Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F18392g1.9ON72572537370.0
Kpol_2002.121.9ON73972926260.0
NCAS0B090701.9ON73072326110.0
SAKL0C00550g1.9ON73273725760.0
KNAG0C002601.9ON74468525630.0
KAFR0D001801.9ON72372725140.0
TPHA0E039701.9ON74773124970.0
TBLA0A075601.9ON74168124850.0
KLLA0C00572g1.9ON71271624170.0
NDAI0A001801.9ON74068824150.0
YCL057W (PRD1)1.9ON71270522690.0
Suva_3.1561.9ON71270622570.0
CAGL0B00418g1.9ON74372822480.0
Smik_3.181.9ON71268922370.0
Skud_3.71.9ON71268922210.0
Ecym_1011na 1ON71672321120.0
AGR406C1.9ON68367917440.0
AGR405Cna 1ON71768017040.0
ABR185WsingletonON4574679681e-123
NDAI0E020102.432ON7785574921e-51
KNAG0A062002.432ON7895584743e-49
TBLA0I007102.432ON7736204531e-46
SAKL0E03938g2.432ON7675554461e-45
Kpol_297.82.432ON7875584382e-44
CAGL0D02112g2.432ON7615544311e-43
NCAS0A042802.432ON7735604273e-43
Suva_11.912.432ON7756164265e-43
TPHA0G023902.432ON7956064266e-43
Ecym_60992.432ON7735504222e-42
AFR198W2.432ON7765504222e-42
Kwal_26.76162.432ON7706044114e-41
KAFR0D029502.432ON7776224025e-40
Skud_11.932.432ON7726274001e-39
ZYRO0G20130g2.432ON7865563964e-39
YKL134C (OCT1)2.432ON7725643954e-39
TDEL0A020802.432ON7875583921e-38
Smik_11.1022.432ON7725553902e-38
KLTH0D04730g2.432ON7725533892e-38
KLLA0B12397g2.432ON7795563733e-36
CAGL0J06534g8.821ON1670133743.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F18392g
         (725 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]...  1444   0.0  
Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON} (21544....  1016   0.0  
NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa] ...  1010   0.0  
SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly s...   996   0.0  
KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9 Y...   991   0.0  
KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9 Y...   972   0.0  
TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {O...   966   0.0  
TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa] ...   961   0.0  
KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar ...   935   0.0  
NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9        934   0.0  
YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc met...   878   0.0  
Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W ...   874   0.0  
CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar ...   870   0.0  
Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)   866   0.0  
Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)    860   0.0  
Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to ...   818   0.0  
AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}...   676   0.0  
AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}...   660   0.0  
ABR185W Chr2 (758126..758380,758380..758709,758709..759029,75903...   377   e-123
NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {O...   194   1e-51
KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {O...   187   3e-49
TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.4...   179   1e-46
SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} simila...   176   1e-45
Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON} ...   173   2e-44
CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {...   170   1e-43
NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {O...   169   3e-43
Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {O...   168   5e-43
TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {O...   168   6e-43
Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}...   167   2e-42
AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic ho...   167   2e-42
Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C...   162   4e-41
KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {O...   159   5e-40
Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {O...   158   1e-39
ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} simi...   157   4e-39
YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON} ...   156   4e-39
TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {O...   155   1e-38
Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {...   154   2e-38
KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} simila...   154   2e-38
KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]...   148   3e-36
CAGL0J06534g Chr10 (625604..630616) [5013 bp, 1670 aa] {ON} simi...    33   3.3  

>ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]
           {ON} similar to uniprot|P25375 Saccharomyces cerevisiae
           YCL057W PRD1 Zinc metalloendopeptidase found in the
           cytoplasm and intermembrane space of mitochondria
          Length = 725

 Score = 1444 bits (3737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 701/725 (96%), Positives = 701/725 (96%)

Query: 1   MLLRSCSRVAGFTRKSIFSVVAVPALAIGIYRVSKFQYSTMSSPNLFIAPQSAPSWAFTP 60
           MLLRSCSRVAGFTRKSIFSVVAVPALAIGIYRVSKFQYSTMSSPNLFIAPQSAPSWAFTP
Sbjct: 1   MLLRSCSRVAGFTRKSIFSVVAVPALAIGIYRVSKFQYSTMSSPNLFIAPQSAPSWAFTP 60

Query: 61  QSLLDETHRLIESSKQFYDSLAQLSNPTVENLVKPYMHHENGVGLIESQLTFPQQVSADK 120
           QSLLDETHRLIESSKQFYDSLAQLSNPTVENLVKPYMHHENGVGLIESQLTFPQQVSADK
Sbjct: 61  QSLLDETHRLIESSKQFYDSLAQLSNPTVENLVKPYMHHENGVGLIESQLTFPQQVSADK 120

Query: 121 EIRDASVQATEFLQNFGIEQSLRHDLFLQFDKIWNELKDKSFEQGSQEYEIYKYVEKIHR 180
           EIRDASVQATEFLQNFGIEQSLRHDLFLQFDKIWNELKDKSFEQGSQEYEIYKYVEKIHR
Sbjct: 121 EIRDASVQATEFLQNFGIEQSLRHDLFLQFDKIWNELKDKSFEQGSQEYEIYKYVEKIHR 180

Query: 181 DYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGEQKEFVAFTKEELDGVSESVMDQF 240
           DYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGEQKEFVAFTKEELDGVSESVMDQF
Sbjct: 181 DYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGEQKEFVAFTKEELDGVSESVMDQF 240

Query: 241 EQFKDENGTTKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETLQLRN 300
           EQFKDENGTTKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETLQLRN
Sbjct: 241 EQFKDENGTTKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETLQLRN 300

Query: 301 ELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEAENLKQIKQKECESL 360
           ELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEAENLKQIKQKECESL
Sbjct: 301 ELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEAENLKQIKQKECESL 360

Query: 361 GLPYDGHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPIESTISGMLSIYETLLKLKFVEE 420
           GLPYDGHYYVWDHR            VDLEKISEYYPIESTISGMLSIYETLLKLKFVEE
Sbjct: 361 GLPYDGHYYVWDHRYYDNKYLKDNYNVDLEKISEYYPIESTISGMLSIYETLLKLKFVEE 420

Query: 421 TDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKYGHAANFGISASYVKED 480
           TDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKYGHAANFGISASYVKED
Sbjct: 421 TDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKYGHAANFGISASYVKED 480

Query: 481 GTRSYPVTALVCNFXXXXXXXXXXXXHNEISTFFHELGHGIHDLVGENRLTTFNGPGAVP 540
           GTRSYPVTALVCNF            HNEISTFFHELGHGIHDLVGENRLTTFNGPGAVP
Sbjct: 481 GTRSYPVTALVCNFSKPSAKKPSLLKHNEISTFFHELGHGIHDLVGENRLTTFNGPGAVP 540

Query: 541 WDFVEAPSQMLEFWTWNERELHELSSHYESGEKIPKDLLQSLISTKHVDGALFALRQLHF 600
           WDFVEAPSQMLEFWTWNERELHELSSHYESGEKIPKDLLQSLISTKHVDGALFALRQLHF
Sbjct: 541 WDFVEAPSQMLEFWTWNERELHELSSHYESGEKIPKDLLQSLISTKHVDGALFALRQLHF 600

Query: 601 GLFDMYVHTSKNVAKLDLLKLWNELREEVSLVENGDTFTKGYDSFGHIMSDSYSAGYYGY 660
           GLFDMYVHTSKNVAKLDLLKLWNELREEVSLVENGDTFTKGYDSFGHIMSDSYSAGYYGY
Sbjct: 601 GLFDMYVHTSKNVAKLDLLKLWNELREEVSLVENGDTFTKGYDSFGHIMSDSYSAGYYGY 660

Query: 661 MWAEVFAADMYHTRFAADPLDSKAGVQYRDIVLGRGGLYETNDNLREFLGREPSEEAFLK 720
           MWAEVFAADMYHTRFAADPLDSKAGVQYRDIVLGRGGLYETNDNLREFLGREPSEEAFLK
Sbjct: 661 MWAEVFAADMYHTRFAADPLDSKAGVQYRDIVLGRGGLYETNDNLREFLGREPSEEAFLK 720

Query: 721 ELGLN 725
           ELGLN
Sbjct: 721 ELGLN 725

>Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON}
           (21544..23763) [2220 nt, 740 aa]
          Length = 739

 Score = 1016 bits (2626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/729 (65%), Positives = 590/729 (80%), Gaps = 13/729 (1%)

Query: 5   SCSRVAGFTRKS----IFSVVAVPALAIGIYRVSKFQYSTMSSPNLFIAPQSAPSWAFTP 60
           S S ++G T K+    I S  AVPA+A  I      +YSTM++ +L IAPQ AP+W +TP
Sbjct: 16  SNSIISGKTLKNRKTRIVSFFAVPAIAFTI-----LKYSTMTNSSLLIAPQPAPTWNWTP 70

Query: 61  QSLLDETHRLIESSKQFYDSLAQLSNPTVENLVKPYMHHENGVGLIESQLTFPQQVSADK 120
           + ++ +   LI+ S + +D+LA +S+PTVEN + PYM+HEN V  + +QLTF Q VSADK
Sbjct: 71  EGIVKDAESLIKDSNRIFDNLAAISSPTVENFIVPYMNHENKVSPLINQLTFLQHVSADK 130

Query: 121 EIRDASVQATEFLQNFGIEQSLRHDLFLQFDKIWNELKDKSF---EQGSQEYEIYKYVEK 177
           +IRD+S++ATE +QNF IE SLR DLF+QFDKIW ++KD S    +  S+ YE Y+++EK
Sbjct: 131 DIRDSSMKATELIQNFEIEASLRKDLFIQFDKIWTDVKDNSEFNEKSDSKNYESYRFIEK 190

Query: 178 IHRDYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGEQKEFVAFTKEELDGVSESVM 237
            H+D+ R GL L ++KR+ VK ++ KIA+NSL FSKNLGEQKEF+AFTKEELDGVS++VM
Sbjct: 191 CHKDFIRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLGEQKEFIAFTKEELDGVSDAVM 250

Query: 238 DQFEQFKDE-NGTTKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETL 296
           +QFE+FKDE  G  K+KVTFKYPDI PVLK+AKNP TRKLAF  DQ+KVP+NE LFV+TL
Sbjct: 251 EQFEKFKDEKTGEEKFKVTFKYPDILPVLKSAKNPNTRKLAFNADQNKVPENEALFVDTL 310

Query: 297 QLRNELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEAENLKQIKQKE 356
           +LRN+L+ +L YS YANYNLE+KMAKN++ V+ FL++LK KL+PLGLKE E LKQ+K+K+
Sbjct: 311 KLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPLGLKEIEILKQLKEKD 370

Query: 357 CESLGLPYDGHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPIESTISGMLSIYETLLKLK 416
            + L LPYD HYY+WDHR            VDLEKISEYYPIES+I GML IYET++KLK
Sbjct: 371 MKELNLPYDNHYYIWDHRYYDNKYLKDNFNVDLEKISEYYPIESSIDGMLKIYETVMKLK 430

Query: 417 FVEETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKYGHAANFGISASY 476
           FVEETDP KR+VWHEDVKQL+VWKMDNP  PEF+GWIYFDLHPRDGKYGHAANFGIS+SY
Sbjct: 431 FVEETDPAKRNVWHEDVKQLSVWKMDNPDAPEFIGWIYFDLHPRDGKYGHAANFGISSSY 490

Query: 477 VKEDGTRSYPVTALVCNFXXXXXXXXXXXXHNEISTFFHELGHGIHDLVGENRLTTFNGP 536
           V E+  RSYPVTALVCNF            HNE++TFFHELGHGIHDLVG NR +  NGP
Sbjct: 491 VDENDKRSYPVTALVCNFSKPTSDKPSLLKHNELTTFFHELGHGIHDLVGANRCSRLNGP 550

Query: 537 GAVPWDFVEAPSQMLEFWTWNERELHELSSHYESGEKIPKDLLQSLISTKHVDGALFALR 596
           G+VPWDFVEAPSQMLEFWTWN+ EL  LS HY++GEKIP+ L++SL+STKHV+GALFALR
Sbjct: 551 GSVPWDFVEAPSQMLEFWTWNKNELISLSKHYKTGEKIPESLIESLVSTKHVNGALFALR 610

Query: 597 QLHFGLFDMYVHTSKNVAKLDLLKLWNELREEVSLVENGDTFTKGYDSFGHIMSDSYSAG 656
           QLHF  FDM VHT+++V+KL+LL+LWN LRE++ LVENGD  +KGYDSFGHIMS +YSAG
Sbjct: 611 QLHFSTFDMEVHTAEDVSKLNLLELWNGLREQICLVENGDEMSKGYDSFGHIMSGAYSAG 670

Query: 657 YYGYMWAEVFAADMYHTRFAADPLDSKAGVQYRDIVLGRGGLYETNDNLREFLGREPSEE 716
           YYGYMWAEVFA DMY+T+FAADPL+SK+GV+YRDI+L RGG+YE NDNL EFLGREP+  
Sbjct: 671 YYGYMWAEVFATDMYYTKFAADPLNSKSGVEYRDIILSRGGIYEVNDNLEEFLGREPNNS 730

Query: 717 AFLKELGLN 725
           AFLKE+GLN
Sbjct: 731 AFLKEMGLN 739

>NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa]
           {ON} Anc_1.9
          Length = 730

 Score = 1010 bits (2611), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/723 (67%), Positives = 590/723 (81%), Gaps = 6/723 (0%)

Query: 5   SCSRVAGFTRKSIFSVVAVPALAIGIYRVSKFQYSTMSSPNLFIAPQ-SAPSWAFTPQSL 63
           S +R+A   +K + S + +PA A  + R S F  +  ++  L +AP  +AP+W ++P+S+
Sbjct: 11  SSTRIAN--KKLLISAIVLPATAFILTRKS-FYMTLPTNNKLLVAPTGTAPTWKWSPESI 67

