNKERVRLPLSKKTSSASQEKTQV-----IPWAPTVE-GVENNVEQG 145
            E++E       E+   R+++PL           TQV     +   PT +   E+   Q 
Sbjct: 104 PEQIEVNVGTAPEEPFSRIKIPLKLSDGGIFSPSTQVDDEMAMQLQPTQKLPPESPALQA 163

Query: 146 TDIHEEKTQQVPNEISYDQKTQAIQSFQQTEVEPLTQRISEPERTLDVPTYAATSEDQLD 205
            D H E   ++   ++ D +     S  QT+V  ++     P R  D     AT +D + 
Sbjct: 164 VDTHTELQDELETGVAVDGRI----SLSQTQV-IVSGTNYGPTRVDD--EVVATQQDSMG 216

Query: 206 TQE-QNPITQ-LDISNSLLFQATDSD---IPKSPPQRLKMHDIEKELEEKRQERDHRRNI 260
           T + Q   TQ LD + +  FQAT  D   +  +  ++L +H IE+E+  K Q+       
Sbjct: 217 TADAQCWDTQTLDCALADDFQATIPDAQTLATARHEKLFIHQIEEEIATKTQKELPMMTQ 276

Query: 261 EYRAPEKPVNVKRVFSKEAFLKNFXXXXXXXXXX----XXXXXXDIEKKHTEKD-KSTLE 315
              AP  P   K VF+K+ FL +F                      +++HTE   +S+  
Sbjct: 277 AKEAPYIPKQ-KLVFTKDNFLDSFDDDSETEIHGGLDGSDRQVSYNDREHTETGPQSSQP 335

Query: 316 NTTESSQRQRVFSVYEYKLKGELDSKRCIQLXXXXXXXXXXXXXPLSRVSKATVLDIKAR 375
            T E    Q ++   +         +   Q+               S VSKA VL IKAR
Sbjct: 336 ATGEGQDTQVLYPALQSLSITSKSYQEARQIILDESSEDDTDVNLSSAVSKAAVLAIKAR 395

Query: 376 RSKQEPLSKIKQKKTT-LNDLICTLKKASKKQITDHQNELMKSRGYKLEDIEKQKEEIEN 434
            SK     KI + K++  N+L   L+KA+++Q+ + +   ++ RG  ++++E+++E++ N
Sbjct: 396 NSKFITPQKIDETKSSKSNELFAKLRKANREQLLEQRRNAIERRGINMQNLEQEREQLGN 455

Query: 435 LLEQEI 440
           LLEQE+
Sbjct: 456 LLEQEL 461

>Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON}
            similar to Ashbya gossypii AFR745W
          Length = 1118

 Score =  145 bits (365), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 107/344 (31%), Positives = 166/344 (48%), Gaps = 26/344 (7%)

Query: 615  QRLKDMKAKGLNKMLXXXXXXXXXXWKGVGGVXXXXXXXXXXXXXXMIDDFTKSNENFDD 674
            Q+ K+M+  G+NKM+          W GVGGV              MIDD+ K+  +  +
Sbjct: 772  QKQKEMRKLGVNKMVELEADESEDEWHGVGGVDYEASDEYDSDLDKMIDDYNKNEFDPVE 831

Query: 675  VRQLLAKENKELDEKMVNKILYDIKNGGFRKRGRNAXXXXXXXXXXXXXRNYRLKRRELM 734
            +R++LA E+ + D+ MVNKIL+DIK GGFRKRGR               ++YR KR    
Sbjct: 832  IRKILASEDLQHDKNMVNKILHDIKTGGFRKRGRGELDLELSEDEDGILQSYRAKRWNEQ 891

Query: 735  KKSRIEGKDKEKAFRNAKSKAFLESMVDDID-ESKNPFGDPEMDVEDNTDV-DTQENDYP 792
            K+  ++ +       N KS  F ESMVD+     +   G P+     +T+V + ++N   
Sbjct: 892  KQKMLDSEHNTSVKSNPKSLPFFESMVDEFTIPVERALGTPDSPPAQSTNVLELKQN--- 948

Query: 793  KNKEKNTLSQEFVQXXXXXXXXXXXXXXXXXGEQI--------TLGDEEQDVSSLKRNSS 844
              K+K  +S+ FV+                    +            E +D+ +LK  S+
Sbjct: 949  -TKQKIVISEHFVKQTLSFLTSDENMTNMRSEINVEKPNNDNDIYSSEVEDLYTLKETST 1007

