Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F18458g1.6ON31431414450.0
CAGL0B00352g1.6ON33731312491e-173
Smik_3.151.6ON31631212391e-172
NCAS0B091001.6ON32731312391e-172
YCL059C (KRR1)1.6ON31631212371e-172
TDEL0C069601.6ON35031312381e-172
KNAG0C002301.6ON34931012361e-171
Skud_3.41.6ON31631512321e-171
NDAI0A001501.6ON31731312321e-171
Suva_3.1531.6ON31631212221e-170
SAKL0C00484g1.6ON33931412241e-170
Kpol_2002.91.6ON33831312231e-169
KAFR0D001501.6ON34427112211e-169
TBLA0A049401.6ON31631312161e-169
KLLA0C00506g1.6ON33031012151e-168
Ecym_10091.6ON33631312121e-168
KLTH0F00506g1.6ON33231412041e-167
TPHA0E040001.6ON31631311991e-166
Kwal_33.130111.6ON33431111921e-165
AFR744W1.6ON34331011751e-162
NCAS0A119605.482ON270193880.014
AAR002W1.420ON178147850.019
SAKL0G03740g5.482ON266146830.048
Kpol_543.135.482ON268146830.054
Suva_8.1975.482ON274148820.072
Ecym_45525.482ON271146820.073
ZYRO0D11440g5.482ON269176820.081
Kwal_47.188645.482ON271146820.081
KLTH0G02574g5.482ON271146810.091
TDEL0A034605.482ON272146810.11
CAGL0K09460g5.482ON261146790.15
KNAG0C046105.482ON277176790.16
Skud_15.3105.482ON276176790.19
TPHA0J028205.482ON268146790.19
KLLA0C06446g5.482ON274146770.28
YOR145C (PNO1)5.482ON274148770.31
Smik_15.3265.482ON274148760.43
KAFR0E036005.482ON276146760.43
NDAI0A043105.482ON274146750.59
Smik_4.4128.361ON50668750.70
NCAS0C050301.420ON187121711.1
KAFR0B030308.309ON46754721.4
KLTH0E14014g8.798ON48695702.7
AGL183C8.309ON50724702.8
TBLA0D018905.482ON271146692.9
KNAG0G023508.309ON49735693.3
Kpol_1036.608.309ON49424684.9
TBLA0E020007.316ON301128666.8
TDEL0B058601.420ON18324648.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F18458g
         (314 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highl...   561   0.0  
CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON...   485   e-173
Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON} YC...   481   e-172
NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1....   481   e-172
YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}  KRR...   481   e-172
TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1...   481   e-172
KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}...   480   e-171
Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON} YCL...   479   e-171
NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON} ...   479   e-171
Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}...   475   e-170
SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON...   476   e-170
Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON...   475   e-169
KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}...   474   e-169
TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {...   473   e-169
KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}...   472   e-168
Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON} s...   471   e-168
KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}...   468   e-167
TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6 ...   466   e-166
Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON...   463   e-165
AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic ...   457   e-162
NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {...    39   0.014
AAR002W Chr1 (341790..342326) [537 bp, 178 aa] {ON} Syntenic hom...    37   0.019
SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {O...    37   0.048
Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON} ...    37   0.054
Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}...    36   0.072
Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar ...    36   0.073
ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {O...    36   0.081
Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR14...    36   0.081
KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {O...    36   0.091
TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON...    36   0.11 
CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {...    35   0.15 
KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.48...    35   0.16 
Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {O...    35   0.19 
TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {O...    35   0.19 
KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {O...    34   0.28 
YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}  ...    34   0.31 
Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {O...    34   0.43 
KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.48...    34   0.43 
NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.48...    33   0.59 
Smik_4.412 Chr4 (748318..749838) [1521 bp, 506 aa] {ON} YDR168W ...    33   0.70 
NCAS0C05030 Chr3 (1022377..1022940) [564 bp, 187 aa] {ON} Anc_1....    32   1.1  
KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.3...    32   1.4  
KLTH0E14014g Chr5 (1239444..1240904) [1461 bp, 486 aa] {ON} simi...    32   2.7  
AGL183C Chr7 complement(352996..354519) [1524 bp, 507 aa] {ON} S...    32   2.8  
TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.48...    31   2.9  
KNAG0G02350 Chr7 (542717..544210) [1494 bp, 497 aa] {ON} Anc_8.3...    31   3.3  
Kpol_1036.60 s1036 (169585..171069) [1485 bp, 494 aa] {ON} (1695...    31   4.9  
TBLA0E02000 Chr5 (487674..488579) [906 bp, 301 aa] {ON} Anc_7.31...    30   6.8  
TDEL0B05860 Chr2 complement(1040386..1040937) [552 bp, 183 aa] {...    29   8.6  

>ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highly
           similar to uniprot|P25586 Saccharomyces cerevisiae
           YCL059C KRR1 Essential nucleolar protein required for
           the synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 314

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/314 (87%), Positives = 274/314 (87%)

Query: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV
Sbjct: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120
           TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN
Sbjct: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120

Query: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180
           TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL
Sbjct: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180

Query: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVARXXXXXX 240
           KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVAR      
Sbjct: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVARKKPMKI 240

Query: 241 XXXXXVYTPFPPAQTPRKVDLEIESGEYFLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                VYTPFPPAQTPRKVDLEIESGEYFLN                             
Sbjct: 241 RKEKKVYTPFPPAQTPRKVDLEIESGEYFLNKREKEAKKLEERREKQAEKQEERQKERRK 300

Query: 301 DFLPPKEEDYKKSK 314
           DFLPPKEEDYKKSK
Sbjct: 301 DFLPPKEEDYKKSK 314

>CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059c KRR1
          Length = 337

 Score =  485 bits (1249), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 236/313 (75%), Positives = 255/313 (81%)

Query: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVST+NKDKPWDT +IDKW  +EFK EDN SG PFAEESSFMTLFPKYREAYLKSIWNDV
Sbjct: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120
           T+AL+K+H+ C LDLVEGSMTVKTTRKT DPAIILKARDLIKLLARSVPFPQAVKIL+D+
Sbjct: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180
            ACDVIKIGNTVANK+RF KRRQRLVGPNGNTLKALELLTKCYILVQGNTV+AMG YKGL
Sbjct: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVARXXXXXX 240
           KE+RRVV D MKN+HPIYHIKELMIKRELAKRPELANEDWSRFLP FKKRNVAR      
Sbjct: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPSKV 240