Query: 64  LDETHRLIESSKQFYDSLAQLSNPTVENLVKPYMHHENGVGLIESQLTFPQQVSADKEIR 123
           L +T  +I+++   YDSLA +  P+VE+LVKPYMH+EN  GLI +QLTF Q VSADK IR
Sbjct: 68  LAKTKEVIDNATNLYDSLAAIEEPSVESLVKPYMHYENDEGLIVNQLTFLQHVSADKLIR 127

Query: 124 DASVQATEFLQNFGIEQSLRHDLFLQFDKIWNELKDKSFEQGSQEYEIYKYVEKIHRDYT 183
           DASV+ATE LQ+F IE S+R DLF QFDKIWN++KD   +  S+++E YK++EK+H+DY 
Sbjct: 128 DASVEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDD-DLKSKDFETYKFIEKVHKDYV 186

Query: 184 RDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGEQKEFVAFTKEELDGVSESVMDQFEQF 243
           R+GL LPE+KR++VK +K KIA+NSL +SKNLGEQKE+V+FTKE+L GVSESVM+QFE+F
Sbjct: 187 RNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLGEQKEYVSFTKEQLKGVSESVMEQFEKF 246

Query: 244 KD-ENGTTKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETLQLRNEL 302
            D +    KYKVTFKYPDIFPVLKTA+ PKTRKLA+  DQ+KVPQNE LFVETL+LRN+L
Sbjct: 247 VDPKTNEEKYKVTFKYPDIFPVLKTAQVPKTRKLAYISDQNKVPQNEALFVETLKLRNQL 306

Query: 303 ADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEAENLKQIKQKECESLGL 362
           A +LGYSTYANYNL++KMAKNQ+ V+ F+N LKDKLKPLG KE E LK +K+K+CE LGL
Sbjct: 307 AQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLGQKEIETLKTLKKKDCEELGL 366

Query: 363 PYDGHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPIESTISGMLSIYETLLKLKFVEETD 422
            YD HYY+WDHR            VDLE+ISEYYP+ESTI GML IYETLLKLKFV+ET+
Sbjct: 367 AYDDHYYIWDHRYYDNKFLKDNYNVDLEQISEYYPLESTIKGMLGIYETLLKLKFVDETN 426

Query: 423 PEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKYGHAANFGISASYVKEDGT 482
           P+ + VWHEDVKQLAVWKMD+   PEF+GWIYFDLHPRDGKY HAANFGIS+SY+ +DG 
Sbjct: 427 PKIKDVWHEDVKQLAVWKMDDEKNPEFIGWIYFDLHPRDGKYSHAANFGISSSYITQDGD 486

Query: 483 RSYPVTALVCNFXXXXXXXXXXXXHNEISTFFHELGHGIHDLVGENRLTTFNGPGAVPWD 542
           RS+PVTALVCNF            HNEI+TFFHELGHGIHDLVG+N+   FNGPGA PWD
Sbjct: 487 RSFPVTALVCNFSKSTDKKPSLLKHNEITTFFHELGHGIHDLVGKNKCARFNGPGATPWD 546

Query: 543 FVEAPSQMLEFWTWNERELHELSSHYESGEKIPKDLLQSLISTKHVDGALFALRQLHFGL 602
           FVEAPSQMLEFWTWN+ EL  LS HY++GEKI +DLL SLI+TKHV+GALFALRQLHFGL
Sbjct: 547 FVEAPSQMLEFWTWNKNELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALRQLHFGL 606

Query: 603 FDMYVHTSKNVAKLDLLKLWNELREEVSLVENGDTFTKGYDSFGHIMSDSYSAGYYGYMW 662
           FDM VHT+KNV  L+LLKLWNELRE++ LVENG+  TKGYDSFGHIMSDSYSAGYYGYMW
Sbjct: 607 FDMTVHTTKNVEDLNLLKLWNELREKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMW 666

Query: 663 AEVFAADMYHTRFAADPLDSKAGVQYRDIVLGRGGLYETNDNLREFLGREPSEEAFLKEL 722
           AEVFAADMY+T+FA+DPL+S+AGVQYRDIVL  GGLYE  D L+EFLGREP+ +AFLKEL
Sbjct: 667 AEVFAADMYYTKFASDPLNSQAGVQYRDIVLANGGLYEIADKLKEFLGREPTNDAFLKEL 726

Query: 723 GLN 725
           GL+
Sbjct: 727 GLH 729

>SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly
           similar to gnl|GLV|KLLA0C00572g Kluyveromyces lactis
           KLLA0C00572g and similar to YCL057W uniprot|P25375
           Saccharomyces cerevisiae YCL057W PRD1 Zinc
           metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 732

 Score =  996 bits (2576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/737 (64%), Positives = 579/737 (78%), Gaps = 18/737 (2%)

Query: 1   MLLRSCSRVAGFTRKSIFSVVAVPALAIGIY----------RVSKFQYSTMSS--PNLFI 48
           ++L+  ++    T     S++A+PALA G Y          R+ K  YSTMS+      +
Sbjct: 2   LILKRANKFCSTTT----SLLAIPALAFGAYSLLHSTNRTLRIPKSNYSTMSATMSATLV 57

Query: 49  APQSAPSWAFTPQSLLDETHRLIESSKQFYDSLAQLSNPTVENLVKPYMHHENGVGLIES 108
            PQ+APSW ++P+ +L  T+  I S+   +D+LA + NPTVE+LVKP++ HEN    + +
Sbjct: 58  PPQAAPSWKYSPEDILQLTNETIASTSALHDALAGVENPTVESLVKPFLEHENTTQPLIN 117

Query: 109 QLTFPQQVSADKEIRDASVQATEFLQNFGIEQSLRHDLFLQFDKIWNELKDKSFEQGSQE 168
           QLTF Q VSADKE+RDAS +ATE LQ+F IE SLRHDLF+QFDK+W   KD + +   + 
Sbjct: 118 QLTFLQHVSADKEVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQACKDDA-KFKKEH 176

Query: 169 YEIYKYVEKIHRDYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGEQKEFVAFTKEE 228
           +E+YK+VEK H+DY R GL LPE+KR++VK+L+ KI+ NSL+FSKNLGEQKEFVAFT EE
Sbjct: 177 FELYKFVEKCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGEQKEFVAFTTEE 236

Query: 229 LDGVSESVMDQFEQFKDENGTTKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQN 288
           LDGVS SVMDQFE+F D +G  K+KV+FKYPDI PVLKTAKNP+TRK AF  DQ+KVPQN
Sbjct: 237 LDGVSASVMDQFEKFTDTDGVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKVPQN 296

Query: 289 EKLFVETLQLRNELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEAEN 348
           E LF+ETL+LR+ELA +LGYSTYANYNL++KMAK Q+ V  FL +LK+KLKPLG+KE E 
Sbjct: 297 EVLFLETLRLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEA 356

Query: 349 LKQIKQKECESLGLPYDGHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPIESTISGMLSI 408
           LK +K+K+C+ L +P+D HYY+WD+R            VD EKISEY+P+E TI GML I
Sbjct: 357 LKSLKEKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPTIGGMLKI 416

Query: 409 YETLLKLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKYGHAA 468
           YET+LKLKFVEETD EK+ VWHEDVKQLAVWK+D    PEFVGWIYFDLHPRDGKYGHAA
Sbjct: 417 YETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYGHAA 476

Query: 469 NFGISASYVKEDGTRSYPVTALVCNFXXXXXXXXXXXXHNEISTFFHELGHGIHDLVGEN 528
           NFGI++SYV+ DG RS+PVTALVCNF            H+EI+TFFHELGHGIHDLVG N
Sbjct: 477 NFGIASSYVR-DGARSHPVTALVCNFSKPSAKKPALLKHSEITTFFHELGHGIHDLVGGN 535

Query: 529 RLTTFNGPGAVPWDFVEAPSQMLEFWTWNERELHELSSHYESGEKIPKDLLQSLISTKHV 588
            +  FNGPGA PWDFVEAPSQMLEFWTWN+ EL  LS HYE+GEKIP+ LL SLI+TKHV
Sbjct: 536 HIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYETGEKIPEQLLDSLIATKHV 595

Query: 589 DGALFALRQLHFGLFDMYVHTSKNVAKLDLLKLWNELREEVSLVENGDTFTKGYDSFGHI 648
           +GALFALRQL FGLFDM VHT K++  LD+  LWN+LR+EVSLVENGD  TKG++SFGHI
Sbjct: 596 NGALFALRQLTFGLFDMTVHTCKDLESLDVTSLWNDLRQEVSLVENGDQVTKGFNSFGHI 655

Query: 649 MSDSYSAGYYGYMWAEVFAADMYHTRFAADPLDSKAGVQYRDIVLGRGGLYETNDNLREF 708
           MS +YSAGYYGYMWAEVFAADMYHT+FAADPL+   GV+YRDIVL RGGLYE +DNLREF
Sbjct: 656 MSGAYSAGYYGYMWAEVFAADMYHTKFAADPLNGDVGVRYRDIVLSRGGLYEIDDNLREF 715

Query: 709 LGREPSEEAFLKELGLN 725
           LGREP+ EAFLKELGL+
Sbjct: 716 LGREPNNEAFLKELGLS 732

>KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9
           YCL057W
          Length = 744

 Score =  991 bits (2563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/685 (68%), Positives = 555/685 (81%), Gaps = 3/685 (0%)

Query: 43  SPNLFIAPQSAPSWAFTPQSLLDETHRLIESSKQFYDSLAQLSNPTVENLVKPYMHHENG 102
           SP L     + P W F    + +E  R+IES+ +FYD L ++SNP+++NLVKPYM+HEN 
Sbjct: 58  SPQLVPPAGALPRWEFPSAKIGEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHENS 117

Query: 103 VGLIESQLTFPQQVSADKEIRDASVQATEFLQNFGIEQSLRHDLFLQFDKIWNELKDKS- 161
           +GL+ +QL F Q VS+DKEIR+AS +ATE LQNF IE SLRHDLFLQFDKIW ELK +  
Sbjct: 118 IGLMVNQLCFLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKE 177

Query: 162 -FEQGSQEYEIYKYVEKIHRDYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGEQKE 220
            F    +++EIYK+VEK H+D+ R GL L E+ R+KVK +KIKIA+NSLEFSKNLGEQKE
Sbjct: 178 EFSHDEEQFEIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQKE 237

Query: 221 FVAFTKEELDGVSESVMDQFEQFKDENGT-TKYKVTFKYPDIFPVLKTAKNPKTRKLAFA 279
           F+ F+KE+LDGVS++VM+QFEQ KDE    T YKVTFKYPDIFPVLK AKN +TRK AF 
Sbjct: 238 FLLFSKEQLDGVSDTVMEQFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFC 297

Query: 280 RDQDKVPQNEKLFVETLQLRNELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLK 339
            DQ+KVPQNE+LFV TL+LR+ELA +LGY TYANYNLE+KMAK Q  V+KFLN+LKDKLK
Sbjct: 298 GDQNKVPQNEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVFKFLNDLKDKLK 357

Query: 340 PLGLKEAENLKQIKQKECESLGLPYDGHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPIE 399
           PLG KE   LK IK+ EC+ LG+P+DG YY+WDHR            VD E I+EYYPI+
Sbjct: 358 PLGEKEIGILKSIKEAECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPID 417

Query: 400 STISGMLSIYETLLKLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHP 459
           STI GML IYET+ KLKFVEE D  K++VW+EDVKQ+AVWKMDN   P FVGWIYFDLHP
Sbjct: 418 STIEGMLKIYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHP 477

Query: 460 RDGKYGHAANFGISASYVKEDGTRSYPVTALVCNFXXXXXXXXXXXXHNEISTFFHELGH 519
           RDGKYGHAANFGI++SY++EDG+RSYPVTALVCNF            HNEI+TFFHELGH
Sbjct: 478 RDGKYGHAANFGIASSYIREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELGH 537

Query: 520 GIHDLVGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNERELHELSSHYESGEKIPKDLL 579
           GIHDLVG+NR   FNGPGA PWDFVEAPSQMLEF+TW++  L  LS HY++GE+IP+ LL
Sbjct: 538 GIHDLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLL 597

Query: 580 QSLISTKHVDGALFALRQLHFGLFDMYVHTSKNVAKLDLLKLWNELREEVSLVENGDTFT 639
            SLI+TKHV+GALFALRQLHFGLFDM VHTSK+VA LDLLKLW +LR+E+SLVENG  +T
Sbjct: 598 DSLIATKHVNGALFALRQLHFGLFDMTVHTSKDVASLDLLKLWGDLRQEISLVENGGQYT 657

Query: 640 KGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTRFAADPLDSKAGVQYRDIVLGRGGLY 699
           KGYDSFGHIMSDSYSAGYYGYMWAEVFA DMY T+FA +PLDS  G++YRDIVL  GGLY
Sbjct: 658 KGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGLY 717

Query: 700 ETNDNLREFLGREPSEEAFLKELGL 724
           E +DNL+EFLGREPS++AFLKELGL
Sbjct: 718 EIDDNLKEFLGREPSKDAFLKELGL 742

>KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9
           YCL057W
          Length = 723

 Score =  972 bits (2514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/727 (66%), Positives = 568/727 (78%), Gaps = 9/727 (1%)

Query: 2   LLRSCSRVAGFTRKSIFSVVAVPALAIGIYRVSKFQYSTMSSPNLFIAPQSAPSWAFTPQ 61
           +L   SR+   +RKS  S+V +PA +   Y V    YS M+  + FIAPQ+APSW + P 
Sbjct: 1   MLNRLSRLVIPSRKSFLSLVCIPATS---YLVYNRLYSNMTI-SAFIAPQAAPSWNWNPS 56

Query: 62  SLLDETHRLIESSKQFYDSLAQLSNPTVENLVKPYMHHENGVGLIESQLTFPQQVSADKE 121
            LL +   +I++S + YD L+ L  PTVENLV+PYM HEN +  + ++L F Q VS D +
Sbjct: 57  RLLFDAECVIDNSNRLYDELSSLKKPTVENLVRPYMIHENKISPLINKLCFLQHVSEDPK 116

