Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F18414g1.8ON87873833e-49
SAKL0C00528g1.8ON110763444e-43
Ecym_10101.8ON82763346e-42
TPHA0E039801.8ON86863279e-41
AFR743W1.8ON82763261e-40
KLTH0F00550g1.8ON82763242e-40
Kpol_2002.111.8ON86743216e-40
NCAS0B090801.8ON93713149e-39
CAGL0B00396g1.8ON88733079e-38
Kwal_33.130161.8ON82753052e-37
TBLA0A049601.8ON96713035e-37
YCL057C-A (MOS1)1.8ON97962992e-36
Smik_3.171.8ON97692958e-36
Skud_3.61.8ON97692941e-35
Suva_3.1551.8ON97692896e-35
TDEL0C069401.8ON86762773e-33
KLLA0C00550g1.8ON82702712e-32
KNAG0C002501.8ON94742497e-29
NDAI0A001701.8ON96692436e-28
KAFR0D001701.8ON90692332e-26
NCAS0A052701.537ON57726603.9
CAGL0F00187g1.537ON57026594.3
YGR276C (RNH70)5.23ON55350586.8
Skud_7.6095.23ON55250587.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F18414g
         (87 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} simila...   152   3e-49
SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}...   137   4e-43
Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON} sim...   133   6e-42
TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8 Y...   130   9e-41
AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic ho...   130   1e-40
KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON} ...   129   2e-40
Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}...   128   6e-40
NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8...   125   9e-39
CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON} ...   122   9e-38
Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON} ...   122   2e-37
TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa] {O...   121   5e-37
YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}  MO...   119   2e-36
Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON} YCL...   118   8e-36
Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON} YCL0...   117   1e-35
Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON} ...   115   6e-35
TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8...   111   3e-33
KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON} ...   108   2e-32
KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON} A...   100   7e-29
NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON} A...    98   6e-28
KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON} A...    94   2e-26
NCAS0A05270 Chr1 (1042604..1044337) [1734 bp, 577 aa] {ON}             28   3.9  
CAGL0F00187g Chr6 (19572..21284) [1713 bp, 570 aa] {ON} similar ...    27   4.3  
YGR276C Chr7 complement(1043819..1045480) [1662 bp, 553 aa] {ON}...    27   6.8  
Skud_7.609 Chr7 complement(1018396..1020054) [1659 bp, 552 aa] {...    27   7.4  

>ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} similar
          to uniprot|Q96VH5 Saccharomyces cerevisiae YCL057C-A
          Length = 87

 Score =  152 bits (383), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 79/87 (90%), Positives = 79/87 (90%)

Query: 1  MAEXXXXXXXXVTAPNKSILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLG 60
          MAE        VTAPNKSILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLG
Sbjct: 1  MAEQQQQAQLQVTAPNKSILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLG 60

Query: 61 IGFGLGRGYAEGDAIFRSAAGLRTSKA 87
          IGFGLGRGYAEGDAIFRSAAGLRTSKA
Sbjct: 61 IGFGLGRGYAEGDAIFRSAAGLRTSKA 87

>SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}
           similar to uniprot|Q96VH5 Saccharomyces cerevisiae
           YCL057C-A
          Length = 110

 Score =  137 bits (344), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 72/76 (94%)

Query: 12  VTAPNKSILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAE 71
           V+ PNKSILNDKWDVVLSN++VK+GLGFG G+VASVL+FKRRAFPVWLG+GFGLGRGYAE
Sbjct: 35  VSKPNKSILNDKWDVVLSNVVVKTGLGFGAGIVASVLLFKRRAFPVWLGVGFGLGRGYAE 94

Query: 72  GDAIFRSAAGLRTSKA 87
           GDAIFRS+AGLRT  A
Sbjct: 95  GDAIFRSSAGLRTVNA 110

>Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON}
          similar to Ashbya gossypii AFR743W
          Length = 82

 Score =  133 bits (334), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 66/76 (86%), Positives = 71/76 (93%)

Query: 12 VTAPNKSILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAE 71
          V AP++SILNDKWDVVLSNL+VK+GLGF VGV+ASVL FKRRAFPVWLGIGFGLGRGYAE
Sbjct: 7  VAAPSRSILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGLGRGYAE 66

Query: 72 GDAIFRSAAGLRTSKA 87
          GDAIFRS AGLRT KA
Sbjct: 67 GDAIFRSHAGLRTMKA 82

>TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score =  130 bits (327), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 76/86 (88%), Gaps = 1/86 (1%)