Query: 845  IHALHN-SSSPIKEDLEKENQDEDFITLPNFKPPSLIKSLAGGFDPNNKFQSGKKTVTVS 903
            I  L+  S  PI       N+DED      FK PS++++     D N+KF+ G K+V +S
Sbjct: 1008 IKVLNTYSGKPIV------NEDEDGAEF-GFKAPSVMQTFGSRNDVNDKFKDGFKSVKIS 1060

Query: 904  KSYRAVGGSRSSITYFGKMRKLVGPKNRNSTLSKGPRPASKPTM 947
              Y+ +G SR++IT+ GK RKL+ PK      SK PR ++  ++
Sbjct: 1061 NKYKTLGSSRAAITFLGKKRKLIIPKRS----SKSPRDSAHRSI 1100

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/88 (46%), Positives = 62/88 (70%), Gaps = 3/88 (3%)

Query: 362 SRVSKATVLDIKARRSKQEPLSKIKQKKT---TLNDLICTLKKASKKQITDHQNELMKSR 418
           S + KA +L+IKA+ SK   LSK  ++     TL  L  +LKKA+KKQI DH+ E+ + R
Sbjct: 439 STMVKAALLNIKAKISKNMNLSKNAEQSINSPTLKQLFISLKKANKKQILDHRREITEKR 498

Query: 419 GYKLEDIEKQKEEIENLLEQEIARNKRL 446
           G  LE +E+++E++E+LLEQ+I RN+R+
Sbjct: 499 GISLEQLEQEREKVEDLLEQKIKRNRRI 526

>TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_1.5
            YCL061C
          Length = 1252

 Score =  141 bits (356), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 90/250 (36%), Positives = 124/250 (49%), Gaps = 19/250 (7%)

Query: 541  LPAEDSDSEHDDTLPR-------NIIDLGPYGNNLQV-------NHEEDMENLPLXXXXX 586
            L  E+SDSE+D+ L         NII+LG YG+NL         N ++ +E++       
Sbjct: 770  LVTEESDSENDNPLESEKIPINPNIINLGHYGDNLDSKSTIFNENSKKFIEDIEQFEADN 829

Query: 587  XXXXXXXKTNELXXXXXXXX-----XXXXXXXXQRLKDMKAKGLNKMLXXXXXXXXXXWK 641
                   + NEL                      +L+++K  G +KM           W 
Sbjct: 830  STENSNNELNELEYKRHIKQELEKQKLKEAKKKAKLRELKKVGASKMFDMEAEESEDEWF 889

Query: 642  GVGGVXXXXXXXXXXXXXXMIDDFTKSNENFDDVRQLLAKENKELDEKMVNKILYDIKNG 701
            G+GG               +IDD+++ + N D++R  L  ENKE+D KMVN+ILYDIKNG
Sbjct: 890  GIGGADGEVSDEYDSEVEKLIDDYSRQDFNPDEIRNKLMNENKEMDIKMVNRILYDIKNG 949

Query: 702  GFRKRGRNAXXXXXXXXXXXXXRNYRLKRRELMKKSRIEGKDKEKAFRNAKSKAFLESMV 761
            GFRKR RN              R YR+KRRE+MKK R+E  + +K  + +KSKAF  SMV
Sbjct: 950  GFRKRNRNNIDLELSDDEDDELREYRIKRREIMKKKRLEVTNTDKILKTSKSKAFFMSMV 1009

Query: 762  DDIDESKNPF 771
            DDI E+ NPF
Sbjct: 1010 DDIVETSNPF 1019

 Score = 84.7 bits (208), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 81/137 (59%), Gaps = 1/137 (0%)

Query: 310 DKSTLENTTESSQRQRVFSVYEYKLKGELDSKRCIQLXXXXXXXXXXXXXPLSRVSKATV 369
           +K  L+N     +R+ + S YE +LK  L     I L               S  SKA +
Sbjct: 563 NKVQLKNVIAKPKRKVILSQYENRLKENLLYNNSIDLYSDSEENTQSDIL-FSTASKAQI 621

Query: 370 LDIKARRSKQEPLSKIKQKKTTLNDLICTLKKASKKQITDHQNELMKSRGYKLEDIEKQK 429
           LDI+ + SK++P  K K  +T L+ L   LKKASKKQI DHQ   ++S+G KLED++K+K
Sbjct: 622 LDIRHKLSKKKPQVKKKTIQTNLDQLFNKLKKASKKQIFDHQKNAIESKGLKLEDLKKEK 681

Query: 430 EEIENLLEQEIARNKRL 446
           E +ENLLEQEI RN+++
Sbjct: 682 EIVENLLEQEIERNRKI 698

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/54 (55%), Positives = 38/54 (70%), Gaps = 1/54 (1%)