Query: 122 IRDASVQATEFLQNFGIEQSLRHDLFLQFDKIWNELKDKSFEQGSQ-EYEIYKYVEKIHR 180
           IR+AS++ATE LQ F IE SLRHDLFLQFDKIW E+ +K  +   + ++E +K++EK+H+
Sbjct: 117 IREASLKATELLQKFEIEASLRHDLFLQFDKIWQEISEKKDDFVKEYDFETWKFIEKVHK 176

Query: 181 DYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGEQKEFVAFTKEELDGVSESVMDQF 240
           DY R GL LPEDKR+K+K++KIKI  NSL++SKNLGEQKE +AFT+EELDGVS++V +QF
Sbjct: 177 DYVRSGLNLPEDKREKIKEIKIKIGNNSLQYSKNLGEQKELIAFTREELDGVSDAVFEQF 236

Query: 241 EQFKDE-NGTTKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETLQLR 299
           E+F DE  G  K+KVTFKYPDIFPVLKTAKNP+TR+ AF  DQ+KVPQNE LFVETL+LR
Sbjct: 237 EKFIDEETGEEKFKVTFKYPDIFPVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLR 296

Query: 300 NELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEAENLKQIKQKECES 359
           NELA  L YSTYANYNLE KMAK Q+ V  FLN+LK +LKPL +KE   LK IKQKEC+ 
Sbjct: 297 NELATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLAMKEISILKDIKQKECKE 356

Query: 360 LGLPYDGHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPIESTISGMLSIYETLLKLKFVE 419
           L   YD HYY++DHR            VDLE ISEYYP+E TI+GML IYE L KLKF E
Sbjct: 357 LNREYDSHYYIYDHRYYDNKYLKDNFNVDLEAISEYYPLEHTINGMLKIYEELFKLKFNE 416

Query: 420 ETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKYGHAANFGISASYVK- 478
           ET  + +SVWHEDVKQLAVWKMDNP KPEFVGWIYFDLHPRDGKYGHAANFGIS+SYV  
Sbjct: 417 ET--KNKSVWHEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRDGKYGHAANFGISSSYVDI 474

Query: 479 EDGTRSYPVTALVCNFXXXXXXXXXXXXHNEISTFFHELGHGIHDLVGENRLTTFNGPGA 538
           E G RSYPVTALVCNF            HNEI+TFFHELGHGIHDLVG+N+L+ FNGPGA
Sbjct: 475 ETGKRSYPVTALVCNFSKSTATRPSLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGA 534

Query: 539 VPWDFVEAPSQMLEFWTWNERELHELSSHYESGEKIPKDLLQSLISTKHVDGALFALRQL 598
            PWDFVEAPSQMLEFWTWN  EL  LS HYES EKIP DLL SLI TKHV+GALFALRQL
Sbjct: 535 TPWDFVEAPSQMLEFWTWNANELKSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQL 594

Query: 599 HFGLFDMYVHTSKNVAKLDLLKLWNELREEVSLVENGDTFTKGYDSFGHIMSDSYSAGYY 658
           HFGLFDM VHT+ NV  L+LLKLWNELREE+ LVE G   +KGYDSFGHIMSDSYSAGYY
Sbjct: 595 HFGLFDMTVHTTNNVESLNLLKLWNELREEICLVETGHELSKGYDSFGHIMSDSYSAGYY 654

Query: 659 GYMWAEVFAADMYHTRFAADPLDSKAGVQYRDIVLGRGGLYETNDNLREFLGREPSEEAF 718
           GYMWAEVFAADMYHT+F+ +PLDS+ GVQYRDIVL  GGLYE  DNLR+FLGREPS+ AF
Sbjct: 655 GYMWAEVFAADMYHTKFSPNPLDSEVGVQYRDIVLANGGLYEIADNLRDFLGREPSKNAF 714

Query: 719 LKELGLN 725
           LKELGL+
Sbjct: 715 LKELGLD 721

>TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {ON}
           Anc_1.9 YCL057W
          Length = 747

 Score =  966 bits (2497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/731 (63%), Positives = 573/731 (78%), Gaps = 17/731 (2%)

Query: 11  GFTRKSIF-SVVAVPALAIGIYRVSK--FQYSTMSSPNL----FIAPQSAPSWAFTPQSL 63
            F  KSI  S+VA+PA+AIGIY  +    ++ T S   +    FIAPQ +P W F+P+ +
Sbjct: 16  SFKNKSILLSLVAIPAVAIGIYHQNNQGLRFYTASQVKMNEAAFIAPQLSPKWDFSPERI 75

Query: 64  LDETHRLIESSKQFYDSLAQLSNPTVENLVKPYMHHENGVGLIESQLTFPQQVSADKEIR 123
           L +  ++I++S  FY+++  + NP++EN V P ++ EN   L  +QLTF Q VS DK IR
Sbjct: 76  LSDAKKIIDTSNDFYNAMVAIENPSIENFVIPSINFENENSLAINQLTFLQHVSKDKLIR 135

Query: 124 DASVQATEFLQNFGIEQSLRHDLFLQFDKIWNELKD-KSFEQ----GSQEYEIYKYVEKI 178
           DAS++ATE + NF IE SLR+D+F QFDKI+N+LKD K +        ++YEI+KYVEK 
Sbjct: 136 DASLEATELITNFDIEISLRYDMFKQFDKIFNDLKDNKKYNDLKTATPKDYEIFKYVEKC 195

Query: 179 HRDYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGEQKEFVAFTKEELDGVSESVMD 238
           H+DY R GL L E+KR+++K++K +IA NSL+FSKNLGEQ EFVAFTKEEL+GVS+ VM 
Sbjct: 196 HKDYVRSGLNLSEEKRNEIKEIKKRIALNSLQFSKNLGEQNEFVAFTKEELEGVSDDVMK 255

Query: 239 QFEQFKDE-NGTTKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETLQ 297
           QFE + DE  G  K+KVTFKYPDIFPVLKTAKNP TRK+AF  DQ+KVP+NEKLF++TL+
Sbjct: 256 QFETYTDEQTGEQKFKVTFKYPDIFPVLKTAKNPNTRKIAFNADQNKVPENEKLFIDTLK 315

Query: 298 LRNELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEAENLKQIKQKEC 357
           LR +L  ILGY TYANYNL++KMAKNQ+ V +FL +LKDKLKPL  KE E LK IK+ E 
Sbjct: 316 LRYQLGKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKLKPLAEKEIEVLKAIKKTEA 375

Query: 358 ESLGLPYDGHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPIESTISGMLSIYETLLKLKF 417
           + L + YD HYY+WDHR            VDLEKISEYYP+ESTI GML IYET++ LKF
Sbjct: 376 QELNMAYDDHYYIWDHRYYDNKYLKDKFNVDLEKISEYYPVESTIQGMLKIYETVMNLKF 435

Query: 418 VEETDPEKRSVWH-EDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKYGHAANFGISASY 476
           +EETD + +S W  +DVKQLAVWKMD+PSKPEFVGWIYFDLHPR+GKYGHAANFG++ SY
Sbjct: 436 IEETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPREGKYGHAANFGMAPSY 495

Query: 477 VKEDGTRSYPVTALVCNFXXXXXXXXXXXXHNEISTFFHELGHGIHDLVGENRLTTFNGP 536
           + +D  R YPVTALVCNF            HNEI+TFFHELGHGIHDLVG N +  FNGP
Sbjct: 496 IDKDSKRIYPVTALVCNFSAATADKPALLKHNEITTFFHELGHGIHDLVGNNGIGRFNGP 555

Query: 537 GAVPWDFVEAPSQMLEFWTWNERELHELSSHYESGEKIPKDLLQSLISTKHVDGALFALR 596
           GAVPWDFVEAPSQMLEFWTWN+ EL  LS HY++GEKIP+ LL+SLI+TKHV+GALFALR
Sbjct: 556 GAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPESLLESLIATKHVNGALFALR 615

Query: 597 QLHFGLFDMYVHTSKN---VAKLDLLKLWNELREEVSLVENGDTFTKGYDSFGHIMSDSY 653
           QLHFGLFDM VHT+ +   +  +DL++LWN LREE+SLVENGD   KGYDSFGHIMSDSY
Sbjct: 616 QLHFGLFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVENGDEMNKGYDSFGHIMSDSY 675

Query: 654 SAGYYGYMWAEVFAADMYHTRFAADPLDSKAGVQYRDIVLGRGGLYETNDNLREFLGREP 713
           SAGYYGYMWAEVFA DMY+++FA DPL++K+G++YRDI+L RGG+ ETNDNL+EFLGREP
Sbjct: 676 SAGYYGYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARGGIRETNDNLKEFLGREP 735

Query: 714 SEEAFLKELGL 724
           S+EAFLKELGL
Sbjct: 736 SKEAFLKELGL 746

>TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa]
           {ON} Anc_1.9 YCL057W
          Length = 741

 Score =  961 bits (2485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/681 (69%), Positives = 553/681 (81%), Gaps = 4/681 (0%)

Query: 49  APQSAPSWAFTPQSLLDETHRLIESSKQFYDSLAQLSNPTVENLVKPYMHHENGVGLIES 108
           APQ+AP+W +TP  L+ +   LI+ S  FYD+L  L +P   N + PYM++EN VG + +
Sbjct: 61  APQAAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKVGSLIN 120

Query: 109 QLTFPQQVSADKEIRDASVQATEFLQNFGIEQSLRHDLFLQFDKIWNELKDKS--FEQGS 166
           QLTF Q VS++K+IRDAS +AT+ LQNF IE SLR+ LFLQFDKIWN++KD    +E+  
Sbjct: 121 QLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKYEKDP 180

Query: 167 QEYEIYKYVEKIHRDYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGEQKEFVAFTK 226
           ++ E Y++V K+HRD+ R GL L E KR+K+K++K  IA NSL+F+ NLGEQ EFVAFTK
Sbjct: 181 KDLENYEFVRKVHRDFVRAGLNLDESKREKIKEIKKAIANNSLKFATNLGEQTEFVAFTK 240

Query: 227 EELDGVSESVMDQFEQFKDE-NGTTKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDKV 285
           EELDGVS+SVM+QFE+F DE  G   YKVTFKYPDIFPVLKTA+NP+TRK AFA DQ+KV
Sbjct: 241 EELDGVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGDQNKV 300

Query: 286 PQNEKLFVETLQLRNELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKE 345
            +N  LF  TL+LRN+LADILGYSTYANYNLELKMAK QD+V+KFL +L D+LKPLG KE
Sbjct: 301 SENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPLGSKE 360

Query: 346 AENLKQIKQKECESLGLPYDGHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPIESTISGM 405
            E LK IK+KE + L LP+D HYYVWDHR            VDLEKISEYYP++STI GM
Sbjct: 361 IEILKSIKEKEFKELNLPFDNHYYVWDHRYYDNKYLKDNYNVDLEKISEYYPLDSTIEGM 420

Query: 406 LSIYETLLKLKFVEETDPEK-RSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKY 464
           L+IYETLL LKF+EE D  K ++VWH++VKQLAVWKMDNP  PEFVGWIYFDLHPRDGKY
Sbjct: 421 LNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRDGKY 480

Query: 465 GHAANFGISASYVKEDGTRSYPVTALVCNFXXXXXXXXXXXXHNEISTFFHELGHGIHDL 524
           GHAANFGIS+SY+K +  RSYPVTALVCNF            HNEI+TFFHELGHGIHDL
Sbjct: 481 GHAANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGHGIHDL 540

Query: 525 VGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNERELHELSSHYESGEKIPKDLLQSLIS 584
           VG+N  + FNGPGAVPWDFVEAPSQMLEFWTWN+ EL  LS HY++GEKIP +LL SL++
Sbjct: 541 VGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLNSLVA 600

Query: 585 TKHVDGALFALRQLHFGLFDMYVHTSKNVAKLDLLKLWNELREEVSLVENGDTFTKGYDS 644
           TKHV+GALFALRQLHFGLFDM VHTSK++  LD LKLWNELREEVSLVENGD FTKGYDS
Sbjct: 601 TKHVNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGDLFTKGYDS 660

Query: 645 FGHIMSDSYSAGYYGYMWAEVFAADMYHTRFAADPLDSKAGVQYRDIVLGRGGLYETNDN 704
           FGHIMSDSYSAGYYGYMWAEVFA DMY+T+FAA+PL++K GV+YRD VL RGGLYE  DN
Sbjct: 661 FGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGLYEIEDN 720

Query: 705 LREFLGREPSEEAFLKELGLN 725
           L +FLGR+PS EAFLKELGLN
Sbjct: 721 LIQFLGRKPSNEAFLKELGLN 741

>KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057W PRD1
           Zinc metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 712

 Score =  935 bits (2417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/716 (62%), Positives = 559/716 (78%), Gaps = 8/716 (1%)

Query: 9   VAGFTRKSIFSVVAVPALAIGIYRVSKFQYSTMSSPNLFIAPQSAPSWAFTPQSLLDETH 68
           +A    KS  S+V +P LA   ++ +  + S M+  + F+ PQ+APSW +T + LL +TH
Sbjct: 5   LANLRFKSATSLVVIPTLAFASFQFNAIR-SIMTKTD-FVVPQAAPSWNYTTEELLKQTH 62

Query: 69  RLIESSKQFYDSLAQLSNPTVENLVKPYMHHENGVGLIESQLTFPQQVSADKEIRDASVQ 128
             I+SS +  DSL  +SNP+VEN V PY+HHEN +  + +QLTF Q VS+DKE+RD S +
Sbjct: 63  EAIDSSNELLDSLESISNPSVENFVTPYLHHENTISPLFNQLTFLQHVSSDKELRDTSTK 122

Query: 129 ATEFLQNFGIEQSLRHDLFLQFDKIWNELKDKSFEQGSQEYEIYKYVEKIHRDYTRDGLQ 188
            TE ++NFGIE SLR  LF QFD +WN+LKD + +     +EIYK+VEK H+D+ R GL 
Sbjct: 123 VTELIENFGIESSLRFKLFRQFDIVWNQLKDDA-QFKKDHFEIYKFVEKCHKDFLRSGLN 181