Query: 1  MAEXXXXXXXXVTAPNKSILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLG 60
          M+E        +T+P KSILNDKWDVVLSN+LVK+GLGFGVGVV S+L+FKRRAFPVWLG
Sbjct: 1  MSEQKNNNNLELTSP-KSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWLG 59

Query: 61 IGFGLGRGYAEGDAIFRSAAGLRTSK 86
          IGFG+GRGY++GDAIFRSAAGLR+++
Sbjct: 60 IGFGVGRGYSDGDAIFRSAAGLRSTR 85

>AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YCL057C-A
          Length = 82

 Score =  130 bits (326), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 63/76 (82%), Positives = 70/76 (92%)

Query: 12 VTAPNKSILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAE 71
          V+AP++SILNDKWDVVLSNL+VK+GLGFG GV ASVL FKRRAFPVWLG+GFGLGRGYAE
Sbjct: 7  VSAPSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWLGVGFGLGRGYAE 66

Query: 72 GDAIFRSAAGLRTSKA 87
          GDAIFRS AGLR  +A
Sbjct: 67 GDAIFRSHAGLRAVRA 82

>KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score =  129 bits (324), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 62/76 (81%), Positives = 72/76 (94%)

Query: 12 VTAPNKSILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAE 71
          V+  ++S+LNDKWDVVLSNL+VK+GLGFG GVVASVL+FKRRAFPVW+G+GFGLGRGYAE
Sbjct: 7  VSPTSRSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPVWIGVGFGLGRGYAE 66

Query: 72 GDAIFRSAAGLRTSKA 87
          GDAIFRS+AGLRT KA
Sbjct: 67 GDAIFRSSAGLRTVKA 82

>Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}
          complement(19864..20124) [261 nt, 87 aa]
          Length = 86

 Score =  128 bits (321), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (91%)

Query: 12 VTAPNKSILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAE 71
           +AP +SILNDKWDVVLSN LVK+ LGFG GV+ASV++FKRRAFPVWLGIGFG+GRGY+E
Sbjct: 11 TSAPTRSILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGIGFGIGRGYSE 70

Query: 72 GDAIFRSAAGLRTS 85
          GDAIFRSAAGLR S
Sbjct: 71 GDAIFRSAAGLRKS 84

>NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 93

 Score =  125 bits (314), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 60/71 (84%), Positives = 66/71 (92%)

Query: 16 NKSILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAEGDAI 75
          ++SILNDKWDVVLSN+LVK GLGF VGVVASV+ FKRR FPVWLGIGFG+GRGYAEGDAI
Sbjct: 22 DRSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPVWLGIGFGVGRGYAEGDAI 81

Query: 76 FRSAAGLRTSK 86
          FRS AGLRT+K
Sbjct: 82 FRSPAGLRTAK 92

>CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON}
          highly similar to uniprot|Q96VH5 Saccharomyces
          cerevisiae YCL057ca
          Length = 88

 Score =  122 bits (307), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 65/73 (89%)

Query: 14 APNKSILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAEGD 73
           P +SILNDKWDVVLSN++VK GLGFGVGVV SVL FKRR+FPVWLG+GFG GRGY+EGD
Sbjct: 15 TPVRSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGFGAGRGYSEGD 74

Query: 74 AIFRSAAGLRTSK 86
          AIFRS AGLR+ K
Sbjct: 75 AIFRSTAGLRSVK 87

>Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON}
          YCL057C-A - Hypothetical ORF, has similarity to
          proteins in S. pombe, C. elegans, D. melanogaster.
          [contig 123] FULL
          Length = 82

 Score =  122 bits (305), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 70/75 (93%), Gaps = 1/75 (1%)

Query: 14 AP-NKSILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAEG 72
          AP ++S+LNDKWDVVLSNL+VK GLGFG GVVASVL+FKRRA PVW+G+GFGLGRGY+EG
Sbjct: 8  APVSRSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGLGRGYSEG 67

Query: 73 DAIFRSAAGLRTSKA 87
          DAIFRS+AGLRT KA
Sbjct: 68 DAIFRSSAGLRTVKA 82

>TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa]
          {ON} Anc_1.8 YCL057C-A
          Length = 96

 Score =  121 bits (303), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 64/71 (90%)

