Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F18436g1.7ON1121124969e-66
Kpol_2002.101.7ON1111051703e-16
SAKL0C00506g1.7ON1051111693e-16
NCAS0B090901.7ON119981556e-14
TDEL0C069501.7ON111931391e-11
YCL058W-A (ADF1)1.7ON113911217e-09
Smik_3.161.7ON113911172e-08
TPHA0E039901.7ON116931163e-08
Skud_3.51.7ON113911164e-08
KNAG0C002401.7ON126971156e-08
TBLA0A049501.7ON1131101147e-08
KLTH0F00528g1.7ON104791121e-07
AFR743CA1.7ON1011031084e-07
Suva_3.1541.7ON1131011086e-07
Kwal_YGOB_YCL058W-A1.7ON105941061e-06
Kwal_33.13015singletonOFF105941061e-06
KAFR0D001601.7ON11194921e-04
NDAI0A001601.7ON12390840.002
CAGL0B00374g1.7ON12138720.11
KLLA0C00528g1.7ON11643641.1
Kpol_1028.851.414ON33431615.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F18436g
         (112 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa] ...   195   9e-66
Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON} (19162.....    70   3e-16
SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly si...    70   3e-16
NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {...    64   6e-14
TDEL0C06950 Chr3 complement(1262284..1262619) [336 bp, 111 aa] {...    58   1e-11
YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}  ADF1Transcr...    51   7e-09
Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A (R...    50   2e-08
TPHA0E03990 Chr5 complement(837690..838040) [351 bp, 116 aa] {ON...    49   3e-08
Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)    49   4e-08
KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7 YC...    49   6e-08
TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1....    49   7e-08
KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved...    48   1e-07
AFR743CA Chr6 complement(1801173..1801478) [306 bp, 101 aa] {ON}...    46   4e-07
Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A...    46   6e-07
Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON} ANN...    45   1e-06
Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig ...    45   1e-06
KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7 YC...    40   1e-04
NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7 YC...    37   0.002
CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar t...    32   0.11 
KLLA0C00528g Chr3 (40060..40410) [351 bp, 116 aa] {ON} no simila...    29   1.1  
Kpol_1028.85 s1028 complement(191587..192591) [1005 bp, 334 aa] ...    28   5.0  

>ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa]
           {ON} similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 112

 Score =  195 bits (496), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 100/112 (89%), Positives = 100/112 (89%)

Query: 1   MMVKPTKNQKAVRSKHNNGFKKPKKSISHSDKKRTKSKVEKLDAKGLLPSEIFKLNRXXX 60
           MMVKPTKNQKAVRSKHNNGFKKPKKSISHSDKKRTKSKVEKLDAKGLLPSEIFKLNR   
Sbjct: 1   MMVKPTKNQKAVRSKHNNGFKKPKKSISHSDKKRTKSKVEKLDAKGLLPSEIFKLNRSAS 60

Query: 61  XXXXXXXXXLLARNLEQDRKMDQDTRDKANAKKKETDNNILQQIEMISGFSL 112
                    LLARNLEQDRKMDQDTRDKANAKKKETDNNILQQIEMISGFSL
Sbjct: 61  SKTSNGSSSLLARNLEQDRKMDQDTRDKANAKKKETDNNILQQIEMISGFSL 112

>Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON}
           (19162..19497) [336 nt, 112 aa]
          Length = 111

 Score = 70.1 bits (170), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 68/105 (64%), Gaps = 3/105 (2%)

Query: 11  AVRSKHNNGFKKPKKS-ISHSDKKRTKSKVEKLDAKGLLPSEIFKLNRXXXXXXXX--XX 67
           ++R K N G K  +K+ IS S+KKR K K+EK++ +G+LPS+I +LN             
Sbjct: 7   SMRKKGNVGKKSKRKNVISQSEKKRNKIKMEKINKEGILPSDILQLNNETRNGQSEGNKE 66