Query: 189 LPEDKRDKVKQLKIKIAANSLEFSKNLGEQKEFVAFTKEELDGVSESVMDQFEQFKDENG 248
           LPE++RDKVK++K KI+ NSL+FSKNLGEQ EF+ FTKEEL GVSE+VM QFE   DE+G
Sbjct: 182 LPEEQRDKVKEIKKKISNNSLQFSKNLGEQNEFITFTKEELIGVSENVMKQFETV-DEDG 240

Query: 249 TTKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETLQLRNELADILGY 308
            TKYKVTFKYPDIFPVLK+AKN +TRK AF  DQ+KVPQNE LF+ETLQLRN+LA++L Y
Sbjct: 241 ITKYKVTFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQLRNDLAELLNY 300

Query: 309 STYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEAENLKQIKQKECESLGLPYDGHY 368
            +YA+YNL++KMAK ++ V  FLN+LK+KLKPLG KE   LK +K++EC+ L  PYD  Y
Sbjct: 301 DSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPLGEKELTKLKNLKEEECKELNTPYDRRY 360

Query: 369 YVWDHRXXXXXXXXXXXXVDLEKISEYYPIESTISGMLSIYETLLKLKFVEETDPEKRSV 428
           Y+WD+R            +D EKI+EY+P+ESTI GML IYET+LKLKF+EE + +    
Sbjct: 361 YIWDNRYYDNQYLKKNFQIDEEKIAEYFPLESTIKGMLQIYETVLKLKFIEEDNGD---T 417

Query: 429 WHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKYGHAANFGISASYVKEDGTRSYPVT 488
           WH DVK+L+VWKMD+ + P FVGWIYFDLHPR+GKYGHAANFGIS+S++K DG+RSYPVT
Sbjct: 418 WHPDVKKLSVWKMDD-NFPSFVGWIYFDLHPREGKYGHAANFGISSSFLKSDGSRSYPVT 476

Query: 489 ALVCNFXXXXXXXXXXXXHNEISTFFHELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPS 548
           ALVCNF            H+E++TFFHELGHGIHDLVG N +  FNGP A PWDFVEAPS
Sbjct: 477 ALVCNFSKPTKDKPALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPS 536

Query: 549 QMLEFWTWNERELHELSSHYESGEKIPKDLLQSLISTKHVDGALFALRQLHFGLFDMYVH 608
           QMLEFWTWN++EL  LS HY++ EKIP  LL SL+ TKH++GALFALRQLHFGLFDM VH
Sbjct: 537 QMLEFWTWNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQLHFGLFDMKVH 596

Query: 609 TSKNVAKLDLLKLWNELREEVSLVENGDTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFAA 668
           T+K+++KL++ +LWN LREE+ L++NGD  TKG++SFGHIMSDSYSAGYYGYMWA+VFA+
Sbjct: 597 TTKDISKLNVTELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFAS 656

Query: 669 DMYHTRFAADPLDSKAGVQYRDIVLGRGGLYETNDNLREFLGREPSEEAFLKELGL 724
           DMY+T+F  DPL+S  GVQYRDI+L RGGLYE  DNL EFLGR+P+ +AFLKELGL
Sbjct: 657 DMYYTKFLEDPLNSDVGVQYRDIILARGGLYEIEDNLTEFLGRKPNNKAFLKELGL 712

>NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9
          Length = 740

 Score =  934 bits (2415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/688 (64%), Positives = 557/688 (80%), Gaps = 4/688 (0%)

Query: 39  STMSSPNLFIAP-QSAPSWAFTPQSLLDETHRLIESSKQFYDSLAQLSNPTVENLVKPYM 97
           +T+++ + FIAP  + P W +TP+ +LDET   IE + ++Y+S++++ +P++ENL+ PYM
Sbjct: 55  NTVNNKHGFIAPANTVPDWTWTPKQILDETKSYIEKTNKYYNSISEIESPSIENLIIPYM 114

Query: 98  HHENGVGLIESQLTFPQQVSADKEIRDASVQATEFLQNFGIEQSLRHDLFLQFDKIWNEL 157
           ++EN +GL+ +QLTF Q VSADK+IRDAS++AT  L++  I  SLR +++ QF+K+W  +
Sbjct: 115 NYENKMGLLINQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKVWETV 174

Query: 158 KDKSFEQGSQEYEIYKYVEKIHRDYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGE 217
           ++      + ++E YK++EKIH+D  R+GL+   ++  ++K +K KI+A++L FS NLGE
Sbjct: 175 QNDDDFLKNHQFETYKFIEKIHKDSLRNGLK--SERNYQLKYIKGKISADALTFSSNLGE 232

Query: 218 QKEFVAFTKEELDGVSESVMDQFEQFKD-ENGTTKYKVTFKYPDIFPVLKTAKNPKTRKL 276
           Q E+V+FTKEELDGVSE+VMDQFE+F D +    KYKVTFKYPDIFPVLKTAKNPKTRK+
Sbjct: 233 QNEYVSFTKEELDGVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTRKI 292

Query: 277 AFARDQDKVPQNEKLFVETLQLRNELADILGYSTYANYNLELKMAKNQDNVWKFLNELKD 336
           AF  DQ+KVP+NEKL    L+LR ELA+ LGYSTYANYNL++KMAKNQ+ V KFLN+LK+
Sbjct: 293 AFLGDQNKVPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDLKE 352

Query: 337 KLKPLGLKEAENLKQIKQKECESLGLPYDGHYYVWDHRXXXXXXXXXXXXVDLEKISEYY 396
           KLKPL  KE + LK +K+KECE LG+PYDGHYY+WDHR            VD+EKISEYY
Sbjct: 353 KLKPLAEKEIKILKDLKKKECEELGIPYDGHYYIWDHRYYDNKYLKDNFNVDIEKISEYY 412

Query: 397 PIESTISGMLSIYETLLKLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFD 456
           P+ESTI GML IYET+L LKF+EETDP  ++VWH DVKQL+VW MD+ + P FVGWIYFD
Sbjct: 413 PLESTIDGMLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFD 472

Query: 457 LHPRDGKYGHAANFGISASYVKEDGTRSYPVTALVCNFXXXXXXXXXXXXHNEISTFFHE 516
           L+PRDGKYGHAANFGI++SY+ E+  RSYPVTALVCNF            H+EI+TFFHE
Sbjct: 473 LYPRDGKYGHAANFGIASSYITEENKRSYPVTALVCNFSKPTKNKPALLKHSEITTFFHE 532

Query: 517 LGHGIHDLVGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNERELHELSSHYESGEKIPK 576
           LGHGIHDLVG+N+   FNGPG+VPWDFVEAPSQMLEFWTWN+ EL  LS HY++GEKIP+
Sbjct: 533 LGHGIHDLVGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPE 592

Query: 577 DLLQSLISTKHVDGALFALRQLHFGLFDMYVHTSKNVAKLDLLKLWNELREEVSLVENGD 636
           DLL SLISTKHV+GALFALRQLHFGLFDM VHT+K++  LDLLKLWNE REE+ LVENG+
Sbjct: 593 DLLDSLISTKHVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKLWNESREEICLVENGE 652

Query: 637 TFTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTRFAADPLDSKAGVQYRDIVLGRG 696
            FTKGY+SFGHI+SDSYSAGYYGYMWAEVFAADMYHT+FA +PLD   G++YRD++L +G
Sbjct: 653 NFTKGYNSFGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKG 712

Query: 697 GLYETNDNLREFLGREPSEEAFLKELGL 724
           GLYE NDNL EFLGREPS + FLKELGL
Sbjct: 713 GLYEINDNLLEFLGREPSNKPFLKELGL 740

>YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc
           metalloendopeptidase, found in the cytoplasm and
           intermembrane space of mitochondria; with Cym1p,
           involved in degradation of mitochondrial proteins and of
           presequence peptides cleaved from imported proteins
          Length = 712

 Score =  878 bits (2269), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/705 (59%), Positives = 540/705 (76%), Gaps = 7/705 (0%)

Query: 22  AVPALAIGIYRVSKFQYSTMSSPNLFIAPQSAPSWAFTPQSLLDETHRLIESSKQFYDSL 81
           A P ++  +Y  ++  YS  ++ +  IAPQ+ P+W+FTP  +  +T+ +I +S  FYDS+
Sbjct: 11  ASPVISPLLY--TRSLYSMANTTSFPIAPQAPPNWSFTPSDISGKTNEIINNSNNFYDSM 68

Query: 82  AQLSNPTVENLVKPYMHHENGVGLIESQLTFPQQVSADKEIRDASVQATEFLQNFGIEQS 141
           +++ +P+V N V+P+M  EN +G I +QLTF Q VS+DKEIRDASV ++  L    I+ S
Sbjct: 69  SKVESPSVSNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLS 128

Query: 142 LRHDLFLQFDKIWNELKDKSFEQGSQEYEIYKYVEKIHRDYTRDGLQLPEDKRDKVKQLK 201
           LRHD+FLQF ++W +++ K+    S E E +KYVEK ++DY   GL+L E  R K+K++K
Sbjct: 129 LRHDIFLQFARVWQDVQSKA---DSVERETFKYVEKSYKDYIHSGLELDEGNRLKIKEIK 185

Query: 202 IKIAANSLEFSKNLGEQKEFVAFTKEELDGVSESVMDQFEQFKDENGT--TKYKVTFKYP 259
            KI+ NS+ FSKNLGEQKE++ FTKE+L+GV +S++ QFE  K +  +  T YKVTFKYP
Sbjct: 186 KKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKVTFKYP 245

Query: 260 DIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETLQLRNELADILGYSTYANYNLELK 319
           DIFPV+K A + +TRK AF  DQ+KVP+NE + ++TL+LR+ELA +LGY TYANYNL  K
Sbjct: 246 DIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANYNLYDK 305

Query: 320 MAKNQDNVWKFLNELKDKLKPLGLKEAENLKQIKQKECESLGLPYDGHYYVWDHRXXXXX 379
           MA++   V  FLN+LKDKL PLG KE + L+ +K ++ + L    D +YY+WDHR     
Sbjct: 306 MAEDSTTVMNFLNDLKDKLIPLGRKELQVLQDMKAEDVKKLNQGADPNYYIWDHRYYDNK 365

Query: 380 XXXXXXXVDLEKISEYYPIESTISGMLSIYETLLKLKFVEETDPEKRSVWHEDVKQLAVW 439
                  VDLEKISEY+P+E+TI+GML IYETL  LKF+E  D + +SVWH+DVKQ+AVW
Sbjct: 366 YLLENFNVDLEKISEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVKQIAVW 425

Query: 440 KMDNPSKPEFVGWIYFDLHPRDGKYGHAANFGISASYVKEDGTRSYPVTALVCNFXXXXX 499
            MD+P  P FVGWIYFDLHPRDGKYGHAANFG+S+S++ +D TRSYPVTALVCNF     
Sbjct: 426 NMDDPKSPNFVGWIYFDLHPRDGKYGHAANFGLSSSFMIDDTTRSYPVTALVCNFSKSTK 485

Query: 500 XXXXXXXHNEISTFFHELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNER 559
                  HNEI TFFHELGHGIHDLVG+N+ + FNGPG+VPWDFVEAPSQMLEFWTWN+ 
Sbjct: 486 DKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKN 545

Query: 560 ELHELSSHYESGEKIPKDLLQSLISTKHVDGALFALRQLHFGLFDMYVHTSKNVAKLDLL 619
           EL  LSSHY++GEKIP+ L+ SLI TKHV+GALF LRQLHFGLFDM VHT K++  L + 
Sbjct: 546 ELINLSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSIC 605

Query: 620 KLWNELREEVSLVENGDTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTRFAADP 679
             WN+LR+++SL+ NG T +KGYDSFGHIMSDSYSAGYYGY+WAEVFA DMYHT+FA DP
Sbjct: 606 DTWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDP 665

Query: 680 LDSKAGVQYRDIVLGRGGLYETNDNLREFLGREPSEEAFLKELGL 724
           L++K G+QYRDIVL RGGLY+ NDNL+EFLGREPS++AFLKELGL
Sbjct: 666 LNAKNGIQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGL 710

>Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W
           (REAL)
          Length = 712

 Score =  874 bits (2257), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/706 (59%), Positives = 530/706 (75%), Gaps = 9/706 (1%)

Query: 22  AVPALAIGIYRVSKFQYSTMSSPNLFIAPQSAPSWAFTPQSLLDETHRLIESSKQFYDSL 81
           A P +   +Y  ++F  S  ++ +   APQ+ PSW+FTP  +   T  +IE S +FYDS+
Sbjct: 11  ASPVITPLLY--TRFLSSMTTTASFPTAPQTPPSWSFTPNDISGRTKEIIEKSNKFYDSM 68

Query: 82  AQLSNPTVENLVKPYMHHENGVGLIESQLTFPQQVSADKEIRDASVQATEFLQNFGIEQS 141
           +Q+ +P V N V+P+M  EN +G I +QLTF Q VS+DKEIRDASV ++  L    I+ S
Sbjct: 69  SQVESPAVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVDSSMKLDELNIDLS 128

Query: 142 LRHDLFLQFDKIWNELKDKSFEQGSQEYEIYKYVEKIHRDYTRDGLQLPEDKRDKVKQLK 201
           LRHD+FLQF ++W   +D   +  S E E ++Y+EK ++DY   GL+L E  R KVK++K
Sbjct: 129 LRHDVFLQFARVW---QDAQSQADSIERETFRYIEKSYKDYIHSGLELDEPDRLKVKEIK 185

Query: 202 IKIAANSLEFSKNLGEQKEFVAFTKEELDGVSESVMDQFEQF---KDENGTTKYKVTFKY 258
            KI+ NS+ FSKNLGEQKEF+ FTKE+L+GV +S++ QFE     KD N T  YKVTFKY
Sbjct: 186 KKISVNSINFSKNLGEQKEFITFTKEQLEGVPDSILAQFETIESGKDSNETL-YKVTFKY 244

Query: 259 PDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETLQLRNELADILGYSTYANYNLEL 318
           PDIFPV+K A + +TRK AF  DQ+KV +NE + ++TL+LR+E+A +LGY TYANYNL  
Sbjct: 245 PDIFPVMKLASSSQTRKQAFLADQNKVSENEAILLDTLKLRDEVASLLGYDTYANYNLYD 304