Query: 241 XXXXXVYTPFPPAQTPRKVDLEIESGEYFLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                VYTPFPPAQ PRKVDL+IESGEYFL+                             
Sbjct: 241 KAEKKVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERRK 300

Query: 301 DFLPPKEEDYKKS 313
           D++ PKE++YK S
Sbjct: 301 DYIAPKEDEYKSS 313

>Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  481 bits (1239), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 238/312 (76%), Positives = 256/312 (82%), Gaps = 1/312 (0%)

Query: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVSTHN+DKPWDT +IDKW  +EFKEEDNASG PFAEESSFMTLFPKYRE+YLK+IWNDV
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120
           T+AL+K+++ACVLDLVEGSMTVKTTRKT DPAIILKARDLIKLLARSVPFPQAVKIL+D+
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180
            ACDVIKIGN V NKERF KRRQRLVGPNGNTLKALELLTKCYILVQGNTV+AMG +KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVARXX-XXX 239
           KEVRRVVED MKN+HPIYHIKELMIKRELAKRPELANEDWSRFLP FKKRNVAR      
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXVYTPFPPAQTPRKVDLEIESGEYFLNXXXXXXXXXXXXXXXXXXXXXXXXXXXX 299
                 VYTPFPPAQ PRKVDLEIESGEYFL+                            
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLSEQKEKQMEREIERQEERA 300

Query: 300 XDFLPPKEEDYK 311
            DF+ P+EE YK
Sbjct: 301 KDFIAPEEETYK 312

>NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1.6
           YCL059C
          Length = 327

 Score =  481 bits (1239), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 233/313 (74%), Positives = 255/313 (81%)

Query: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVSTHN+DKPWDT ++DKWH +EFK EDNASGLPFAEESSFMTLFPKYRE YLKS+WNDV
Sbjct: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120
           T+ALNK+++ CVLDLVEGSMTVKTTRKT DPAIILKARDLIKLLARSVPFPQAVKIL+D+
Sbjct: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180
            ACDVIKIGN V NKERF KRRQRLVGPNGNTLKALELLTKCYILVQGNTV+ MG ++GL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180

Query: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVARXXXXXX 240
           KEVRRVVED MKN+HPIYHIKELMIKRELAK+PELANEDWSRFLP FKKRNVAR      
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKV 240

Query: 241 XXXXXVYTPFPPAQTPRKVDLEIESGEYFLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                +YTPFPPAQ PRKVDLEIESGEYFL+                             
Sbjct: 241 RKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHERREQQAEKQAEKEVERNK 300

Query: 301 DFLPPKEEDYKKS 313
           +++ P+EE YK S
Sbjct: 301 NYIAPEEETYKSS 313

>YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}
           KRR1Essential nucleolar protein required for the
           synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 316

 Score =  481 bits (1237), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 239/312 (76%), Positives = 256/312 (82%), Gaps = 1/312 (0%)

Query: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVSTHN+DKPWDT +IDKW  +EFKEEDNASG PFAEESSFMTLFPKYRE+YLK+IWNDV
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120
           T+AL+K+++ACVLDLVEGSMTVKTTRKT DPAIILKARDLIKLLARSVPFPQAVKIL+D+
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180
            ACDVIKIGN V NKERF KRRQRLVGPNGNTLKALELLTKCYILVQGNTV+AMG +KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVARXX-XXX 239
           KEVRRVVED MKNIHPIYHIKELMIKRELAKRPELANEDWSRFLP FKKRNVAR      
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXVYTPFPPAQTPRKVDLEIESGEYFLNXXXXXXXXXXXXXXXXXXXXXXXXXXXX 299
                 VYTPFPPAQ PRKVDLEIESGEYFL+                            
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA 300

Query: 300 XDFLPPKEEDYK 311
            DF+ P+EE YK
Sbjct: 301 KDFIAPEEEAYK 312

>TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1.6
           YCL059C
          Length = 350

 Score =  481 bits (1238), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 235/313 (75%), Positives = 253/313 (80%)

Query: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVSTHN+DKPWDT +IDKW  +EFK EDNASGLPFAEESSFMTLFPKYRE YLKSIWNDV
Sbjct: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60

Query: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120
           T+ALN +H+ACVLDL+EGSMTVKTTRKT DPAIIL+ARDLIKLLARSVPF QAVKILE++
Sbjct: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120

Query: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180
            ACDVIKIGN VANKERF KRRQRLVGPNGNTLKALELLTKCYILVQGNTV+ MG YKGL
Sbjct: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVARXXXXXX 240
           KEVRRVVEDTM+N+HPIY IKELMIKRELAKRPELA EDWSRFLP FKKRNVAR      
Sbjct: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXVYTPFPPAQTPRKVDLEIESGEYFLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                VYTPFPPAQ PRK+DLEIESGEYFL+                             
Sbjct: 241 RAEKKVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLKERREKQAEKQEEKEEARSK 300

Query: 301 DFLPPKEEDYKKS 313
           D++ PKE+ YK S
Sbjct: 301 DYIAPKEDVYKSS 313

>KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}
           Anc_1.6 YCL059C
          Length = 349

 Score =  480 bits (1236), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 234/310 (75%), Positives = 250/310 (80%)

Query: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVSTHNKDKPWDT +IDKWH +EFK EDNASG PFAEESSFMTLFPKYRE YLKS+W DV
Sbjct: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60

Query: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120
           TKAL+ +H+AC LDLVEGSMTVKTTRKT DPAIILKARDLIKLLARSVPFPQAVKIL+++
Sbjct: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120

Query: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180
           TACDVIKIGN V NKERF KRRQRLVGP+GNTLKALELLTKCYILVQGNTV+AMG YKGL
Sbjct: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVARXXXXXX 240
           KE+RRVVED M N+HPIYHIKELMIKRELAK+PELANEDWSRFLP FKKRNVAR      
Sbjct: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXVYTPFPPAQTPRKVDLEIESGEYFLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                VYTPFPPAQ PRKVDLEIESGEYFLN                             
Sbjct: 241 KKEKKVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERRK 300

Query: 301 DFLPPKEEDY 310
           D+  PKE+ Y
Sbjct: 301 DYTAPKEKAY 310

>Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  479 bits (1232), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 239/315 (75%), Positives = 255/315 (80%), Gaps = 1/315 (0%)