Query: 875  KPPSLIKSLAGGFDPNNKFQSGKKTVTVSKSYRAVGGSRSSITYFGKMRKLVGP 928
            K PS+IK      D N+KF+ G KTVT+S SY+ VGG ++SIT FG+ RKLV P
Sbjct: 1167 KAPSIIKIFGSTHDINDKFKDGNKTVTISNSYKTVGGMKTSITSFGR-RKLVAP 1219

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 37/64 (57%), Gaps = 3/64 (4%)

Query: 1  MDSLLEKLDPLSSKRRTTYKKVFEPQEEE---ETQQISNSPPPPILGNGFLFQNSTIDKV 57
          MD++ + LD L  K+RTTYKKV E    E       ISN  P   L  GFLF N  ++K+
Sbjct: 3  MDAVFDSLDELKIKKRTTYKKVPEQVATELDKAATTISNPVPSFNLSEGFLFANDKLEKI 62

Query: 58 RNRL 61
          +NRL
Sbjct: 63 KNRL 66

>KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON}
           weakly similar to uniprot|P25588 Saccharomyces
           cerevisiae YCL061C MRC1 S-phase checkpoint protein found
           at replication forks required for DNA replication also
           required for Rad53p activation during DNA replication
           stress where it forms a replication-pausing complex with
           Tof1p and is phosphorylated by Mec1p protein involved in
           replication checkpoint
          Length = 993

 Score =  136 bits (343), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 142/485 (29%), Positives = 201/485 (41%), Gaps = 74/485 (15%)

Query: 530 IQKGRTKNHKMLPAEDSDSEHDDTL-PRNIIDLGPYGNNL----QVNHEEDME------- 577
           I+K   + HK     D+D E    L   NIIDLG YG+N+    Q+  E+  E       
Sbjct: 529 IRKSGLRKHKKFCLIDTDEEDGSVLNSGNIIDLGAYGSNIGNLNQIEQEQVGEHVGAHIE 588

Query: 578 ----------NLPLXXXXXXXXXXXXKTNELXXXXXXXXXXXXXXXXQRLKDMKAKGLN- 626
                     NL               ++E                 + L++ K + L+ 
Sbjct: 589 NDLTTTGRNKNLIKPSSRSSSFQVEDNSHEDMNPGVIRELIEKHKRKELLREAKLEKLHQ 648

Query: 627 ----KMLXXXXXXXXXXWKGVGGVXXXXXXXXXXXXXXMIDDFTKSNENFDDVRQLLAKE 682
               +++          W G+GGV              MIDD++ S  +  +VR+   +E
Sbjct: 649 SKASRIIDYEAEESDDEWHGIGGVDGERFDDHDSDLEKMIDDYSNSRFDSSEVRKRQIEE 708

Query: 683 NKELDEKMVNKILYDIKNGGFRKRGRNAXXXXXXXXXXXXXRNYRLKRRELMK-KSRIEG 741
               D+ MVNKIL+DI+ GGFRKRGRNA               Y  +R+EL++ K   +G
Sbjct: 709 EISEDKSMVNKILHDIETGGFRKRGRNALDLELSDDDDEELLKYHSRRKELLRQKVSAQG 768

Query: 742 KDKEKAFRNAKSKAFLESMVDDI-------DESKNP---FGDPEMDVEDNTDVDTQENDY 791
           + K  A  N KSKAF E++V+DI       DE   P   F       E N+D D      
Sbjct: 769 EAKLLA-ENPKSKAFFETIVEDIRSKGALEDEGPPPVRGFSSVNAPEEKNSDSD------ 821

Query: 792 PKNKEKNTLSQEFVQXXXXXXXXXXXXXXXXXGEQITLG-----------DEEQDVSSLK 840
            K  +K  LS+ FVQ                 G +  LG           +E QD+ +LK
Sbjct: 822 -KKGKKTVLSEAFVQ--QTLSFLTSGEVGEEKGPENNLGSLPTHVPSFNTEETQDIFALK 878

Query: 841 RNSSIHAL----HNSSSPIKEDLEKENQDEDFITLPNFKPPSLIKSLAGGFDPNNKFQSG 896
           +NSSI +L     NSS+ + +D E          L   +  S         D N KF+ G
Sbjct: 879 QNSSIKSLSAPTRNSSNMLIDDQED--------LLSRKRACSFFARFTKRVDANEKFEEG 930

Query: 897 KKTVTVSKSYRAVGGSRSSITYFGKMRKLVGPKNRNSTLSKGPRPASKPTMG-KLWESQQ 955
           KKTV    SY+  G S++SITY GK RKL  PK      S+  +   KP  G  ++ S  
Sbjct: 931 KKTVRSLNSYKVAGSSKASITYLGKARKLNAPKKVAHQQSR--KRGHKPAAGFGIFASNS 988