Query: 319 KMAKNQDNVWKFLNELKDKLKPLGLKEAENLKQIKQKECESLGLPYDGHYYVWDHRXXXX 378
           KMAK+   V  FLN+LK KL PLG KE + L+ +K K+ +      D +YY+WDHR    
Sbjct: 305 KMAKDSTTVMDFLNDLKKKLIPLGEKELQILQDMKAKDVKKRNQDEDPNYYIWDHRYYDN 364

Query: 379 XXXXXXXXVDLEKISEYYPIESTISGMLSIYETLLKLKFVEETDPEKRSVWHEDVKQLAV 438
                   VDLEKISE++P+E+TI+GML IYETL  LKF+E  +P+++SVWHEDVKQLAV
Sbjct: 365 KYLLENFNVDLEKISEFFPLETTITGMLQIYETLFNLKFIETKNPQEKSVWHEDVKQLAV 424

Query: 439 WKMDNPSKPEFVGWIYFDLHPRDGKYGHAANFGISASYVKEDGTRSYPVTALVCNFXXXX 498
           W MD+P  P F+GWIYFDLHPRDGKYGHAANFG+S+S++  D TRSYPVTALVCNF    
Sbjct: 425 WNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMVNDTTRSYPVTALVCNFSKST 484

Query: 499 XXXXXXXXHNEISTFFHELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNE 558
                   HNEI TFFHELGHGIHDLVG+N+ + FNGPG+VPWDFVEAPSQMLEFWTWN+
Sbjct: 485 KDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNK 544

Query: 559 RELHELSSHYESGEKIPKDLLQSLISTKHVDGALFALRQLHFGLFDMYVHTSKNVAKLDL 618
            EL  LSSHY++GEKIP+ L+ SLI TKHV+GALF LRQLHFGLFDM VH+ K++  L +
Sbjct: 545 NELMHLSSHYKTGEKIPEPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHSCKDLQNLSI 604

Query: 619 LKLWNELREEVSLVENGDTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTRFAAD 678
              WN+LR+++SL+ NG T +KGY SFGHIMSDSYSAGYYGY+WAEVFA DMYHT+FA D
Sbjct: 605 CDTWNQLRQDISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKD 664

Query: 679 PLDSKAGVQYRDIVLGRGGLYETNDNLREFLGREPSEEAFLKELGL 724
           PL++K G+QYRDIVL RGGL + ND+L+EFLGREPS++AFLKELGL
Sbjct: 665 PLNTKNGIQYRDIVLARGGLRDINDSLKEFLGREPSKDAFLKELGL 710

>CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057w PRD1
           proteinase yscD
          Length = 743

 Score =  870 bits (2248), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/728 (60%), Positives = 544/728 (74%), Gaps = 21/728 (2%)

Query: 13  TRKSIFSVVAVPALAI--GI-----YRVSKFQYSTMSS------PNLFIAPQSAPSWAFT 59
           ++K+ F+++A+P      GI     Y  S   YS +++      P+L   PQ  PSW F 
Sbjct: 20  SKKTTFALIALPLFVSYRGIHLNNTYTSSIRNYSQLANTRFTNMPSL-TPPQYPPSWEFK 78

Query: 60  PQSLLDETHRLIESSKQFYDSLAQLSNPTVENLVKPYMHHENGVGLIESQLTFPQQVSAD 119
           P+ +L +T   I ++K FYD L  + NPT+ENL+ PY++HEN   L+ +QLTF Q VS D
Sbjct: 79  PEDILSQTKEFIANTKLFYDDLVAIDNPTIENLIVPYINHENENELLINQLTFLQHVSED 138

Query: 120 KEIRDASVQATEFLQNFGIEQSLRHDLFLQFDKIWNELKDKSFEQGSQEYEIYKYVEKIH 179
           K IRDAS++AT  LQ+F IE   R DLF QFD IWN++KDK  E   +++EI+++VEK H
Sbjct: 139 KTIRDASMEATMLLQDFEIESGSRVDLFKQFDLIWNQIKDKKDE--FEDFEIWRFVEKCH 196

Query: 180 RDYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGEQKEFVAFTKEELDGVSESVMDQ 239
           +DY R GL LP DK +KVK++K KIA N L+FSKNLGEQKE++ FT EEL GV ESV++Q
Sbjct: 197 KDYVRAGLNLPADKLEKVKEIKKKIADNCLKFSKNLGEQKEYILFTAEELKGVPESVIEQ 256

Query: 240 FEQFKDENGTTKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETLQLR 299
           FE+  DE G  K KVT+KYPDIFPVLK A+NP+TR  AF  DQ+KVP+NE LF +TL+LR
Sbjct: 257 FEKVNDEFGIQKLKVTYKYPDIFPVLKNAQNPETRMKAFMGDQNKVPENEHLFKDTLKLR 316

Query: 300 NELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEAENLKQIKQKECES 359
           NELA +LGY TYANYNL++KMAKN D V  F+N+L  KL+    KE + LK +K++E E+
Sbjct: 317 NELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPAKKELDILKNLKKQEFEN 376

Query: 360 -LGLPYDGHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPIESTISGMLSIYETLLKLKFV 418
              + YDG YY+WDHR            VD EKI+EYYP+ESTI GML IYETLLKLKFV
Sbjct: 377 EFNMVYDGDYYIWDHRYYDNKYLKENFNVDEEKIAEYYPLESTIDGMLKIYETLLKLKFV 436

Query: 419 EETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKYGHAANFGISASYVK 478
           E    E +  WH+DVKQLAVWK+D P  PEFVGWI+FDLHPRDGKYGHAANFG+S+SY+ 
Sbjct: 437 EVK--ENKKTWHDDVKQLAVWKLDTPENPEFVGWIFFDLHPRDGKYGHAANFGLSSSYIS 494

Query: 479 EDGTRSYPVTALVCNFXXXXXXXXXXXXHNEISTFFHELGHGIHDLVGENRLTTFNGPGA 538
            +GTRSYP+TALVCNF            H+EI+TFFHELGHGIHDLVG NR+  FNGPGA
Sbjct: 495 ANGTRSYPITALVCNFSKSTKDKPSLLKHSEITTFFHELGHGIHDLVGNNRIGRFNGPGA 554

Query: 539 VPWDFVEAPSQMLEFWTWNERELHELSSHYESGEKIPKDLLQSLISTKHVDGALFALRQL 598
           VPWDFVEAPSQMLEFWTWN +EL  LS +Y+   KI   LL+SLI TKHV+GALFALRQL
Sbjct: 555 VPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLESLIKTKHVNGALFALRQL 614

Query: 599 HFGLFDMYVH--TSKNVAKLDLLKLWNELREEVSLVENGDTFTKGYDSFGHIMSDSYSAG 656
           HFGLFDM VH  +++ + KLD+ KLWN+LRE++ L+ NGD  T GY+SFGHIMS SYSAG
Sbjct: 615 HFGLFDMKVHMMSAEELDKLDIKKLWNDLREKICLISNGDQPTTGYNSFGHIMSGSYSAG 674

Query: 657 YYGYMWAEVFAADMYHTRFAADPLDSKAGVQYRDIVLGRGGLYETNDNLREFLGREPSEE 716
           YYGYMWAEVFA DMY+T+F ADPL+ + GV+YRDIVL RGGLYE +DNL EFLGR+P+++
Sbjct: 675 YYGYMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGGLYEIDDNLEEFLGRKPAKD 734

Query: 717 AFLKELGL 724
           AFL+ELGL
Sbjct: 735 AFLEELGL 742

>Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score =  866 bits (2237), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/689 (60%), Positives = 525/689 (76%), Gaps = 5/689 (0%)

Query: 38  YSTMSSPNLFIAPQSAPSWAFTPQSLLDETHRLIESSKQFYDSLAQLSNPTVENLVKPYM 97
           YS  ++ +  IAPQ+ P+W FTP  +  +T  +I+ S  FY+S++ +  PTV N V+P+M
Sbjct: 25  YSMSNATSFPIAPQAPPNWTFTPNDINGKTKEIIDKSNNFYESMSNVETPTVTNFVEPFM 84

Query: 98  HHENGVGLIESQLTFPQQVSADKEIRDASVQATEFLQNFGIEQSLRHDLFLQFDKIWNEL 157
             EN +G I +QLTF Q VS+DKEIRDASV ++  L    I+ SLRHD++LQF ++W + 
Sbjct: 85  KFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIYLQFARVWQDA 144

Query: 158 KDKSFEQGSQEYEIYKYVEKIHRDYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGE 217
           + KS    S E E +KY+EK ++DY   GL+L E  R K+K +K KI+ NS+ FSKNLGE
Sbjct: 145 QSKS---DSIERETFKYIEKSYKDYIHSGLELDESNRLKIKDIKKKISVNSINFSKNLGE 201

Query: 218 QKEFVAFTKEELDGVSESVMDQFEQFKDEN--GTTKYKVTFKYPDIFPVLKTAKNPKTRK 275
           QKE++ FTKE+L+GV +SV+ QFE  K +     T YKVTFKYPDIFPV+K A + +TRK
Sbjct: 202 QKEYITFTKEQLEGVPDSVLAQFETIKSDKDRNETLYKVTFKYPDIFPVMKLASSAQTRK 261

Query: 276 LAFARDQDKVPQNEKLFVETLQLRNELADILGYSTYANYNLELKMAKNQDNVWKFLNELK 335
            AF  DQ+KVP+NE + ++TL+LR++LA +LGY TYANYNL  KMAK+   V  FLN+LK
Sbjct: 262 EAFLADQNKVPENEAILLDTLELRDKLASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLK 321

Query: 336 DKLKPLGLKEAENLKQIKQKECESLGLPYDGHYYVWDHRXXXXXXXXXXXXVDLEKISEY 395
           DKL PLG KE E L+++K K+ + L    D +YY+WDHR            VDLEKISEY
Sbjct: 322 DKLIPLGKKELELLQEMKSKDVKKLNQDEDPNYYIWDHRYYDNKYLLENFNVDLEKISEY 381

Query: 396 YPIESTISGMLSIYETLLKLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYF 455
           +P+E+TI+GML IYETL  LKF+E  D + +SVWH+DVKQLAVW MD+P  P+FVGWIYF
Sbjct: 382 FPLETTITGMLQIYETLFNLKFIEIKDGQSKSVWHDDVKQLAVWNMDDPKSPKFVGWIYF 441

Query: 456 DLHPRDGKYGHAANFGISASYVKEDGTRSYPVTALVCNFXXXXXXXXXXXXHNEISTFFH 515
           DLHPRDGKYGHAANFG+S+S++  D  RSYPVTALVCNF            HNEI TFFH
Sbjct: 442 DLHPRDGKYGHAANFGLSSSFMTNDSVRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFH 501

Query: 516 ELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNERELHELSSHYESGEKIP 575
           ELGHGIHDLVG+N+ + FNGPG+VPWDFVEAPSQMLEFWTWN+ EL +LSSHYE+GEKIP
Sbjct: 502 ELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIDLSSHYETGEKIP 561

Query: 576 KDLLQSLISTKHVDGALFALRQLHFGLFDMYVHTSKNVAKLDLLKLWNELREEVSLVENG 635
           + L+ SLI TKHV+GALF LRQLHFGLFDM VHT K++  L + + WN+LR+++SL+ NG
Sbjct: 562 ESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICETWNQLRQDISLISNG 621

Query: 636 DTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTRFAADPLDSKAGVQYRDIVLGR 695
            T +KGYDSFGHIMSDSYSAGYYGY+WAEVFA DMYHT+FA DPL++K G+QYRDIVL R
Sbjct: 622 GTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLAR 681

Query: 696 GGLYETNDNLREFLGREPSEEAFLKELGL 724
           GGL +  D+L++FLGREPS++AFLKELGL
Sbjct: 682 GGLNDIGDDLKKFLGREPSKDAFLKELGL 710

>Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score =  860 bits (2221), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/689 (60%), Positives = 528/689 (76%), Gaps = 6/689 (0%)

Query: 39  STMSSPNLF-IAPQSAPSWAFTPQSLLDETHRLIESSKQFYDSLAQLSNPTVENLVKPYM 97
           S M++   F IAPQ+ P+W+FTP  +  +T  +I+ S +FY+ ++Q+ +P+V N ++P+M
Sbjct: 25  SAMTNAASFPIAPQAPPTWSFTPTDIGGKTTEIIDKSNKFYELMSQVESPSVTNFIEPFM 84

Query: 98  HHENGVGLIESQLTFPQQVSADKEIRDASVQATEFLQNFGIEQSLRHDLFLQFDKIWNEL 157
             EN +G I ++LTF Q VS+DKEIRDASV ++  L    I+ SLRHD+FLQF ++W + 
Sbjct: 85  KFENELGPIINRLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDIFLQFARVWQDA 144

Query: 158 KDKSFEQGSQEYEIYKYVEKIHRDYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGE 217
           + K+    S + E +KY+EK ++D+   GL+L E  R K+K++K KI+ NS+ FSKNLGE
Sbjct: 145 QPKA---DSLKKETFKYIEKSYKDFIHSGLELDEANRLKIKEIKKKISMNSINFSKNLGE 201

Query: 218 QKEFVAFTKEELDGVSESVMDQFEQFKDENG--TTKYKVTFKYPDIFPVLKTAKNPKTRK 275
           QKE++ FTKE+L+GV +S++ QFE  K E G   T YKVTFKYPDIFPV+K A + +TRK
Sbjct: 202 QKEYITFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKVTFKYPDIFPVMKLASSAQTRK 261

Query: 276 LAFARDQDKVPQNEKLFVETLQLRNELADILGYSTYANYNLELKMAKNQDNVWKFLNELK 335
            AF  DQ+KVP+NE + ++TL+LR+ELA +LGY+TYA+YNL  KMAK+   V  FLN+LK
Sbjct: 262 QAFLADQNKVPENEAILLDTLKLRDELASLLGYNTYADYNLYDKMAKDSRTVMDFLNDLK 321