Query: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVSTHN++KPWDT +IDKW  +EFKEEDN SG PFAEESSFMTLFPKYRE YLK+IWNDV
Sbjct: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60

Query: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120
           T+AL+K+++ACVLDLVEGSMTVKTTRKT DPAIILKARDLIKLLARSVPFPQAVKIL+D+
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180
            ACDVIKIGN V NKERF KRRQRLVGPNGNTLKALELLTKCYILVQGNTV+AMG +KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVARXX-XXX 239
           KEVRRVVED MKNIHPIYHIKELMIKRELAKRPELANEDWSRFLP FKKRNVAR      
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXVYTPFPPAQTPRKVDLEIESGEYFLNXXXXXXXXXXXXXXXXXXXXXXXXXXXX 299
                 VYTPFPPAQ PRKVDLEIESGEYFL+                            
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNEQKEKQMERELERQEERA 300

Query: 300 XDFLPPKEEDYKKSK 314
            DF  P+EE YK SK
Sbjct: 301 KDFTAPEEESYKPSK 315

>NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON}
           Anc_1.6 YCL059C
          Length = 317

 Score =  479 bits (1232), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 236/313 (75%), Positives = 252/313 (80%)

Query: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVSTHN+DKPWDT EI+KW  +EFK EDNASGLPFAEESSFMTLFPKYRE YLKS+WNDV
Sbjct: 1   MVSTHNRDKPWDTEEINKWKIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120
           T+ALN +++ACVLDLVEGSMTVKTTRKT DPAIILKARDLIKLLARSVPFPQAVKILED+
Sbjct: 61  TRALNTHNLACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180
            ACDVIKIGN V NKERF KRRQRLVGPNGNTLKALELLTKCYILVQGNTV+ MG +KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVARXXXXXX 240
           KEVRRVVED MKNIHPIYHIKELMIKRELAK+PELANEDWSRFLP FKKRNVAR      
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKV 240

Query: 241 XXXXXVYTPFPPAQTPRKVDLEIESGEYFLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                +YTPFPPAQ PRKVDLEIESGEYFL+                             
Sbjct: 241 KKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLNERREQQAEKQVEKETERNK 300

Query: 301 DFLPPKEEDYKKS 313
           D++ P E  YK S
Sbjct: 301 DYVAPSEPTYKSS 313

>Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  475 bits (1222), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 235/312 (75%), Positives = 255/312 (81%), Gaps = 1/312 (0%)

Query: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVSTHN+DKPWDT ++DKW  +EFKEEDNASG PFAEESSFMTLFPKYRE YLK+IWNDV
Sbjct: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60

Query: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120
           T+AL+K++++CVLDLVEGSMTVKTTRKT DPAIILKARDLIKLLARSVPFPQAVKIL+D+
Sbjct: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180
            ACDVIKIGN V NKERF KRRQRLVGPNGNTLKALELLTKCYILVQGNTV+AMG +KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVARXX-XXX 239
           KEVRRVVED MKN+HPIYHIKELMIKRELAKRPELANEDWSRFLP FKKRNVAR      
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXVYTPFPPAQTPRKVDLEIESGEYFLNXXXXXXXXXXXXXXXXXXXXXXXXXXXX 299
                 VYTPFPPAQ PRKVDLEIESGEYFL+                            
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREVERQEERA 300

Query: 300 XDFLPPKEEDYK 311
            +F+ P+EE YK
Sbjct: 301 KNFVAPQEEAYK 312

>SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 339

 Score =  476 bits (1224), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 235/314 (74%), Positives = 254/314 (80%), Gaps = 1/314 (0%)

Query: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60
           M STHNKDKPWDT EIDKW  +EFK EDNASGLPFAEESSFMTLFPKYREAYLKS+WNDV
Sbjct: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120
           T+AL+K+H+AC LDLVEGSM+VKTTRKT DPAIILKARDLIKLLARSVPFPQAVKILED+
Sbjct: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180
            ACDVIKIGN V+NKERF KRRQRLVGPNGNTLKALELLTKCYILVQGNTV+AMG +KGL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNV-ARXXXXX 239
           KEVRRVVED MKN+HPIYHIKELMIKRELAKRPELA EDWSRFLP FKKRNV  +     
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKA 240

Query: 240 XXXXXXVYTPFPPAQTPRKVDLEIESGEYFLNXXXXXXXXXXXXXXXXXXXXXXXXXXXX 299
                 VYTPFPPAQ PRKVDLEIESGEYFL+                            
Sbjct: 241 KAKEKKVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLQERRQEQAEKQAQKEEERA 300

Query: 300 XDFLPPKEEDYKKS 313
            D++ P+E +YK +
Sbjct: 301 KDYVAPEEAEYKST 314

>Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON}
           complement(17681..18697) [1017 nt, 339 aa]
          Length = 338

 Score =  475 bits (1223), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 234/313 (74%), Positives = 251/313 (80%)

Query: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVSTHNKDKPWDT +IDKW  +EFK EDNASGLPFAEESSFMTLFPKYRE YLKS+WNDV
Sbjct: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60

Query: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120
           TKAL+K H+AC LDLVEGSMTVKTTRKT DP  ILKARDLIKLLARSVPFPQA+KILED+
Sbjct: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120

Query: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180
            ACDVIKIGN V NKERF KRRQRLVGPNGNTLKALELLTKCYILVQGNTV+ MG +KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180

Query: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVARXXXXXX 240
           KE+RRVVED MKN+HPIYHIKELMIKRELAKRPELA+EDWSRFLP FKKRNVAR      
Sbjct: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFKKRNVARKKAAKP 240

Query: 241 XXXXXVYTPFPPAQTPRKVDLEIESGEYFLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                VYTPFPPAQ PRKVDLEIESGEYFL+                             
Sbjct: 241 KKEKKVYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVKRLQERREEQSQKQIEKEKERSK 300

Query: 301 DFLPPKEEDYKKS 313
           D++ P EE+YK +
Sbjct: 301 DYVAPMEEEYKST 313

>KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}
           Anc_1.6 YCL059C
          Length = 344

 Score =  474 bits (1221), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 228/271 (84%), Positives = 244/271 (90%)

Query: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVST+NK+KPWDT +IDKW  +EFK EDNASGLPFAEESSFMTLFPKYRE+YLKS+W DV
Sbjct: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60

Query: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120
           TKAL K+H+AC+LDLVEGSMTVKTTRKT DPAIILKARDLIKLLARSVPFPQA+KILEDN
Sbjct: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120