Query: 68  XXLLARNLEQDRKMDQDTRDKANAKKKETDNNILQQIEMISGFSL 112
             L ++ L+QD   D++T  K  A KKETD+++L+QIE+++GFSL
Sbjct: 67  RALESQKLQQDNVKDRETIAKIEASKKETDDSMLKQIELMTGFSL 111

>SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly
           similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 105

 Score = 69.7 bits (169), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/111 (39%), Positives = 66/111 (59%), Gaps = 6/111 (5%)

Query: 2   MVKPTKNQKAVRSKHNNGFKKPKKSISHSDKKRTKSKVEKLDAKGLLPSEIFKLNRXXXX 61
           M KP       ++K +NG KKP   I  S KKRT+ +VE+L+ +  L S++  +      
Sbjct: 1   MAKP-----LSKTKKDNGSKKPSGGIKKSQKKRTRIQVEQLNKQEFLLSDL-NMTNAGST 54

Query: 62  XXXXXXXXLLARNLEQDRKMDQDTRDKANAKKKETDNNILQQIEMISGFSL 112
                   L A+ L QD+K D++TRDK   ++K+T++N+L Q+EMISGFSL
Sbjct: 55  KTKEKPKTLQAKALAQDQKKDKETRDKLEKQRKDTNDNMLAQLEMISGFSL 105

>NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 119

 Score = 64.3 bits (155), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 60/98 (61%), Gaps = 3/98 (3%)

Query: 18  NGFKKPKKSISHSDKKRTKSKVEKLDAK-GLLPSEIFKLNRXXXXXXXXX--XXXLLARN 74
           N  KK K SIS SD+K+ K +VEKL+ K  LLP  +  L +              L AR+
Sbjct: 22  NQVKKNKNSISFSDRKKAKHQVEKLNKKENLLPMNVLDLQKKKNLSKKPEPLKSILHARS 81

Query: 75  LEQDRKMDQDTRDKANAKKKETDNNILQQIEMISGFSL 112
           L QD+K D++ R+K  A++K TD++I +QIEMISGF+ 
Sbjct: 82  LLQDQKKDKEIRNKIRAEQKATDDSIEKQIEMISGFTF 119

>TDEL0C06950 Chr3 complement(1262284..1262619) [336 bp, 111 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 111

 Score = 58.2 bits (139), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 53/93 (56%), Gaps = 1/93 (1%)

Query: 21  KKPKKSISHSDKKRTKSKVEKLDAKGLLPSEIFKLNRXXXXXXXXXXXXLLA-RNLEQDR 79
           K  KK+IS  D K+TK +VE L+      SEI KLN              L  R L++D 
Sbjct: 19  KNCKKAISRRDVKKTKFRVENLNRDTASLSEIIKLNASTAVKGSARKANTLENRTLQKDW 78

Query: 80  KMDQDTRDKANAKKKETDNNILQQIEMISGFSL 112
           + DQ  R+K+ A+K+E  NN+ +QIE ISGFSL
Sbjct: 79  QKDQKIREKSKAEKEEMANNLEKQIEDISGFSL 111

>YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}
           ADF1Transcriptional repressor encoded by the antisense
           strand of the FYV5 gene; negatively regulates
           transcription of FYV5 by binding to the promoter on the
           sense strand
          Length = 113

 Score = 51.2 bits (121), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 57/91 (62%), Gaps = 3/91 (3%)

Query: 24  KKSISHSDKKRTKSKVEKLD--AKGLLPSEIFKLNRXXXXXXXXXXXXLLARNLEQDRKM 81
           K+SIS +++KRTK +VEKL+  ++ ++P+ + +               L A  L +D++ 
Sbjct: 24  KRSISTAERKRTKLQVEKLNKSSETMIPT-LLREASTQEPAKLKAETTLKAEELIKDQEK 82

Query: 82  DQDTRDKANAKKKETDNNILQQIEMISGFSL 112
           D   R++   +K +T++++L+QIEMISGFSL
Sbjct: 83  DSKVREQIRTEKSKTNDSMLKQIEMISGFSL 113

>Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score = 49.7 bits (117), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 56/91 (61%), Gaps = 3/91 (3%)

Query: 24  KKSISHSDKKRTKSKVEKLD--AKGLLPSEIFKLNRXXXXXXXXXXXXLLARNLEQDRKM 81
           ++SIS + KKRTK +VEKL+  ++ ++P+ + +               L A +L +D++ 
Sbjct: 24  RRSISTAVKKRTKLQVEKLNKSSEMMIPT-LLRETGAQEPAKRKTESTLKAGDLIKDQEK 82

Query: 82  DQDTRDKANAKKKETDNNILQQIEMISGFSL 112
           D   R+    +K +T++N+L+QIEMISGFSL
Sbjct: 83  DSKVREHIQMEKSKTNDNMLKQIEMISGFSL 113

>TPHA0E03990 Chr5 complement(837690..838040) [351 bp, 116 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 116

 Score = 49.3 bits (116), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/93 (39%), Positives = 52/93 (55%), Gaps = 1/93 (1%)

Query: 21  KKPKKSISHSDKKRTKSKVEKLDAKGLLPSE-IFKLNRXXXXXXXXXXXXLLARNLEQDR 79
           K  K  +S   +K TK KVEKL+   ++ S+ I  LN             L A+ L +D 
Sbjct: 24  KNIKGKLSSQVRKSTKHKVEKLNKLEVISSDDINALNALNGKKREKQTSVLEAKTLAKDN 83

Query: 80  KMDQDTRDKANAKKKETDNNILQQIEMISGFSL 112
             D+   +K  +KKKET+ ++LQQIEM+SGFSL
Sbjct: 84  LKDRQLIEKIESKKKETNASLLQQIEMMSGFSL 116

>Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)
          Length = 113

 Score = 49.3 bits (116), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 55/91 (60%), Gaps = 3/91 (3%)

Query: 24  KKSISHSDKKRTKSKVEKLD--AKGLLPSEIFKLNRXXXXXXXXXXXXLLARNLEQDRKM 81
           K+ IS +++KRTK +VEKL+  ++ ++P+ + +               L A  L +D+  
Sbjct: 24  KRPISTAERKRTKLQVEKLNKSSEIMIPT-LLRETATQEPTKKRAKSTLKAEELVKDQAK 82

Query: 82  DQDTRDKANAKKKETDNNILQQIEMISGFSL 112
           D   R++   +K +T++++L+QIEMISGFSL
Sbjct: 83  DCKVREQIQTEKSKTNDSMLEQIEMISGFSL 113

>KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 126

 Score = 48.9 bits (115), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 52/97 (53%), Gaps = 9/97 (9%)

Query: 25  KSISHSDKKRTKSKVEKLD--AKGLLPS-------EIFKLNRXXXXXXXXXXXXLLARNL 75
           K+I  S++KR K +VEKL+    G++         EI K N+            L    L
Sbjct: 30  KTIPLSERKRNKLQVEKLNRPTNGMIEGNAVDIRNEIDKHNQEVEGQNRTVHRSLDVEKL 89

Query: 76  EQDRKMDQDTRDKANAKKKETDNNILQQIEMISGFSL 112
            QD+  D+  +++   K+KETD ++L QIEMISGFSL
Sbjct: 90  AQDKSKDRIIQEQVAKKQKETDQSMLAQIEMISGFSL 126

>TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 113

 Score = 48.5 bits (114), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 59/110 (53%), Gaps = 9/110 (8%)

Query: 11  AVRSKHNNGFKKPKKS--------ISHSDKKRTKSKVEKLDAKGLLPSEIFKLNRXXXXX 62
            VRSK     K P +         IS  DKKR K +VEK++ +  L S+I  LN      
Sbjct: 5   TVRSKLKKSGKTPSRKLGKVKANKISVGDKKRAKLQVEKMNKQDSLLSDIINLN-GKSKE 63