Query: 336 DKLKPLGLKEAENLKQIKQKECESLGLPYDGHYYVWDHRXXXXXXXXXXXXVDLEKISEY 395
            KL PLG KE + L+ +K K+ E      D +YY+WDHR            VDLEKISEY
Sbjct: 322 GKLIPLGKKELQVLQDMKVKDVERSKKDEDPNYYIWDHRYYDNKHLLENFNVDLEKISEY 381

Query: 396 YPIESTISGMLSIYETLLKLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYF 455
           +P+E+TI+GML IYETL  LKF+E  +P+ +SVWHEDVKQLAVW MD+P  P F+GWIYF
Sbjct: 382 FPLETTITGMLQIYETLFNLKFIETKEPQNKSVWHEDVKQLAVWNMDDPKSPRFIGWIYF 441

Query: 456 DLHPRDGKYGHAANFGISASYVKEDGTRSYPVTALVCNFXXXXXXXXXXXXHNEISTFFH 515
           DLHPRDGKYGHAANFG+S+S++  D  RSYPVTALVCNF            HNEI TFFH
Sbjct: 442 DLHPRDGKYGHAANFGLSSSFMINDSKRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFH 501

Query: 516 ELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNERELHELSSHYESGEKIP 575
           ELGHGIHDLVG+N+ + FNGPG+VPWDFVEAPSQMLEFWTWN+ EL  LSSHY++GE+IP
Sbjct: 502 ELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELVSLSSHYKTGERIP 561

Query: 576 KDLLQSLISTKHVDGALFALRQLHFGLFDMYVHTSKNVAKLDLLKLWNELREEVSLVENG 635
           + L+ SLI TKHV+GALF LRQLHFGLFDM VHT K++  L +   WN+LR+E+SL+ NG
Sbjct: 562 ESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLENLSICHTWNQLRQEISLMPNG 621

Query: 636 DTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTRFAADPLDSKAGVQYRDIVLGR 695
            T +KGYDSFGHIMSDSYSAGYYGY+WAEVFA DMYHT+FA DPL++K GVQYRDIVL R
Sbjct: 622 GTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQYRDIVLAR 681

Query: 696 GGLYETNDNLREFLGREPSEEAFLKELGL 724
           GGLY+ NDNL+EFLGREPS++AFLKELGL
Sbjct: 682 GGLYDINDNLKEFLGREPSKDAFLKELGL 710

>Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to
           Ashbya gossypii AGR406C/ AGR405C
          Length = 716

 Score =  818 bits (2112), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/723 (55%), Positives = 516/723 (71%), Gaps = 7/723 (0%)

Query: 2   LLRSCSRVAGFTRKSIFSVVAVPALAIGIYRVSKFQYSTMSSPNLFIAPQSAPSWAFTPQ 61
           +L+   R       +  S + +PALAI   R    Q   MSS    ++P+ APSW F   
Sbjct: 1   MLQFLKRFNILKNSATVSFLLLPALAIAGNRSVHNQERNMSS---LLSPKLAPSWDFAAD 57

Query: 62  SLLDETHRLIESSKQFYDSLAQLSNPTVENLVKPYMHHENGVGLIESQLTFPQQVSADKE 121
            ++    + I+   +FYDS+A L  P +EN V   + HE+      SQLTF Q VSADKE
Sbjct: 58  EIVSLAQKAIDEGTKFYDSVASLETPDLENFVVAVIDHEDETDGYMSQLTFLQHVSADKE 117

Query: 122 IRDASVQATEFLQNFGIEQSLRHDLFLQFDKIWNELKDKSFEQGSQEYEIYKYVEKIHRD 181
           +RDAS++AT+ +Q +GIE S R+DL+ QF K+W + KD        + E+Y Y+E +++D
Sbjct: 118 VRDASIEATKLIQEWGIETSSRYDLYSQFSKVWEQYKDDE-NLKKNDPELYWYMENVNKD 176

Query: 182 YTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGEQKEFVAFTKEELDGVSESVMDQFE 241
           Y   G+ LPE+ R+K+K++K K+A NSL FS NLGEQ +++AFTK+EL GVSE+ + QFE
Sbjct: 177 YIHAGMGLPEESRNKIKEIKKKLANNSLAFSNNLGEQNDYIAFTKDELVGVSETTLGQFE 236

Query: 242 QFKDENGTTKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETLQLRNE 301
           +   E+G  KYK+TFKYPDI PVL TAKNP+TRK A+  DQ+KVPQNE++ +ETL+LRNE
Sbjct: 237 KVI-EDGVEKYKMTFKYPDIHPVLNTAKNPETRKRAYIGDQNKVPQNEQILIETLKLRNE 295

Query: 302 LADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEAENLKQIKQKECESLG 361
           LA+I G+ TYA+Y LE+KMAK Q+ V+ FL +LKDKL P G K+ ENLK +K++E + LG
Sbjct: 296 LAEIHGHPTYASYQLEMKMAKKQETVFNFLYDLKDKLLPGGKKDLENLKSLKEQEYKELG 355

Query: 362 LPYDGHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPIESTISGMLSIYETLLKLKFVEET 421
           LPY+G +  WD+R            VD E++++Y+P++ TI GML+IY+ L  LKFVEET
Sbjct: 356 LPYNGSFNSWDYRYYDDKYLKENFDVDEEELAKYFPLQHTIDGMLNIYQKLFNLKFVEET 415

Query: 422 DPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKYGHAANFGISASYVKEDG 481
               ++VWHEDVKQ AVW +D    PEFVGWIYFDLHPR+GKYGHAANFG+ + YV E+G
Sbjct: 416 RECGKNVWHEDVKQFAVWDLDK-CNPEFVGWIYFDLHPREGKYGHAANFGLYSPYVTEEG 474

Query: 482 TRSYPVTALVCNFXXXXXXXXXXXXHNEISTFFHELGHGIHDLVGENRLTTFNGPGAVPW 541
           TR YPVT LVCNF            H E+ TFFHELGHGIH LVG++R+   NGP ++PW
Sbjct: 475 TRHYPVTVLVCNFSKPSSTRPALLKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPW 534

Query: 542 DFVEAPSQMLEFWTWNERELHELSSHYESGEKIPKDLLQSLISTKHVDGALFALRQLHFG 601
           DFVEAPSQMLEFW WN+ ++ +LS HYE+GE+IP +L+ SLI TKHV+  L  LRQLHF 
Sbjct: 535 DFVEAPSQMLEFWPWNKDQILKLSKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFS 594

Query: 602 LFDMYVHTSKNVAKLDLLKLWNELREEVSLVENGDTFTKGYDSFGHIMSDSYSAGYYGYM 661
           LFDM VHT K + KLD+  LWN LREEV+L+ NGD  TKGYDSF HIMS  YSAGYYGYM
Sbjct: 595 LFDMTVHTDKELDKLDIKSLWNNLREEVTLISNGDVLTKGYDSFSHIMS-GYSAGYYGYM 653

Query: 662 WAEVFAADMYHTRFAADPLDSKAGVQYRDIVLGRGGLYETNDNLREFLGREPSEEAFLKE 721
           W+EVFAADMYHT FA +PLD+  G +YRDI+L +GGL +  D+L EFLGREP+ +AFLKE
Sbjct: 654 WSEVFAADMYHTMFAPNPLDTSVGTRYRDIILAKGGLRDIEDSLEEFLGREPNNKAFLKE 713

Query: 722 LGL 724
           LGL
Sbjct: 714 LGL 716

>AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 683

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/679 (50%), Positives = 473/679 (69%), Gaps = 6/679 (0%)

Query: 47  FIAPQSAPSWAFTPQSLLDETHRLIESSKQFYDSLAQLSNPTVENLVKPYMHHENGVGLI 106
            + PQ+APSW F+ Q ++  +H+LI  ++  Y ++ Q   PT++N + P ++HE    L+
Sbjct: 7   LVPPQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHEEETDLL 66

Query: 107 ESQLTFPQQVSADKEIRDASVQATEFLQNFGIEQSLRHDLFLQFDKIWNELKD-KSFEQG 165
            +QL F + VS D EIR+AS  AT  L ++ I  + ++DL+  FD++W + KD + F++ 
Sbjct: 67  WNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYKDDEKFKK- 125

Query: 166 SQEYEIYKYVEKIHRDYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGEQKEFVAFT 225
            + +E+Y+Y+EK    Y R G+++P + R ++ ++K KIAA  LEFS NLGE+ E++AFT
Sbjct: 126 -ENFELYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVEYIAFT 184

Query: 226 KEELDGVSESVMDQFEQFKDENGTTKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDKV 285
           KEEL+GV ++V++QFE+   E G  K+KVTFKYPDI PVL+ A NP+TR+ A   D+++V
Sbjct: 185 KEELEGVPDTVLNQFEKII-EGGVEKFKVTFKYPDIGPVLRLASNPETRRRASMADENRV 243

Query: 286 PQNEKLFVETLQLRNELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKE 345
             NE L  ETL+LR ELAD+LG+  +A YNL+ KMAKN++ V KFLN+L +KL P+G  +
Sbjct: 244 AANEPLLFETLELRRELADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKND 303

Query: 346 AENLKQIKQKECESLGLPYDGHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPIESTISGM 405
            E LK+ K ++ +S  L +DG +Y WD              V+ + +++Y+P+ES I GM
Sbjct: 304 LEILKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFPVESAIEGM 363

Query: 406 LSIYETLLKLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKYG 465
           L+IY TL +LKFVE TD  ++SVWHEDVKQ AVW +D+   P+F GW+YFDLHPRDGKYG
Sbjct: 364 LNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDGKYG 423

Query: 466 HAANFGISASYVKEDGTRSYPVTALVCNFXXXXXXXXXXXXHNEISTFFHELGHGIHDLV 525
           HAANFG+ ++Y K DG++SYPVT LV NF              E++TFFHELGHGIHDLV
Sbjct: 424 HAANFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHELGHGIHDLV 483

Query: 526 GENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNERELHELSSHYESGEKIPKDLLQSLIST 585
           G N L + NGPG+VPWDFVEAPSQMLE+WT     L  LS HYE+GEKIPK LL +  S 
Sbjct: 484 GSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLDAWFSV 543

Query: 586 KHVDGALFALRQLHFGLFDMYVHTSKNVAKLDLLKLWNELREEVSLVENGDTFTKGYDSF 645
             ++  L  L QL  GLFDMYVHT ++    ++ KLWN+L  E+ L+   +  + GYDSF
Sbjct: 544 GGLNSGLANLGQLKLGLFDMYVHT-RDYKGAEVRKLWNDLTREIGLMNLKNYTSTGYDSF 602

Query: 646 GHIMSDSYSAGYYGYMWAEVFAADMYHTRFAADPLDSKAGVQYRDIVLGRGGLYETNDNL 705
           GHIM+  Y+AGYYGY+W++VFAADMY T+F  +P ++  GV+YRD +L  GGLY+  DNL
Sbjct: 603 GHIMA-GYAAGYYGYLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGLYDMTDNL 661

Query: 706 REFLGREPSEEAFLKELGL 724
           R+FLGR+P+ +AFL+ LGL
Sbjct: 662 RKFLGRDPNNKAFLRGLGL 680

>AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 717

 Score =  660 bits (1704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/680 (47%), Positives = 450/680 (66%), Gaps = 4/680 (0%)

Query: 47  FIAPQSAPSWAFTPQSLLDETHRLIESSKQFYDSL-AQLSNPTVENLVKPYMHHENGVGL 105
            + PQ  P W +T   ++D  + L + S   Y+S+ +Q    T++N + P ++++    L
Sbjct: 12  LVPPQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETDL 71

Query: 106 IESQLTFPQQVSADKEIRDASVQATEFLQNFGIEQSLRHDLFLQFDKIWNELKDKSFEQG 165
           + +QL F + VS D ++R+AS+   + L  +    S ++DL+  F+ IW + KD   E  
Sbjct: 72  LWNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQYKDDE-EFK 130

Query: 166 SQEYEIYKYVEKIHRDYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGEQKEFVAFT 225
              YE+YKY+EK    Y R+   L   +  ++ Q+  KI+ ++L+FS NLGE+ E++ FT
Sbjct: 131 VTNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGEETEYITFT 190

Query: 226 KEELDGVSESVMDQFEQFKDENGTTKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDKV 285
           +EEL+GVS  V+DQFE+   E G  K KVTFKYPDI PVL+TA NP+TR+ A+  DQ++V
Sbjct: 191 EEELEGVSPLVLDQFERII-EGGVKKLKVTFKYPDIGPVLRTATNPETRRKAYVADQNRV 249

Query: 286 PQNEKLFVETLQLRNELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKE 345
             NE+L  ETL LR  +A + GY  YA YNL  KMAKN++ V  FL +L ++L P+G K+
Sbjct: 250 AANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGEKD 309

Query: 346 AENLKQIKQKECESLGLPYDGHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPIESTISGM 405
            E LK  K ++ +S  L +DG  Y WD+             +D E +++Y+PIES I GM
Sbjct: 310 REILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPIESVIEGM 369

Query: 406 LSIYETLLKLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKYG 465
           L  Y+TL +LKFVE TDP +++VWHEDVKQ AVW +D+   PEF GWIYFDL+PRDGKY 
Sbjct: 370 LDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRDGKYS 429

Query: 466 HAANFGISASYVKEDGTRSYPVTALVCNFXXXXXXXXXXXXHNEISTFFHELGHGIHDLV 525
           HAANFG+++++ K+DG++SYPVT LVCN               EI+T FHELGHGIH LV
Sbjct: 430 HAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHELGHGIHHLV 489

Query: 526 GENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNERELHELSSHYESGEKIPKDLLQSLIST 585
             N+L   N  G+VPWDFVEAPSQMLE+WT     L  LS HYE+GEKIP  LL +  ++
Sbjct: 490 ANNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDAWFNS 549

Query: 586 KHVDGALFALRQLHFGLFDMYVHTSKNVAKLDLLKLWNELREEVSLVENGDTFTKGYDSF 645
             +   L+ L QL  GLFDMYVHT +    L++ KLWN++R E+SL+ + +  + GY++F
Sbjct: 550 SGLGSGLYYLGQLRLGLFDMYVHT-REYHGLEVRKLWNDMRREISLINSQNYTSTGYNTF 608