Query: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180
            ACDVIKIGN V+NKERF KRRQRLVGPNGNTLKALELLTKCYILVQGNTV+AMG +KGL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVARXXXXXX 240
           KEVRRVVED M N+HPIYHIKELMIKRELAK+PELANEDWSRFLP FKKRNVAR      
Sbjct: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXVYTPFPPAQTPRKVDLEIESGEYFLN 271
                VYTPFPP Q PRKVDLEIESGEYFL+
Sbjct: 241 RKEKKVYTPFPPTQLPRKVDLEIESGEYFLS 271

>TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {ON}
           Anc_1.6 YCL059C
          Length = 316

 Score =  473 bits (1216), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 230/313 (73%), Positives = 251/313 (80%)

Query: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVSTHN+DKPWDT +I+KW   EFK EDNASGLPF EESSFMTLFPKYRE YL+ +W DV
Sbjct: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60

Query: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120
           TK+L+KYHVAC LDL+EGSMTVKTTRKT DPAIILKARDLIKLLARSVP+PQA++IL+D+
Sbjct: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120

Query: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180
            ACDVIKIGN V NKERF KRRQRLVGPNGNTLKALELLTKCYILVQGNTV+AMG +KGL
Sbjct: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVARXXXXXX 240
           KEVRRVVED MKN+HPIYHIKELMIKREL+KRPELANEDWSRFLP FKKRNVAR      
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFKKRNVARKKSKKP 240

Query: 241 XXXXXVYTPFPPAQTPRKVDLEIESGEYFLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                VYTPFPPAQ PRKVDLEIESGEYFL+                             
Sbjct: 241 KKEKKVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEIKKLKERREKQEEKQVEKEKERRK 300

Query: 301 DFLPPKEEDYKKS 313
           DF+ P E++YK S
Sbjct: 301 DFIAPSEKEYKSS 313

>KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 330

 Score =  472 bits (1215), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 232/310 (74%), Positives = 251/310 (80%), Gaps = 1/310 (0%)

Query: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVSTHNKDKPWDT E+DKW+ +EFK EDN SGLPFAEESSFMTLFPKYREAYLKS+W DV
Sbjct: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60

Query: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120
           T++L+ +H+AC L+LVEGSMTVKTTRKT DPA+ILKARDLIKLLARSVPFPQAVKILED+
Sbjct: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180
            ACDVIKIGN V+NKERF KRRQRLVGPNGNTLKALELLTKCYILVQGNTV+ MG YKGL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVARXXXXXX 240
           KEVRRVVED MKN+HPIYHIKELMIKRELAK+PELA EDWSRFLP FKKRNVAR      
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMFKKRNVAR-KKPKK 239

Query: 241 XXXXXVYTPFPPAQTPRKVDLEIESGEYFLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                +YTPFPPAQ PRKVDLEIESGEYFL+                             
Sbjct: 240 IKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERAK 299

Query: 301 DFLPPKEEDY 310
           DF+ PKE DY
Sbjct: 300 DFIAPKETDY 309

>Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON}
           similar to Ashbya gossypii AFR744W
          Length = 336

 Score =  471 bits (1212), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 232/313 (74%), Positives = 255/313 (81%), Gaps = 1/313 (0%)

Query: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVSTHNKDKPWDT +IDKW  +EFK EDNASGLPFAEESSFMTLFPKYREAYLKS WNDV
Sbjct: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60

Query: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120
           T+AL+K+H+AC L+LVEGSMTVKTTRKT DPAIILKARDLIKLLARSVPFPQAVKILED+
Sbjct: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180
            ACDVIKIGN  +NK+RF KRRQRLVGPNGNTLKALELLTKCYILVQGNTV+AMG YKGL
Sbjct: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVARXXXXXX 240
           KEVRRVVED MKN+HPIYHIKELMIKRELAK+PELA++DWSRFLP FKKRN+AR      
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMFKKRNIAR-KKPKK 239

Query: 241 XXXXXVYTPFPPAQTPRKVDLEIESGEYFLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                VYTPFPPAQ PRKVDLEIE+GEYFL+                             
Sbjct: 240 IKEKKVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERAE 299

Query: 301 DFLPPKEEDYKKS 313
           D++ P E++YK +
Sbjct: 300 DYIAPDEKEYKNA 312

>KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 332

 Score =  468 bits (1204), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 231/314 (73%), Positives = 254/314 (80%), Gaps = 1/314 (0%)

Query: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60
           M STHNKDKPWDT +IDKW  +EFK EDN SG+PFAEESSFMTLFPKYREAYLKS+WNDV
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120
           T+AL+K+++ACVLDLVEGSMTVKTTR+T DPAIILKARDLIKLLARSVPFPQAVKIL+D+
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180
           TACDVIKIGN V+NKERF KRRQRLVGPNGNTLKALELLTKCYILVQGNTV+AMG +KGL
Sbjct: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVARXX-XXX 239
           KEVRRVVED M+NIHPIYHIKELMIKRELAKRP+LA EDWSRFLP FKKRNVAR      
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 240 XXXXXXVYTPFPPAQTPRKVDLEIESGEYFLNXXXXXXXXXXXXXXXXXXXXXXXXXXXX 299
                 VYTPFPPAQ PRK+DL+IESGEYFL                             
Sbjct: 241 KPKENKVYTPFPPAQQPRKIDLQIESGEYFLTKKEKEAKKLEERKREQAEKQVEKNKERA 300

Query: 300 XDFLPPKEEDYKKS 313
            D++ P E+ Y+ S
Sbjct: 301 KDYVAPIEKGYEGS 314

>TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6
           YCL059C
          Length = 316

 Score =  466 bits (1199), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 226/313 (72%), Positives = 250/313 (79%)

Query: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVSTHNK+KPWDT +IDKW  ++FK EDNASG+PF+EESSFMTLFPKYRE YLKS+W DV
Sbjct: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120
           TKAL+K+HVAC L+LV+GSMTV TTRKT DP IILKARDLIKLLARSVPFPQAVKIL+D+
Sbjct: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120

Query: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180
            ACDVIKIGN V NKERF KRRQRLVGPNGNTLKALELLTKCYILVQGNTV+ MG +KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVARXXXXXX 240
           KE+RRVVED M+N+HPIYHIKELMIKRELAK+PELANEDWSRFLP FKKRNVAR      
Sbjct: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKSKKP 240