Query: 63  XXXXXXXLLARNLEQDRKMDQDTRDKANAKKKETDNNILQQIEMISGFSL 112
                  L ++ L++D++ D+    +   KKK+T+++++ QIEMISGFSL
Sbjct: 64  LAKNVNTLSSKQLKKDQEKDRLLNVEIKNKKKQTNDDLIAQIEMISGFSL 113

>KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved
           hypothetical protein
          Length = 104

 Score = 47.8 bits (112), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 46/79 (58%), Gaps = 2/79 (2%)

Query: 34  RTKSKVEKLDAKGLLPSEIFKLNRXXXXXXXXXXXXLLARNLEQDRKMDQDTRDKANAKK 93
           RTK KVE+ + +  L SE+ +  R            L   +L +DR+ D+  + K   +K
Sbjct: 28  RTKLKVEQANKESFLISELNE--REHNTKRTPALESLKVSDLIEDREKDKSMQKKMEEQK 85

Query: 94  KETDNNILQQIEMISGFSL 112
           + TDNNI++Q+E+ISGFSL
Sbjct: 86  QSTDNNIIEQLELISGFSL 104

>AFR743CA Chr6 complement(1801173..1801478) [306 bp, 101 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL058W-A
          Length = 101

 Score = 46.2 bits (108), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 54/103 (52%), Gaps = 8/103 (7%)

Query: 10  KAVRSKHNNGFKKPKKSISHSDKKRTKSKVEKLDAKGLLPSEIFKLNRXXXXXXXXXXXX 69
           +A RSK  NG    +  IS +DKKR K +VEKLD +G+L +E                  
Sbjct: 7   RAKRSK--NGASAKQGKISKADKKRAKLQVEKLDKRGVLLAE------LTAAAPAAKTGV 58

Query: 70  LLARNLEQDRKMDQDTRDKANAKKKETDNNILQQIEMISGFSL 112
           L A +L QD++ D   + +   ++   D  ++QQ+E I+GFSL
Sbjct: 59  LQAASLAQDQRSDAQAQQQRAQERSNVDKKVVQQLEAIAGFSL 101

>Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score = 46.2 bits (108), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 56/101 (55%), Gaps = 6/101 (5%)

Query: 17  NNGFKKP---KKSISHSDKKRTKSKVEKLD--AKGLLPSEIFKLNRXXXXXXXXXXXXLL 71
           N G  K    K+ IS ++ KRTK +VE+L+  ++ ++P+ + K               L 
Sbjct: 14  NGGVGKKQQKKRPISTAEMKRTKLQVERLNKSSETMIPT-LLKEASKQDLDKKKTRSTLE 72

Query: 72  ARNLEQDRKMDQDTRDKANAKKKETDNNILQQIEMISGFSL 112
           A  L +D+  D   R+    +K +T++++L+QIEMISGFSL
Sbjct: 73  AEELVKDQARDSKVREHIETEKSKTNDSMLKQIEMISGFSL 113

>Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 105

 Score = 45.4 bits (106), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 51/94 (54%), Gaps = 5/94 (5%)

Query: 22  KPKKS---ISHSDKKRTKSKVEKLDAKGLLPSEIFKLNRXXXXXXXXXXXXLLARNLEQD 78
           KP+ S   I    K RTK KVE+ + +  L SE+ K  R            L    L +D
Sbjct: 14  KPRGSKNVIKKHQKIRTKLKVEQANKEVFLISELNK--REDTKRQSSPLESLKPSRLVKD 71

Query: 79  RKMDQDTRDKANAKKKETDNNILQQIEMISGFSL 112
            K DQ+ + +  +++K TD N+L+Q+E+ISGFSL
Sbjct: 72  IKKDQNAQKQLESQRKATDENVLRQLELISGFSL 105

>Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig
           123] FULL
          Length = 105

 Score = 45.4 bits (106), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 51/94 (54%), Gaps = 5/94 (5%)

Query: 22  KPKKS---ISHSDKKRTKSKVEKLDAKGLLPSEIFKLNRXXXXXXXXXXXXLLARNLEQD 78
           KP+ S   I    K RTK KVE+ + +  L SE+ K  R            L    L +D
Sbjct: 14  KPRGSKNVIKKHQKIRTKLKVEQANKEVFLISELNK--REDTKRQSSPLESLKPSRLVKD 71