Query: 956 NSFDT 960
            SF++
Sbjct: 989 ESFES 993

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 56/86 (65%), Gaps = 5/86 (5%)

Query: 366 KATVLDIKARRSKQE-----PLSKIKQKKTTLNDLICTLKKASKKQITDHQNELMKSRGY 420
           KA +LD+KAR SK+      P SK+    ++   L  +L+KA+K QI D++ E  +S+G 
Sbjct: 360 KAAILDLKARLSKKSQSLLIPRSKVTSNFSSHQILFASLRKANKSQILDYRKEKYQSKGI 419

Query: 421 KLEDIEKQKEEIENLLEQEIARNKRL 446
             + I ++K  IE+LLE+E+ARNK++
Sbjct: 420 DYDKITEEKNSIESLLERELARNKKI 445

>Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON}
           YCL061C (MRC1) - protein involved in replication
           checkpoint [contig 123] FULL
          Length = 970

 Score =  114 bits (284), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 93/350 (26%), Positives = 155/350 (44%), Gaps = 26/350 (7%)

Query: 616 RLKDMKAKGLNKMLXXXXXXXXXXWKGVGGVXXXXXXXXXXXXXXMIDDFTKSNENFDDV 675
           ++K++     N M+          W GVGG               MIDD++ +  + + +
Sbjct: 626 KMKELNRSKANGMIDFEAEESDDEWFGVGGADGENSDGYDSELDRMIDDYSNTKSDPEFL 685

Query: 676 RQLLAKENKELDEKMVNKILYDIKNGGFRKRGRNAXXXXXXXXXXXXXRNYRLKRRELMK 735
           R+ L +E K  D+ MV++IL+DI+NGGFRKRGR A               Y  +R+EL+ 
Sbjct: 686 RKKLMEEEKLHDKDMVDRILHDIENGGFRKRGRYAMDLTLSDDEDDDLLRYHARRKELLN 745

Query: 736 KSRIEGKDKEKAFRNAKSKAFLESMVDDIDESKNPFGDPEMDVEDNTDVDTQENDYPKNK 795
           + +   ++      N KSKAF +S+ +  D+ K    + + + + +        D    K
Sbjct: 746 ERKSGNQEISVLATNPKSKAFFDSIFE--DDLKGGIANLK-EYQSHASPLKAAKDEISGK 802

Query: 796 EKNTLSQEFVQXXXXXXXXXXXXXXXXXGEQITLGD----------EEQDVSSLKRNSSI 845
            +  +S++FVQ                  E +++ D          E  D   LK+ S I
Sbjct: 803 RETRISEQFVQ--KTLSFLKSKEDEQGDAEFVSVADTQESSSGDFAEATDFYRLKQLSGI 860

Query: 846 HALHNSSSPIKEDLEKENQDEDFITLPNFKPPSLIKSLAGGFDPNNKFQSGKKTVTVSKS 905
            +    S+P++  +  + +++D + L      +L++      D N KF+ G+KTV    S
Sbjct: 861 KSF---SAPLRSSIRLQVRNKDGV-LSGKANTTLVERFVRSVDTNEKFEEGRKTVKSLNS 916

Query: 906 YRAVGGSRSSITYFGKMRKLVGPKNRNSTLSKGPRPASKPTMGKLWESQQ 955
           Y+  G SR+SIT+ GK R L   K       +GP   S P   K+  S Q
Sbjct: 917 YKIAGSSRASITFLGKARSLKARK-------RGPHARSAPHGQKIMTSHQ 959

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 38/87 (43%), Positives = 61/87 (70%), Gaps = 5/87 (5%)

Query: 365 SKATVLDIKARRSKQ-EPLSKIKQKKT----TLNDLICTLKKASKKQITDHQNELMKSRG 419
           SKA +LD+KAR SK+ + L+    K+T    +L  L  +L+KA++ Q+ +H+N L+  RG
Sbjct: 338 SKAAILDLKARMSKKKQSLAVTSSKETMPSASLRHLFSSLRKANRDQLVEHRNGLLLLRG 397

Query: 420 YKLEDIEKQKEEIENLLEQEIARNKRL 446
             L +I K+KE +E+LLE+E+ARNK++
Sbjct: 398 VDLAEIAKEKESVESLLERELARNKKV 424

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.127    0.344 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 88,392,049
Number of extensions: 3785156
Number of successful extensions: 18507
Number of sequences better than 10.0: 158
Number of HSP's gapped: 19224
Number of HSP's successfully gapped: 211
Length of query: 960
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 841
Effective length of database: 39,836,145
Effective search space: 33502197945
Effective search space used: 33502197945
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 71 (32.0 bits)