Query: 241 XXXXXVYTPFPPAQTPRKVDLEIESGEYFLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                VYTPFPP+Q PRKVDLEIESGEYFL+                             
Sbjct: 241 KREKKVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERSK 300

Query: 301 DFLPPKEEDYKKS 313
           +++ PKEE Y  S
Sbjct: 301 NYIAPKEEKYVSS 313

>Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON}
           YCL059C (KRR1) - involved in cell division and spore
           germination [contig 123] FULL
          Length = 334

 Score =  463 bits (1192), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 226/311 (72%), Positives = 248/311 (79%), Gaps = 1/311 (0%)

Query: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60
           M STHNKDKPWDT +IDKW  +EFK EDN SGLPF+EESSFMTLFPKYRE YLKS+W DV
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120
           T+AL K+ ++CVLDLVEGSMTVKTTRKT DPAIILKARDLIKLLARSVPFPQAVKIL+D+
Sbjct: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180
            ACDVIKIGN V+NKERF KRRQRLVGPNGNTLKALELL+KCYILVQGNTV+AMG +KGL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVARXX-XXX 239
           KEVRRVVED MKN+HPIYHIKELMIKRELAKRP+LA EDWSRFLP FKKRNVAR      
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 240 XXXXXXVYTPFPPAQTPRKVDLEIESGEYFLNXXXXXXXXXXXXXXXXXXXXXXXXXXXX 299
                 VYTPFPP Q PRKVDL+IESGEYFL+                            
Sbjct: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300

Query: 300 XDFLPPKEEDY 310
            D++ P E++Y
Sbjct: 301 KDYVAPSEKEY 311

>AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL059C (KRR1)
          Length = 343

 Score =  457 bits (1175), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 226/310 (72%), Positives = 247/310 (79%), Gaps = 1/310 (0%)

Query: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVST NKDKPWDT ++DKW  +EF  ED+ASGLPFAEESSFMTLFPKYRE YLKSIW +V
Sbjct: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60

Query: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120
           T+AL K+H+AC L+LVEGSM+VKTTRKT DPAIILKARDLIKLLARSVP PQA+KIL+D+
Sbjct: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120

Query: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180
            ACDVIKIGN VA+KERF KRRQRLVGPNGNTLKALELLTKCYILVQGNTV+AMG YKGL
Sbjct: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVARXXXXXX 240
           KEVRRVVED M+NIHPIYHIKELMIKRELAKRPELA EDWSRFLP FKKRNVAR      
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVAR-KKPKK 239

Query: 241 XXXXXVYTPFPPAQTPRKVDLEIESGEYFLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                VYTPFPPAQ PRKVDLEIE+GEYFL+                             
Sbjct: 240 IKEKKVYTPFPPAQLPRKVDLEIETGEYFLSKKEKEAKKLEARRAQQAEKQSEKEKERAK 299

Query: 301 DFLPPKEEDY 310
           D++ P E +Y
Sbjct: 300 DYIAPAEPEY 309

>NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {ON}
           Anc_5.482 YOR145C
          Length = 270

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 40/193 (20%), Positives = 80/193 (41%), Gaps = 10/193 (5%)

Query: 4   THNKDKPWDTGE-----IDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWN 58
           TH+  +P    E     +D+  +  F   + A G     ES  + + P +R   L++ W 
Sbjct: 52  THDDTQPTQKKEAKGVVLDEEGKPRFSSANKAEGAKVKLESRKVPV-PPHRMTPLRNSWT 110

Query: 59  DVTKAL-NKYHVACVLDLVEGSMTVKTTRK-TCDPAIILKARDLIKLLARSVPFPQAVKI 116
            +   L +   +   ++L   S+ ++T  K T DP  + K  D IK          ++ +
Sbjct: 111 KIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKAFTLGFDLDDSIAL 170

Query: 117 LE-DNTACDVIKIGNT-VANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAM 174
           L  D+   +  +I +      +   +   R+ G +G T  A+E  T+  I++    +  +
Sbjct: 171 LRLDDLYIETFEIKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATRTRIVLADTKIHIL 230

Query: 175 GNYKGLKEVRRVV 187
           G +  ++  R  V
Sbjct: 231 GGFTHIRMAREAV 243

>AAR002W Chr1 (341790..342326) [537 bp, 178 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR003W (MRPL32)
          Length = 178

 Score = 37.4 bits (85), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 61/147 (41%), Gaps = 29/147 (19%)

Query: 54  KSIWNDVTKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQA 113
           +++W +V +AL++   A    L  GS +V            +  R L++LL R+    QA
Sbjct: 4   QAVWGNVGRALSECTAALFPRLELGSGSV------------IAPRTLLELLRRAGGSQQA 51

Query: 114 --VKILEDNTACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTV 171
               +  D     V K       K   QKRRQ+L GP    L+ +  L KC         
Sbjct: 52  GTAAVGADGLVLAVPK------KKVSHQKRRQKLYGPGKKQLQMVHHLGKC--------- 96

Query: 172 AAMGNYKGLKEVRRVVEDTMKNIHPIY 198
            + G+YK L  +       +++I  +Y
Sbjct: 97  PSCGHYKRLNTLCMYCVGEIRHIWKVY 123

>SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 266

 Score = 36.6 bits (83), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 64/146 (43%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSIWNDVTKAL-NKYHVACVLDLVEGSMTVKTTRK-TCDPAIILKARDLIKL 103
           P +R   L++ W  +   L +   +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 94  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 153

Query: 104 LARSVPFPQAVKILE-DNTACDVIKIGNT-VANKERFQKRRQRLVGPNGNTLKALELLTK 161
            A       A+ +L  D+   +  ++ +      +   +   R+ G +G T  A+E  T+
Sbjct: 154 FALGFDLDDAIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 213

Query: 162 CYILVQGNTVAAMGNYKGLKEVRRVV 187
             I++  + +  +G +  ++  R  V
Sbjct: 214 TRIVLADSKIHILGGFTHIRMAREAV 239

>Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON}
           complement(30976..31782) [807 nt, 269 aa]
          Length = 268

 Score = 36.6 bits (83), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 64/146 (43%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSIWNDVTKAL-NKYHVACVLDLVEGSMTVKTTRK-TCDPAIILKARDLIKL 103
           P +R   L++ W  +   L +   +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 96  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKA 155