Query: 646 GHIMSDSYSAGYYGYMWAEVFAADMYHTRFAADPLDSKAGVQYRDIVLGRGGLYETNDNL 705
           GHIM+ SYSAGYYGY+W++VFAADMY T+F ++P +S  G QYRD +L  GGLY+ NDNL
Sbjct: 609 GHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYDMNDNL 668

Query: 706 REFLGREPSEEAFLKELGLN 725
           R+FLGREP+  AFL+ LG N
Sbjct: 669 RKFLGREPNNRAFLRGLGFN 688

>ABR185W Chr2
           (758126..758380,758380..758709,758709..759029,
           759033..759122,759122..759499) [1374 bp, 457 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); 3-intron; artificial frameshift
          Length = 457

 Score =  377 bits (968), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 211/467 (45%), Positives = 283/467 (60%), Gaps = 18/467 (3%)

Query: 265 LKTAKNPK---TRKLAFARDQDKVPQNEKLFVETLQLRNELADI-LGYSTYANYNLELKM 320
           + T K P+   +  L+ A+  DKV   +       ++  ELA++ L     A Y LE+K 
Sbjct: 1   MSTVKIPQPAPSWDLSPAQINDKV---QTALESAARMFAELANVKLPTVETAAYVLEVKT 57

Query: 321 AKNQDNVWKFLNELKDKLKPLGLKEAENLKQIKQKECESLGLPYDGHYYVWDHRXXXXXX 380
           AKN DNV  FLN+L++KLKP        LK++K++EC+ LG  YDG  Y  D        
Sbjct: 58  AKNVDNVNSFLNDLREKLKPASADNWRPLKKLKEQECKELGNFYDGELYSQDLCYYEQKL 117

Query: 381 XXXXXXVDLEKISEYYPIESTISGMLSIYETLLKLKFVEETDPEKRSVWHEDVKQLAVWK 440
                 VD E+ ++Y+P+E TI  ML  Y TL +  FVEET+P  R+VWHED KQ +VWK
Sbjct: 118 LRDNFSVDEEETAQYFPLEHTIKFMLDTYNTLFRHNFVEETEPATRNVWHEDDKQYSVWK 177

Query: 441 MDNPSKPEFVGWIYFDLHPRDGKYGHAANFGISASYVKEDGTRSYPVTALVCNFXXXXXX 500
           MD+   P+F GW+YFDLHPRDGK+GH A F    + + E+G+R YPVT+LVCNF      
Sbjct: 178 MDDWDAPQFTGWLYFDLHPRDGKFGHLACFDNVYTDMSEEGSRVYPVTSLVCNFSNPSKE 237

Query: 501 XXXXXXHNEISTFFHELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNERE 560
                 H E+  FFHELGHG H L+    L        VP DF+EAPSQMLE+W W +  
Sbjct: 238 KPALLKHYEVQAFFHELGHGSHKLLCAPELCC--SSSWVPRDFIEAPSQMLEYWIWRKDV 295

Query: 561 LHELSSHYESGEKIPKDLLQSLISTKHVDGALFALRQLHFGLFDMYVHTSKNVAK---LD 617
           + +LS H E+GE+IP+ L+  ++ +K  + A+  L Q+   L DM VH  K+V     LD
Sbjct: 296 ITDLSKH-ETGERIPESLVDCMVKSKRANAAIDNLIQV-LALLDMAVH--KHVGSYETLD 351

Query: 618 LLKLWNELREEVSLVENGDTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTRFAA 677
           L  LWN L E+V L++N +  T+ Y SF HI+ + Y+AGYYGY W++VFAADMY +RF  
Sbjct: 352 LNALWNNLCEDVILIKNPEP-TRAYCSFSHIV-EGYAAGYYGYQWSKVFAADMYFSRFEK 409

Query: 678 DPLDSKAGVQYRDIVLGRGGLYETNDNLREFLGREPSEEAFLKELGL 724
             LD   G  Y D ++ RGGLYE  DNL EFL REP+ EA+L++ GL
Sbjct: 410 AHLDPTLGKLYGDTIIARGGLYEMEDNLGEFLDREPNNEAYLRDQGL 456

 Score = 38.5 bits (88), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%)

Query: 50 PQSAPSWAFTPQSLLDETHRLIESSKQFYDSLAQLSNPTVE 90
          PQ APSW  +P  + D+    +ES+ + +  LA +  PTVE
Sbjct: 7  PQPAPSWDLSPAQINDKVQTALESAARMFAELANVKLPTVE 47

>NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {ON}
           Anc_1.9 YCL057W
          Length = 778

 Score =  194 bits (492), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 153/557 (27%), Positives = 249/557 (44%), Gaps = 54/557 (9%)

Query: 180 RDYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGE-QKEFVAFTKEELD--GVSESV 236
           +D+ + G+ +   K+D+   L   I+    E+  N+ +  +  +   + ELD  G+   V
Sbjct: 209 QDFIKSGIYMDSGKKDQFITLSQDISVIGQEYINNINQLARNHIKVKRSELDNAGIEFDV 268

Query: 237 MDQFEQFKDENGTTKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETL 296
             Q    KD  G   YK+       F +LK   +P+ RK  +    D   Q  +     +
Sbjct: 269 ACQLG--KDITGKY-YKIPTYGHLPFLILKACTDPEIRKKIWVAMHDCSKQQIERLTNLV 325

Query: 297 QLRNELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEAENLKQIKQK- 355
           ++R  LA  +G   YA Y ++ KMAKN  +V +FL  L D LKP   KE + +  +    
Sbjct: 326 KIRAFLAHTMGRECYAAYAIDGKMAKNPKDVDEFLKSLMDFLKPKAAKELKFISDLIHNE 385

Query: 356 ----------ECESLGLPYDGHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPIESTISGM 405
                     E  +   P+D  YY   HR            +D+     YYP+ + I G+
Sbjct: 386 KGEKPSDDVDEILTAVRPWDREYYTAIHRNKQKHLLLDDYALDV-----YYPLGNVIQGL 440

Query: 406 LSIYETLLKLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKYG 465
             I+E++  ++F E     K   W  DV++L V       K   +G IY DL  R GK  
Sbjct: 441 SDIFESIYGIRF-EPAVAGKGETWSSDVRRLNVVS----EKEGLIGIIYCDLFRRQGKTN 495

Query: 466 HAANFGISAS---YVKE------------DGTR-SYPVTALVCNFXXXXXX---XXXXXX 506
           +AA+F I  S   Y  E            DGT+   P+ +L+CNF               
Sbjct: 496 NAAHFTICCSRQIYPHEDDFSTIQLGTNVDGTKFQLPIISLLCNFNTRCLNSGETICLLA 555

Query: 507 HNEISTFFHELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNERELHELSS 566
            NEI T FHE+GH IH ++G  RL   +G      DFVE PS ++E +  + R L  +  
Sbjct: 556 LNEIETLFHEMGHAIHSMLGRTRLQNVSGT-RCSTDFVELPSVLMEHFARDTRVLKRIGH 614

Query: 567 HYESGEKIPKDLLQSLISTKHVDGALFALRQLHFGLFDMYVH---TSKNVAKLDLLKLWN 623
           HY++G+++P  LL   +             Q    + D  ++     +N+  +D++K+++
Sbjct: 615 HYKTGDRVPATLLNRYLEKARFLKDCETFSQAKMAMLDQRLYDKNIVQNIDSVDVVKIYH 674

Query: 624 ELREEVSLVENGDTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTRFAADPLDSK 683
           EL +E+ ++ + +  +     FGH+    Y A YY Y++    A+ ++   F  DP    
Sbjct: 675 ELEKELEVLVDDE--SNWCAKFGHLF--GYGATYYCYLFDRAIASKVWKKLFEKDPYSRS 730

Query: 684 AGVQYRDIVLGRGGLYE 700
            G ++++ VL  GGL E
Sbjct: 731 GGEKFKNDVLKWGGLRE 747

>KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {ON}
           Anc_2.432 YKL134C
          Length = 789

 Score =  187 bits (474), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 149/558 (26%), Positives = 255/558 (45%), Gaps = 63/558 (11%)

Query: 181 DYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLG-EQKEFVAFTKEELD--GVSESVM 237
           D+ + G+ +  D RD+  ++   I+    +F  N    + EF+    EELD  GVS  ++
Sbjct: 222 DFEKSGIYMSTDTRDRFIEMSQDISLVGQDFINNTNWLRSEFIEIASEELDNSGVSPILL 281

Query: 238 DQFEQFKDENGTTKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETLQ 297
               Q       T YKV       + +L++ KN   RK  +        +        ++
Sbjct: 282 ---RQLTTTVRGTHYKVPAYGTAPYIILRSCKNENARKAVWTALHSCPDKQINRLTHMVK 338

Query: 298 LRNELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEAENLKQIKQKEC 357
           +R+ L++I+G   +A Y L+ KMAK+ +NV  F+  L +  KP+    AE LK +   + 
Sbjct: 339 MRSVLSNIMGKVGFAVYQLQGKMAKSPENVLNFITRLMEHTKPMA---AEELKLLANMKL 395

Query: 358 ESLGLP--------------YDGHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPIESTIS 403
             LGLP              +D  YYV   +             + E I+ Y+ + S + 
Sbjct: 396 NDLGLPEANSEKEILETVRPWDRDYYVAKSQQTRKAKNQL---TNHEPINAYFTLGSVLE 452

Query: 404 GMLSIYETL--LKLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRD 461
           G+ ++++++  + L+ V     E    W  +V+++ V   +N      +G +Y DL  R 
Sbjct: 453 GLSNLFKSIYGISLEVVASIPGE---TWSSEVRRVNVKTENN----NIIGVVYCDLFERK 505

Query: 462 GKYGHAANFGISAS---YVKED-------GTRS------YPVTALVCNFXXXXXXXXXXX 505
            K    A+F +  S   Y +E+       G  S       P+ +LVCNF           
Sbjct: 506 AKTSSPAHFTVCCSRELYAEENDPSILQSGVNSRGEKFQLPIISLVCNFARTSDNELCLL 565

Query: 506 XHNEISTFFHELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNERELHELS 565
             +EI T FHE+GH +H ++G+ +L   +G      DFVE PS ++E +  + R L  + 
Sbjct: 566 QLSEIETLFHEMGHAMHSMLGQTKLQNISGTRCTT-DFVELPSIIMEHFARDPRVLKGIG 624

Query: 566 SHYESGEKIPKDLL-QSLISTKHVDGA-LFALRQLHFGLFDMYVHTSK---NVAKLDLLK 620
            HY + EK+P+DLL + L ST+++     FA  Q    + D  ++ +    +V  LD+++
Sbjct: 625 RHYITKEKVPEDLLAEELNSTRYLQNCETFA--QAKMAMLDQRLYDNNIIFHVRDLDVVE 682

Query: 621 LWNELREEVSLVENGDTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTRFAADPL 680
           L+++L   + ++ +  T   G   FGH+    Y A YY Y+     AA ++   F  DP 
Sbjct: 683 LYHDLERNLEVLVDDQTNWCG--KFGHLF--GYGATYYSYLLDRAIAAKIWDCLFVNDPF 738

Query: 681 DSKAGVQYRDIVLGRGGL 698
               G  +++ VL  GGL
Sbjct: 739 SRTGGENFKNAVLKWGGL 756

>TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.432
           YKL134C
          Length = 773

 Score =  179 bits (453), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 165/620 (26%), Positives = 281/620 (45%), Gaps = 57/620 (9%)

Query: 112 FPQQVSADKEIRDASVQATEFLQNFGIEQSLRHDLFLQFDKIWNELKDKSFEQGSQEYEI 171
           F +    +K    A+ +  E +  +    +L  D+ L  D++   L +K   +   + EI
Sbjct: 143 FIRSCHPEKSFVQAAQECHEHM--YAFMNTLNTDIAL-CDRLRTVLDNKEVLKRLTDEEI 199

Query: 172 YKYVEKIHRDYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLG-EQKEFVAFTKEELD 230
            K  + +  D+ + G+Q+  + RD+   L   I+    +F  N    +K+++    +E D
Sbjct: 200 -KVGKLLLEDFEKSGIQMSPEIRDRFISLSQDISLAGQDFLNNTSYTEKDYIKIKCDEFD 258

Query: 231 GVSESVMDQFEQFKDENGTTKYKVTFKYPDI-FPVLKTAKNPKTRK---LAFARDQDKVP 286
              +    +++  KD +G  KY     Y  I +  L   K+ + RK   +AF    +K  
Sbjct: 259 KACDYPALKYKLSKDLSG--KYYKIPTYGKIPYTALLKCKDEELRKKLWVAFHSCSNK-- 314

Query: 287 QNEKLFVETLQLRNELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEA 346
           Q E+L  + ++ R ELA +L  S+Y+ Y LE KMAK    V  FLN L   + P   KE 
Sbjct: 315 QIERL-TKIIKHRIELAKLLSKSSYSEYTLEGKMAKGPKEVNNFLNALLKSILPEVTKE- 372

Query: 347 ENLKQIKQKECESLGLPYD-------GHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPIE 399
             L+ I  K+C S G   +        +   WD                +  I EY+ + 
Sbjct: 373 --LEPISNKKCLSEGFSLETSEQSILNNIKPWDRDYYNPIQATSEGAYQM-LIMEYFTLG 429

Query: 400 STISGMLSIYETLLKLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHP 459
           + I G+ +++ ++  ++F E    E    W +DV++L V   D       +G IY DL  
Sbjct: 430 NIIHGLSNLFNSIYGIRF-EPGKIEDGETWSKDVRKLNVISEDEG----LIGVIYCDLFE 484

Query: 460 RDGKYGHAANFGISAS---YVKEDGTRSY--------------PVTALVCNFXXXXXXXX 502
           R+GK    +++ I  S   Y +E    +               P+ +LVCNF        
Sbjct: 485 REGKSESPSHYTICCSREIYSEEHDLSTIQTGVNNKTGKNFQLPIVSLVCNFQVTNAKES 544