Query: 14 APNKSILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAEGD 73
            N+SILNDKWD+V+SN+LVK+  GFG GV+ASV+ FKRRAFPVWLG+GFGLGRGY+EGD
Sbjct: 23 TSNRSILNDKWDIVISNMLVKTTFGFGAGVLASVIFFKRRAFPVWLGVGFGLGRGYSEGD 82

Query: 74 AIFRSAAGLRT 84
          AIFRS AGLR+
Sbjct: 83 AIFRSTAGLRS 93

>YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}
          MOS1Mitochondrial protein essential for proper inner
          membrane organization; conserved component of the
          mitochondrial inner membrane organizing system (MICOS,
          MINOS, or MitOS), a scaffold-like structure on the
          intermembrane space side of the inner membrane which
          has a role in the maintenance of crista junctions and
          inner membrane architecture; ortholog of human MINOS1
          Length = 97

 Score =  119 bits (299), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 71/96 (73%), Gaps = 10/96 (10%)

Query: 1  MAEXXXXXXXXVTAPNK----------SILNDKWDVVLSNLLVKSGLGFGVGVVASVLIF 50
          M+E         + P+K          +IL+ KWD+VLSN+LVK+ +GFGVGV  SVL F
Sbjct: 1  MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60

Query: 51 KRRAFPVWLGIGFGLGRGYAEGDAIFRSAAGLRTSK 86
          KRRAFPVWLGIGFG+GRGYAEGDAIFRS+AGLR+SK
Sbjct: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSK 96

>Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  118 bits (295), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 64/69 (92%)

Query: 18 SILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAEGDAIFR 77
          ++L+ KWD+VLSN+LVK+ +GFGVGV  SVL FKRRAFPVWLGIGFG+GRGYAEGDAIFR
Sbjct: 28 TVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGRGYAEGDAIFR 87

Query: 78 SAAGLRTSK 86
          S+AGLR+SK
Sbjct: 88 SSAGLRSSK 96

>Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  117 bits (294), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 64/69 (92%)

Query: 18 SILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAEGDAIFR 77
          +IL+ KWD+V+SN+LVK+ +GFGVGV  SVL FKRRAFPVWLGIGFG+GRGYAEGDAIFR
Sbjct: 28 TILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGRGYAEGDAIFR 87

Query: 78 SAAGLRTSK 86
          S+AGLR+SK
Sbjct: 88 SSAGLRSSK 96

>Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  115 bits (289), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 63/69 (91%)

Query: 18 SILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAEGDAIFR 77
          ++L+ KWD+VLSN+LVK+ +GFG+GV  SVL FKRRAFP WLGIGFG+GRGYAEGDAIFR
Sbjct: 28 TVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFFKRRAFPAWLGIGFGVGRGYAEGDAIFR 87

Query: 78 SAAGLRTSK 86
          S+AGLR+SK
Sbjct: 88 SSAGLRSSK 96

>TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score =  111 bits (277), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 72/76 (94%)

Query: 12 VTAPNKSILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAE 71
          V AP++SILNDKWDVVLSN+LVK+GLGFGVGVV SVL FKRRAFPVWLGIGFGLGRGYAE
Sbjct: 11 VAAPSRSILNDKWDVVLSNMLVKTGLGFGVGVVGSVLFFKRRAFPVWLGIGFGLGRGYAE 70

Query: 72 GDAIFRSAAGLRTSKA 87
          GDAIFRSAAGLR+ KA
Sbjct: 71 GDAIFRSAAGLRSVKA 86

>KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score =  108 bits (271), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 61/70 (87%)

Query: 18 SILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAEGDAIFR 77
          SIL+ +WDVVLSN++ K+ LG GVG+VASVL FKRRAFPVW+G+GFGLGRGYAEGDAIFR
Sbjct: 13 SILDKRWDVVLSNVVAKTALGAGVGIVASVLFFKRRAFPVWVGVGFGLGRGYAEGDAIFR 72

Query: 78 SAAGLRTSKA 87
          + AGLR   A
Sbjct: 73 TNAGLRKVNA 82

>KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 94

 Score =  100 bits (249), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 68/74 (91%)

Query: 13 TAPNKSILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAEG 72
          T  ++S+LNDKWDVVLSN+LVK G+GFGVGVV SVL+F+RRAFPVWLGIGFG+GRGY+EG
Sbjct: 20 TKIDRSLLNDKWDVVLSNMLVKVGMGFGVGVVTSVLLFRRRAFPVWLGIGFGVGRGYSEG 79