Query: 104 LARSVPFPQAVKILE-DNTACDVIKIGNT-VANKERFQKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  D+   +  +I +    N +   +   R+ G +G T  A+E  T+
Sbjct: 156 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 215

Query: 162 CYILVQGNTVAAMGNYKGLKEVRRVV 187
             I++  + +  +G +  ++  R  V
Sbjct: 216 TRIVLADSKIHILGGFTHIRMAREAV 241

>Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 36.2 bits (82), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 30/148 (20%), Positives = 66/148 (44%), Gaps = 4/148 (2%)

Query: 44  LFPKYREAYLKSIWNDVTKALNKY-HVACVLDLVEGSMTVKTTRK-TCDPAIILKARDLI 101
           + P +R   L++ W  +   L ++  +   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRLTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILE-DNTACDVIKIGNT-VANKERFQKRRQRLVGPNGNTLKALELL 159
           K  A       ++ +L  D+   +  ++ +      +   +   R+ G +G T  A+E  
Sbjct: 160 KAFALGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVAAMGNYKGLKEVRRVV 187
           T+  I++  + +  +G +  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMAREFV 247

>Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii AFR390C
          Length = 271

 Score = 36.2 bits (82), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 30/146 (20%), Positives = 64/146 (43%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSIWNDVTKAL-NKYHVACVLDLVEGSMTVKTTRK-TCDPAIILKARDLIKL 103
           P +R   L++ W  +   L +   +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTVDPGALQKGADFIKT 158

Query: 104 LARSVPFPQAVKILE-DNTACDVIKIGNT-VANKERFQKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  D+   +  +I +    N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVAAMGNYKGLKEVRRVV 187
             I++  + +  +G +  ++  R  +
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARETI 244

>ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability
          Length = 269

 Score = 36.2 bits (82), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 35/176 (19%), Positives = 76/176 (43%), Gaps = 5/176 (2%)

Query: 16  IDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDVTKALNKY-HVACVLD 74
           +D   +  F     +SG     ES  + + P +R   L++ W  +   L ++  +   ++
Sbjct: 68  LDDQGKPRFGSAKKSSGERVKIESRKVGV-PPHRMTPLRNNWTKIYPPLVEHLKLQVRMN 126

Query: 75  LVEGSMTVKTT-RKTCDPAIILKARDLIKLLARSVPFPQAVKILE-DNTACDVIKIGNT- 131
           L   S+ +++  R+T DP  + K  D IK          ++ +L  D+   +  ++ +  
Sbjct: 127 LKTKSVELRSHPRQTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEVKDVK 186

Query: 132 VANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGLKEVRRVV 187
             N +   +   R+ G +G T  A+E  T+  I++    +  +G +  ++  R  V
Sbjct: 187 TLNGDHLSRAIGRIAGKDGKTKFAIENATRTRIVLADAKIHILGGFTHIRMAREAV 242

>Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR145C
           - Protein required for cell viability [contig 189] FULL
          Length = 271

 Score = 36.2 bits (82), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 64/146 (43%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSIWNDVTKAL-NKYHVACVLDLVEGSMTVKTTRK-TCDPAIILKARDLIKL 103
           P +R   L++ W  +   L +   +   ++L   ++ ++T  K T DP  + K  D IK 
Sbjct: 99  PPHRLTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAVKILE-DNTACDVIKIGNT-VANKERFQKRRQRLVGPNGNTLKALELLTK 161
                    A+ +L  D+   +  +I +    N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVAAMGNYKGLKEVRRVV 187
             I++  + +  +G +  ++  R  V
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESV 244

>KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 271

 Score = 35.8 bits (81), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 64/146 (43%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSIWNDVTKAL-NKYHVACVLDLVEGSMTVKTTRK-TCDPAIILKARDLIKL 103
           P +R   L++ W  +   L +   +   ++L   ++ ++T  K T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAVKILE-DNTACDVIKIGNT-VANKERFQKRRQRLVGPNGNTLKALELLTK 161
                    A+ +L  D+   +  +I +    N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVAAMGNYKGLKEVRRVV 187
             I++  + +  +G +  ++  R  V
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESV 244

>TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON}
           Anc_5.482 YOR145C
          Length = 272

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 65/146 (44%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSIWNDVTKALNKY-HVACVLDLVEGSMTVKTTRK-TCDPAIILKARDLIKL 103
           P +R   L++ W  +   L ++  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 100 PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKA 159

Query: 104 LARSVPFPQAVKILE-DNTACDVIKIGNT-VANKERFQKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  D+   +  +I +    N +   +   R+ G +G T  A+E  T+
Sbjct: 160 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 219

Query: 162 CYILVQGNTVAAMGNYKGLKEVRRVV 187
             I++  + +  +G +  ++  R  V
Sbjct: 220 TRIVLADSKIHILGGFTHIRMAREAV 245

>CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {ON}
           highly similar to uniprot|Q99216 Saccharomyces
           cerevisiae YOR145c
          Length = 261

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 29/146 (19%), Positives = 64/146 (43%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSIWNDVTKAL-NKYHVACVLDLVEGSMTVKTTRK-TCDPAIILKARDLIKL 103
           P +R   L++ WN +   L +   +   ++L   ++ ++T  K T DP  + K  D IK 
Sbjct: 89  PPHRMTPLRNSWNKIYPPLVDHLKLQVRMNLKTRTVELRTHPKHTTDPGALQKGADFIKA 148

Query: 104 LARSVPFPQAVKILE-DNTACDVIKIGNT-VANKERFQKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  D+   +  ++ +      +   +   R+ G +G T  A+E  T+
Sbjct: 149 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 208

Query: 162 CYILVQGNTVAAMGNYKGLKEVRRVV 187
             I++  + +  +G +  ++  R  V
Sbjct: 209 TRIVLADSKIHILGGFTHIRMAREAV 234

>KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.482
           YOR145C
          Length = 277

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 35/176 (19%), Positives = 76/176 (43%), Gaps = 5/176 (2%)

Query: 16  IDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDVTKAL-NKYHVACVLD 74
           +D+  +  F   + AS      ES  + + P +R   L++ W  +   L +   +   ++
Sbjct: 76  LDEQGKPRFSSANKASETKIKAESRKVAV-PPHRMTPLRNNWTKIYPPLVDHLKLQVRMN 134