Query: 79  RKMDQDTRDKANAKKKETDNNILQQIEMISGFSL 112
            K DQ+ + +  +++K TD N+L+Q+E+ISGFSL
Sbjct: 72  IKKDQNAQKQLESQRKATDENVLRQLELISGFSL 105

>KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 111

 Score = 40.0 bits (92), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 48/94 (51%), Gaps = 1/94 (1%)

Query: 20  FKKPKKSISHSDKKRTKSKVEKLDAKGLL-PSEIFKLNRXXXXXXXXXXXXLLARNLEQD 78
            K  K  IS S++K+ K  VEK + + +    E+ K  +            L  + L  D
Sbjct: 18  IKSRKNVISQSERKKNKLIVEKFNQQTITNVQELNKDLKKDKRRLSKTKNALETKKLLHD 77

Query: 79  RKMDQDTRDKANAKKKETDNNILQQIEMISGFSL 112
           +  D + +     K KET++++L+QIEMISGFSL
Sbjct: 78  QARDHEVKQNIETKLKETEDSMLKQIEMISGFSL 111

>NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 123

 Score = 37.0 bits (84), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 45/90 (50%), Gaps = 6/90 (6%)

Query: 27  ISHSDKKRTKSKVEKLDAKGLLPSEIFKLNRXXXXXXXXXX------XXLLARNLEQDRK 80
           I  SD+K+ K KV   + +  L   + +LN                   L A +L  D+K
Sbjct: 32  IKQSDRKKNKIKVAMFNKESSLHMNVSELNSQSMSPIKQKQDSLRKGSSLSAHDLLNDQK 91

Query: 81  MDQDTRDKANAKKKETDNNILQQIEMISGF 110
            D +  ++   +KK+ ++++L+QIEMISGF
Sbjct: 92  KDIEANNRIQTEKKQVNDDMLRQIEMISGF 121

>CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar to
           CA0039|IPF3998 Candida albicans and KLLA0C00528g
           Kluyveromyces lactis
          Length = 121

 Score = 32.3 bits (72), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 27/38 (71%)

Query: 75  LEQDRKMDQDTRDKANAKKKETDNNILQQIEMISGFSL 112
           L +D+K D+  R+       ET++++L+Q+E++SGFSL
Sbjct: 84  LVKDQKRDKKVREHIEKINSETNSDMLKQLELMSGFSL 121

>KLLA0C00528g Chr3 (40060..40410) [351 bp, 116 aa] {ON} no
           similarity
          Length = 116

 Score = 29.3 bits (64), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 26/43 (60%)

Query: 70  LLARNLEQDRKMDQDTRDKANAKKKETDNNILQQIEMISGFSL 112
           L  + + +  K D++   K + +KK T+  I  Q+E+ISGFSL
Sbjct: 74  LEGQKVREHYKEDKEVVKKHDKEKKATEKKIEDQLELISGFSL 116

>Kpol_1028.85 s1028 complement(191587..192591) [1005 bp, 334 aa]
           {ON} complement(191587..192591) [1005 nt, 335 aa]
          Length = 334

 Score = 28.1 bits (61), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 24  KKSISHSDKKRTKSKVEKLDAKGLLPSEIFK 54
           K ++S+ D+K   SK E L+   LLPS+ F+
Sbjct: 216 KPNLSNFDRKSVSSKEEALEIASLLPSDFFQ 246

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.125    0.329 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,657,294
Number of extensions: 351363
Number of successful extensions: 2079
Number of sequences better than 10.0: 47
Number of HSP's gapped: 2061
Number of HSP's successfully gapped: 47
Length of query: 112
Length of database: 53,481,399
Length adjustment: 82
Effective length of query: 30
Effective length of database: 44,078,787
Effective search space: 1322363610
Effective search space used: 1322363610
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 59 (27.3 bits)