Query: 73 DAIFRSAAGLRTSK 86
          DAIFRS +G+RT K
Sbjct: 80 DAIFRSTSGIRTVK 93

>NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 96

 Score = 98.2 bits (243), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 57/69 (82%), Positives = 63/69 (91%)

Query: 16 NKSILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAEGDAI 75
          +KSILNDKWD+VLSN LVK GLGFGVGVV SV+ FKRR FPVWLGIGFG GRGYAEGDAI
Sbjct: 25 DKSILNDKWDIVLSNTLVKVGLGFGVGVVTSVIFFKRRTFPVWLGIGFGAGRGYAEGDAI 84

Query: 76 FRSAAGLRT 84
          FRS+AG+R+
Sbjct: 85 FRSSAGIRS 93

>KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 90

 Score = 94.4 bits (233), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 55/69 (79%), Positives = 63/69 (91%)

Query: 16 NKSILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAEGDAI 75
          ++SILNDKWD+VLSN+LVK GLGFGVGVV SV+ FKRRAFPVWLGIG+G GR Y+EGDAI
Sbjct: 19 DRSILNDKWDLVLSNMLVKVGLGFGVGVVTSVIFFKRRAFPVWLGIGYGFGRAYSEGDAI 78

Query: 76 FRSAAGLRT 84
          FRS AGLR+
Sbjct: 79 FRSNAGLRS 87

>NCAS0A05270 Chr1 (1042604..1044337) [1734 bp, 577 aa] {ON} 
          Length = 577

 Score = 27.7 bits (60), Expect = 3.9,   Method: Composition-based stats.
 Identities = 12/26 (46%), Positives = 18/26 (69%), Gaps = 5/26 (19%)

Query: 37  LGFGVGVVASVLIFKRRAFPVWLGIG 62
           +G G+GVV +++     AF VW+GIG
Sbjct: 387 IGTGIGVVVAII-----AFGVWIGIG 407

>CAGL0F00187g Chr6 (19572..21284) [1713 bp, 570 aa] {ON} similar to
           uniprot|P40988 Saccharomyces cerevisiae YMR319c FET4 low
           affinity Fe(II) iron transport protein
          Length = 570

 Score = 27.3 bits (59), Expect = 4.3,   Method: Composition-based stats.
 Identities = 11/26 (42%), Positives = 18/26 (69%), Gaps = 5/26 (19%)

Query: 37  LGFGVGVVASVLIFKRRAFPVWLGIG 62
           +G G+GVV ++++F      VW+GIG
Sbjct: 377 IGTGIGVVVAIIVFG-----VWIGIG 397

>YGR276C Chr7 complement(1043819..1045480) [1662 bp, 553 aa] {ON}
           RNH703'-5' exoribonuclease; required for maturation of
           3' ends of 5S rRNA and tRNA-Arg3 from dicistronic
           transcripts
          Length = 553

 Score = 26.9 bits (58), Expect = 6.8,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 8/50 (16%)

Query: 16  NKSILNDKWDVV--------LSNLLVKSGLGFGVGVVASVLIFKRRAFPV 57
           NKSI N + D V        L+ L + +GL FG+G+    L  K   F V
Sbjct: 352 NKSIQNGEHDSVEDARACLELTKLKILNGLAFGIGINTENLFTKLHRFEV 401

>Skud_7.609 Chr7 complement(1018396..1020054) [1659 bp, 552 aa] {ON}
           YGR276C (REAL)
          Length = 552

 Score = 26.9 bits (58), Expect = 7.4,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 8/50 (16%)

Query: 16  NKSILNDKWDVV--------LSNLLVKSGLGFGVGVVASVLIFKRRAFPV 57
           NKSI N + D V        L+ L + +GL FG+G+    L  K   F V
Sbjct: 351 NKSIQNGEHDSVEDARACLELTKLKILNGLAFGIGINTENLFSKLHRFEV 400

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.141    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,036,781
Number of extensions: 216217
Number of successful extensions: 490
Number of sequences better than 10.0: 27
Number of HSP's gapped: 490
Number of HSP's successfully gapped: 27
Length of query: 87
Length of database: 53,481,399
Length adjustment: 59
Effective length of query: 28
Effective length of database: 46,716,105
Effective search space: 1308050940
Effective search space used: 1308050940
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (27.3 bits)