Query: 75  LVEGSMTVKTTRK-TCDPAIILKARDLIKLLARSVPFPQAVKILE-DNTACDVIKIGNT- 131
           L   S+ ++T  K T DP  + K  D IK          ++ +L  D+   +  ++ +  
Sbjct: 135 LKTKSVELRTHPKHTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEVKDVK 194

Query: 132 VANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGLKEVRRVV 187
             + +   +   R+ G +G T  A+E  T+  I++  + +  +G +  ++  R  V
Sbjct: 195 TLHGDHLSRAIGRIAGKDGKTKFAIENATRTRIVLADSKIHILGGFTHIRMARESV 250

>Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {ON}
           YOR145C (REAL)
          Length = 276

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 34/176 (19%), Positives = 74/176 (42%), Gaps = 5/176 (2%)

Query: 16  IDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDVTKALNKY-HVACVLD 74
           +D   +  F     + G     ES  + + P +R   L++ W  +   L ++  +   ++
Sbjct: 75  VDDQGKPRFSSASRSQGSKIKFESRKI-MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMN 133

Query: 75  LVEGSMTVKTTRK-TCDPAIILKARDLIKLLARSVPFPQAVKILE-DNTACDVIKIGNT- 131
           L   S+ ++T  K T DP  + K  D IK          ++ +L  D+   +  ++ +  
Sbjct: 134 LKTKSVELRTNPKFTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEVKDVK 193

Query: 132 VANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGLKEVRRVV 187
               +   +   R+ G +G T  A+E  T+  I++  + +  +G +  ++  R  V
Sbjct: 194 TLTGDHLSRAIGRIAGKDGKTKFAIENATRTRIVLADSKIHILGGFTHIRMARESV 249

>TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {ON}
           Anc_5.482 YOR145C
          Length = 268

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 30/146 (20%), Positives = 64/146 (43%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSIWNDVTKAL-NKYHVACVLDLVEGSMTVKTTRK-TCDPAIILKARDLIKL 103
           P +R   L++ W+ +   L +   +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 96  PPHRMTPLRNSWSKIYPPLVDHLKLQVRMNLKSKSVELRTHPKHTTDPGALQKGADFIKA 155

Query: 104 LARSVPFPQAVKILE-DNTACDVIKIGNT-VANKERFQKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  D+   +  +I +    + +   +   R+ G +G T  A+E  T+
Sbjct: 156 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLHGDHLSRAIGRIAGKDGKTKFAIENATR 215

Query: 162 CYILVQGNTVAAMGNYKGLKEVRRVV 187
             I++    +  +G +  ++  R  V
Sbjct: 216 TRIVLADTKIHILGGFTHIRMAREAV 241

>KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability,
          Length = 274

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 64/146 (43%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSIWNDVTKAL-NKYHVACVLDLVEGSMTVKTTRK-TCDPAIILKARDLIKL 103
           P +R   LK+ W+ +   L +   +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 102 PPHRMTPLKNNWSKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 161

Query: 104 LARSVPFPQAVKILE-DNTACDVIKIGNT-VANKERFQKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  D+   +  +I +      +   +   R+ G +G T  A+E  T+
Sbjct: 162 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLQGDHLSRAIGRIAGKDGKTKFAIENATR 221

Query: 162 CYILVQGNTVAAMGNYKGLKEVRRVV 187
             I++  + +  +G +  ++  R  V
Sbjct: 222 TRIVLADSKIHILGGFTHIRMARESV 247

>YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}
           PNO1Essential nucleolar protein required for pre-18S
           rRNA processing, interacts with Dim1p, an 18S rRNA
           dimethyltransferase, and also with Nob1p, which is
           involved in proteasome biogenesis; contains a KH domain
          Length = 274

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 29/148 (19%), Positives = 65/148 (43%), Gaps = 4/148 (2%)

Query: 44  LFPKYREAYLKSIWNDVTKALNKY-HVACVLDLVEGSMTVKTTRK-TCDPAIILKARDLI 101
           + P +R   L++ W  +   L ++  +   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILE-DNTACDVIKIGNT-VANKERFQKRRQRLVGPNGNTLKALELL 159
           K          ++ +L  D+   +  ++ +      +   +   R+ G +G T  A+E  
Sbjct: 160 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVAAMGNYKGLKEVRRVV 187
           T+  I++  + +  +G +  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMARESV 247

>Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 33.9 bits (76), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 29/148 (19%), Positives = 65/148 (43%), Gaps = 4/148 (2%)

Query: 44  LFPKYREAYLKSIWNDVTKALNKY-HVACVLDLVEGSMTVKTTRK-TCDPAIILKARDLI 101
           + P +R   L++ W  +   L ++  +   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILE-DNTACDVIKIGNT-VANKERFQKRRQRLVGPNGNTLKALELL 159
           K          ++ +L  D+   +  ++ +      +   +   R+ G +G T  A+E  
Sbjct: 160 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVAAMGNYKGLKEVRRVV 187
           T+  I++  + +  +G +  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMARESV 247

>KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.482
           YOR145C
          Length = 276

 Score = 33.9 bits (76), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 29/146 (19%), Positives = 64/146 (43%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSIWNDVTKALNKY-HVACVLDLVEGSMTVKTTRK-TCDPAIILKARDLIKL 103
           P +R   L++ W  +   L ++  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 104 PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 163

Query: 104 LARSVPFPQAVKILE-DNTACDVIKIGNT-VANKERFQKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  D+   +  ++ +      +   +   R+ G +G T  A+E  T+
Sbjct: 164 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 223

Query: 162 CYILVQGNTVAAMGNYKGLKEVRRVV 187
             I++  + +  +G +  ++  R  V
Sbjct: 224 TRIVLADSKIHILGGFTHIRMAREAV 249

>NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.482
           YOR145C
          Length = 274

 Score = 33.5 bits (75), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 30/146 (20%), Positives = 62/146 (42%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSIWNDVTKAL-NKYHVACVLDLVEGSMTVKTTRK-TCDPAIILKARDLIKL 103
           P +R   L++ W  +   L +   +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 102 PPHRMTPLRNSWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 161

Query: 104 LARSVPFPQAVKILE-DNTACDVIKIGNT-VANKERFQKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  D+   +  +I +      +   +   R+ G +G T  A+E  T+
Sbjct: 162 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 221

Query: 162 CYILVQGNTVAAMGNYKGLKEVRRVV 187
             I++    +  +G +  ++  R  V
Sbjct: 222 TRIVLADTKIHILGGFTHIRMARESV 247

>Smik_4.412 Chr4 (748318..749838) [1521 bp, 506 aa] {ON} YDR168W
           (REAL)
          Length = 506

 Score = 33.5 bits (75), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 1/68 (1%)

Query: 92  AIILKARDLIKLLARSVPFPQAVKILEDNTACDVIKIGNTVANKERFQKRRQRLV-GPNG 150
           AI+ K  D I  +   +P  +A KILE     D+I I   + N++ FQ  + + V G + 
Sbjct: 418 AIMTKNLDNINKVFEDIPIAEAEKILEVFNDIDIIGIKAILENEKDFQSLKDQYVQGHDD 477

Query: 151 NTLKALEL 158
            T++ L L
Sbjct: 478 ATIEGLAL 485

>NCAS0C05030 Chr3 (1022377..1022940) [564 bp, 187 aa] {ON} Anc_1.420
           YCR003W
          Length = 187

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 50/121 (41%), Gaps = 16/121 (13%)

Query: 76  VEGSMTVKTTRK--TCDPAIILKARDLIKLLARSVPFPQAVKILEDNTACDVIKIGNTVA 133
           +EG +++   RK  T  P   L+     KLL      P +  + E NT  D   +     
Sbjct: 18  LEGGLSILLPRKATTTTPGSSLQEWIRRKLLD----GPSSTDVPESNTI-DTGVLKAVPK 72

Query: 134 NKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGLKEVRRVVEDTMKN 193
            K   QK+RQRL GP    LK +  L +C          + G+YK    +     D+++ 
Sbjct: 73  KKVSHQKKRQRLYGPGSKQLKMVHHLNEC---------PSCGHYKRANTLCMYCVDSIRR 123

Query: 194 I 194
           I
Sbjct: 124 I 124

>KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.309
           YLR116W
          Length = 467

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 5/54 (9%)

Query: 145 LVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGLKEVRRVVEDTMKNIHPIY 198
           L+GP GNTL+ L+  +KC I ++G      G+ K  K    + E  M    P++
Sbjct: 151 LLGPRGNTLRKLQEQSKCKIAIRGR-----GSVKEGKHANDLPEGAMNMEDPLH 199

>KLTH0E14014g Chr5 (1239444..1240904) [1461 bp, 486 aa] {ON} similar
           to uniprot|Q12096 Saccharomyces cerevisiae YOR320C GNT1
           N-acetylglucosaminyltransferase capable of modification
           of N-linked glycans in the Golgi apparatus
          Length = 486

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 37/95 (38%), Gaps = 19/95 (20%)

Query: 140 KRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGLKEVRRVVEDTMKNIHPIYH 199
           KRR RLVG  G  +  + L  KC +  Q N        + ++  R        NIH IY 
Sbjct: 6   KRRLRLVGAIGAVVLLISLTAKCVVQFQLN--------REIEHYRTFFRKHKDNIHDIYD 57

Query: 200 -----------IKELMIKRELAKRPELANEDWSRF 223
                      I+ L   R+    P+ +  DW ++
Sbjct: 58  PLNIKQIPYETIESLYQLRKTGDVPKKSPIDWGKY 92

>AGL183C Chr7 complement(352996..354519) [1524 bp, 507 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR116W
           (MSL5)
          Length = 507

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTLK L+  + C I+++G
Sbjct: 169 LLGPRGNTLKQLQQQSGCKIVIRG 192

>TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.482
           YOR145C
          Length = 271

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 28/146 (19%), Positives = 63/146 (43%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSIWNDVTKAL-NKYHVACVLDLVEGSMTVKTTRK-TCDPAIILKARDLIKL 103
           P +R   L++ W  +   L +   +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWPKIYPPLVDHLKLQVRMNLRTKSVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAVKILE-DNTACDVIKIGNT-VANKERFQKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  D+   +  ++ +      +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVAAMGNYKGLKEVRRVV 187
             I++  + +  +G +  ++  R  +
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESI 244

>KNAG0G02350 Chr7 (542717..544210) [1494 bp, 497 aa] {ON} Anc_8.309
           YLR116W
          Length = 497

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 19/35 (54%)

Query: 145 LVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKG 179
           L+GP GNTLK L+  + C I ++G      G   G
Sbjct: 148 LLGPRGNTLKQLQKQSNCKIAIRGRGSVKEGKGSG 182

>Kpol_1036.60 s1036 (169585..171069) [1485 bp, 494 aa] {ON}
           (169585..171069) [1485 nt, 495 aa]
          Length = 494

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTLK L+  ++C I ++G
Sbjct: 152 LLGPRGNTLKKLQEDSQCKIAIRG 175

>TBLA0E02000 Chr5 (487674..488579) [906 bp, 301 aa] {ON} Anc_7.316
           YDL142C
          Length = 301

 Score = 30.0 bits (66), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 56/128 (43%), Gaps = 18/128 (14%)

Query: 56  IWNDVTKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARS-------- 107
           I   +  AL  +  +CV DL++G +  K   +T   +++  A D + +L  +        
Sbjct: 102 IHEQLVSALYLFCYSCVTDLLDGQLARKFNLQTPLGSVLDPAADKLLMLVTTIALTIPSG 161

Query: 108 ---VPFPQAVKILEDNTACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYI 164
              +P P A  IL      D++  GN+  ++    K  QR      +T +  ++ +   I
Sbjct: 162 PCLIPLPIATVILGR----DLVLAGNSFYHR---YKSMQRAYAGGFSTKQFFDIFSYPSI 214

Query: 165 LVQGNTVA 172
           +VQ  T++
Sbjct: 215 VVQPTTIS 222

>TDEL0B05860 Chr2 complement(1040386..1040937) [552 bp, 183 aa] {ON}
           Anc_1.420 YCR003W
          Length = 183

 Score = 29.3 bits (64), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (62%)

Query: 139 QKRRQRLVGPNGNTLKALELLTKC 162
           QK+RQ+L GP    LK +  L KC
Sbjct: 78  QKKRQKLYGPGSKQLKMIHHLNKC 101

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,040,038
Number of extensions: 1208068
Number of successful extensions: 3295
Number of sequences better than 10.0: 55
Number of HSP's gapped: 3340
Number of HSP's successfully gapped: 55
Length of query: 314
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 205
Effective length of database: 40,982,805
Effective search space: 8401475025
Effective search space used: 8401475025
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)