Query: 503 XXXX---HNEISTFFHELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNER 559
                  H+EI T FHE+GH +H ++G  R  T +G   V  DFVE PS ++EF+  N +
Sbjct: 545 RRICFLQHHEIETLFHEMGHAMHSMLGRTRFQTISGTRCVS-DFVEIPSILMEFFANNPK 603

Query: 560 ELHELSSHYESGEKIPKDLLQSLISTKHVDGALFALRQLHFGLFDMYVHT--SKNVAKLD 617
            L ++S HY+SGE I  ++L   +       A     Q    L D  +H   + ++  +D
Sbjct: 604 VLIDISRHYDSGESIDIEVLNKYLENTKQFKACETYSQGKMALLDQRLHAENANSLDNID 663

Query: 618 LLKLWNELREEVSLVENGDTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTRFAA 677
           ++++++ L +E+S++   DT +     FGH+    Y A YY Y++    A  ++ + F  
Sbjct: 664 VVEIYHNLEKELSVLP--DTESNWCGRFGHLY--GYGALYYCYLFDRAIATKIWESLFQN 719

Query: 678 DPLDSKAGVQYRDIVLGRGG 697
           DP   K G  +++ +L  GG
Sbjct: 720 DPFSRKGGNIFKEQLLKWGG 739

>SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 767

 Score =  176 bits (446), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 143/555 (25%), Positives = 253/555 (45%), Gaps = 58/555 (10%)

Query: 181 DYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLG-EQKEFVAFTKEELD--GVSESVM 237
           D+ + G+ +  + R++   L  +I+    +F  N    +  ++    EEL+  G+++ V+
Sbjct: 199 DFEKSGIHMNPEVREQFIALSQQISVVGQDFINNTEYVRSNYIKVEVEELNKSGINKIVL 258

Query: 238 DQFEQFKDENGTTKYKV-TFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETL 296
           +Q    KD  G   YK+ TF Y   + +L++  +   R   ++       +      + +
Sbjct: 259 NQLS--KDIKGR-HYKIPTFGYIP-YSILRSCPDDNIRMKVWSALHSCSEKQIARLDQLI 314

Query: 297 QLRNELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEAENLKQIKQK- 355
           +LR+ LA+I+G  ++A+Y LE KMAK  + V  F+  L D  KP   +E + +  +K K 
Sbjct: 315 KLRSVLANIMGKKSFAHYQLEGKMAKTPEYVRGFMQSLIDATKPKAAEELKFIADLKAKH 374

Query: 356 -----------ECESLGLPYDGHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPIESTISG 404
                      E   +  P+D  +Y   H              + E+IS Y+ +   I G
Sbjct: 375 VPGNKPAESMHEILEMVKPWDRDFYGSVH------ALQQRRPFNNEQISSYFSLGVVIQG 428

Query: 405 MLSIYETLLKLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKY 464
           + ++++ +  + ++E   P+    W  +V+++ V       K   +G +Y DL  R GK 
Sbjct: 429 LSNLFKQIYGI-YLEPVVPKTGETWSPEVRRINVVS----EKEGVIGVVYCDLFERQGKT 483

Query: 465 GHAANFGISASYVKEDGTR----------------SYPVTALVCNFXXXXXXXXXXXX-- 506
            + A+F +  S    DG                    PV +LVCNF              
Sbjct: 484 ANPAHFTVCCSRQIYDGETDLSTIQVGQNSKGEQFQLPVISLVCNFSPTTISQEQSICLL 543

Query: 507 -HNEISTFFHELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNERELHELS 565
             +EI T FHE+GH +H ++G  +L   +G      DFVE PS ++E +  + R L  ++
Sbjct: 544 QLSEIETLFHEMGHAMHSMLGRTKLQNISGTRCAT-DFVELPSILMEHFARDHRVLQRMA 602

Query: 566 SHYESGEKIPKDLLQSLISTKHVDGALFALRQLHFGLFDMYVH---TSKNVAKLDLLKLW 622
           SHY +GE IP+ LL S  S         A  Q    + D  +H     K +  LD++KL+
Sbjct: 603 SHYSTGESIPEQLLFSYQSEVKFLQHAEAFSQAKMAILDQELHGESIMKEMQYLDIVKLY 662

Query: 623 NELREEVSLVENGDTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTRFAADPLDS 682
           + L  ++ ++ +  +   G   FGH+    Y A YY Y++    A+ ++   FA DP   
Sbjct: 663 HNLERQLEVLSDDKSNWCG--RFGHLF--GYGATYYSYLFDRAIASKIWQHLFANDPFCR 718

Query: 683 KAGVQYRDIVLGRGG 697
           ++G ++++ VL  GG
Sbjct: 719 RSGEKFKNSVLKWGG 733

>Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON}
           complement(11648..14011) [2364 nt, 788 aa]
          Length = 787

 Score =  173 bits (438), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 150/558 (26%), Positives = 258/558 (46%), Gaps = 63/558 (11%)

Query: 181 DYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGEQKEF-VAFTKEELD--GVSESVM 237
           D+ + G+ +  + R++   L   I+    EF  N    K+  V  +  +LD  G+   ++
Sbjct: 218 DFEKSGIYMKPEVREQFITLSQSISVIGQEFISNTDFVKDNNVVVSCNQLDSLGIDPELL 277

Query: 238 DQFEQFKDENGTTKYKV-TFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETL 296
            Q E  KD  G   YK+ T+ Y   F +LK+  + + R+  +    +   +  K   + +
Sbjct: 278 SQIE--KDIAGKN-YKIPTYGYIP-FALLKSCPSEEIREKIWVAVHNCSNEQIKRLTDLV 333

Query: 297 QLRNELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEAENL--KQIKQ 354
           +LR  L+ +LG  +YA Y LE KMAKN   V +F+  L D  KP+  KE + +  K++  
Sbjct: 334 KLRAVLSQLLGKKSYAEYQLEGKMAKNPKEVIEFIKTLMDFTKPMAAKELDGIAEKKLTI 393

Query: 355 KE-------CESLGL--PYDGHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPIESTISGM 405
           K        C+ L    P+D  YY    R               E++ +Y+ + + + G+
Sbjct: 394 KSNGSNLSVCDILKTVRPWDRDYYSAIEREQTSAKNLYGS----EEVLKYFTLGNVMQGL 449

Query: 406 LSIYETLLKLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKYG 465
            ++++ +  +K +E   P+    W  +V+++ V   D       +G IY DL  R GK  
Sbjct: 450 SNLFQKIYGIK-LELDVPKIGETWSPEVRKINVISEDEG----LIGIIYCDLFERSGKTS 504

Query: 466 HAANFGISAS-----YVKED----------GTR-SYPVTALVCNFXXXXXXXXXXXXH-- 507
           +AA+F I  S     Y  ED          GTR   P+ +LVCNF               
Sbjct: 505 NAAHFTICCSRDISPYETEDSTTQIAIDSKGTRFQLPIISLVCNFSKTMISETDSVCFLH 564

Query: 508 -NEISTFFHELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNERELHELSS 566
             E+ T FHE+GH +H ++G  +L   +G      DFVE PS ++E++  + R L  +  
Sbjct: 565 LPEVETLFHEMGHAMHSMLGRTKLQNISGTRCAT-DFVELPSILMEYFARDPRVLETIGK 623

Query: 567 HYESGEKIPKDL----LQSLISTKHVDGALFALRQLHFGLFDMYVH---TSKNVAKLDLL 619
           HY + E + +++    LQ L   +H +       Q    + D  +H    S ++  LD++
Sbjct: 624 HYLTKETVKREMLEPHLQDLKYLQHCE----TYSQAKMAMLDQTLHGETISSHLDHLDVV 679

Query: 620 KLWNELREEVSLVENGDTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTRFAADP 679
           KL+ +L  ++ ++ +  +   G   FGH+    YSA YY Y++    A+ ++   F  +P
Sbjct: 680 KLYQDLERQLGVLVDDKSNWCG--KFGHLF--GYSAVYYSYLFDRAIASKIWGALFERNP 735

Query: 680 LDSKAGVQYRDIVLGRGG 697
               +G +YR+ VL  GG
Sbjct: 736 FSRASGDKYRNSVLQWGG 753

>CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {ON}
           similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134c MIP1
          Length = 761

 Score =  170 bits (431), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 141/554 (25%), Positives = 250/554 (45%), Gaps = 55/554 (9%)

Query: 181 DYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLG-EQKEFVAFTKEELD--GVSESVM 237
           D+ + G+ +    R++  +L  +I+    EF  N     KEF+   ++E+D  G+S  + 
Sbjct: 194 DFEKSGIYMKAGIREQFIELSQQISVIGQEFINNTDYVAKEFIKVKRDEMDKSGISPLLT 253

Query: 238 DQFEQFKDENGTTKYKVTFKYPDI-FPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETL 296
            +     + + T KY     Y  I   +LK+  +   RK  +A   +      +   + +
Sbjct: 254 ARL----NRDLTGKYYKIPTYGQIPLQILKSCPDEDIRKEVWAALHNCPKAQIQRLNQLV 309

Query: 297 QLRNELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEAE--------- 347
           +LR  L+++LG  +Y++Y L+ KMA + +NV  F+  L +  KPL  +E E         
Sbjct: 310 RLRVILSNLLGKQSYSDYQLDNKMAGSPENVKGFIKTLMNVTKPLAARELEFIARDKLNA 369

Query: 348 -NLKQIKQKECESLGLPYDGHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPIESTISGML 406
            + + +   E  S+  P+D +Y+                 +  E++  Y+ + + I+G+ 
Sbjct: 370 PDSRHMSDNEILSIVKPWDKNYF-----SSKYDSDNEMAMIRDEQLRYYFSLGNVINGLS 424

Query: 407 SIYETLLKLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKYGH 466
            +++ +  +  ++ +  E    W  DV++L V       +   VG IY DL  R GK  +
Sbjct: 425 ELFKRIYGIT-LQPSRTENGETWSPDVRRLDVIS----EEEGLVGVIYCDLFERVGKISN 479

Query: 467 AANFGISAS---YVKE------------DGTR-SYPVTALVCNFXXXXXXXXXXXX---H 507
            A+F +  S   Y  E            DGT    PV +LVCNF                
Sbjct: 480 PAHFTVCCSRQVYPDENDFTTIQTGQNSDGTVFQLPVISLVCNFSTVALPNGNRTCFLHM 539

Query: 508 NEISTFFHELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNERELHELSSH 567
           NEI T FHE+GH +H ++G  RL   +G      DFVE PS ++E +  + R L  + SH
Sbjct: 540 NEIETLFHEMGHAMHSMLGRTRLQNISGTRCAT-DFVELPSILMEHFARDIRVLRTIGSH 598

Query: 568 YESGEKIPKDLLQSLISTKHVDGALFALRQLHFGLFDMYVHTS---KNVAKLDLLKLWNE 624
           YE+ E  P+ LL   +             Q    + D  +H S    ++ ++D  K++ +
Sbjct: 599 YETSEPAPEALLNDYLDKTQFLQHCETYSQAKMAMLDQKLHGSFSLSDIERIDSAKIYQK 658

Query: 625 LREEVSLVENGDTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTRFAADPLDSKA 684
           L   + ++ + ++   G   FGH+    Y A YY Y++    A+ ++ + F  DP +   
Sbjct: 659 LETRLQVLADDESNWCG--RFGHLF--GYGATYYSYLFDRAIASKVWDSLFKDDPFNRTG 714

Query: 685 GVQYRDIVLGRGGL 698
           G ++++ VL  GGL
Sbjct: 715 GEKFKERVLKWGGL 728

>NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {ON}
           Anc_2.432
          Length = 773

 Score =  169 bits (427), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 143/560 (25%), Positives = 250/560 (44%), Gaps = 66/560 (11%)

Query: 181 DYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGEQKE-FVAFTKEELD--GVSESVM 237
           D+ + G+ +  + R +   L  +I+    +F  N+   K   V     EL+  GV+  ++
Sbjct: 205 DFEKSGIYMDPNIRKQFISLSQEISLTGQDFINNIDLIKSNHVKIKCSELNKSGVNSLLL 264

Query: 238 DQFEQFKDENGTTKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETLQ 297
            Q    KD  G   YK+         ++++  +   R   +A          +     ++
Sbjct: 265 KQLP--KDITGKY-YKIPTSGYIPISLIRSCPDATIRAKVWASLHSCPNDQIRRLTHLVK 321

Query: 298 LRNELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEAENLKQIKQKEC 357
           LR  LA +L   ++A Y LE KMAK   NV  F+  L D ++P   K A+ LK +   +C
Sbjct: 322 LRAILAHLLNKCSFAKYQLEGKMAKTPQNVRDFIKTLMDYMRP---KAAQELKFMADLKC 378

Query: 358 ESLGL--------------PYDGHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPIESTIS 403
           + L +              P+D  YY   H             +++     Y+ + + + 
Sbjct: 379 KELNIPTSDSTTAILDLISPWDREYYTTIHSKAKDVNLYENHPINM-----YFTMGNIMK 433

Query: 404 GMLSIYETLLKLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPE-FVGWIYFDLHPRDG 462
           G+  I++ +  ++ +E   PE+   W  +V++L V      S+ E  +G +Y DL  R G
Sbjct: 434 GLSHIFQRIYGIR-LEAVVPEEGETWSPEVRRLNVI-----SETEGLIGVVYCDLFERAG 487

Query: 463 KYGHAANFGISASY---------------VKEDGTR-SYPVTALVCNFXXXXXX---XXX 503
           K  + A+F +  S                   DGT    PV +LVCNF            
Sbjct: 488 KTSNPAHFTVCCSRQIYPDENDLSTIQIGTNPDGTAFQLPVISLVCNFSSTLTSNDKMIC 547

Query: 504 XXXHNEISTFFHELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNERELHE 563
               NEI T FHE+GH +H ++G +RL   +G      DFVE PS ++E +  ++R LHE
Sbjct: 548 LLQLNEIETLFHEMGHAMHSMLGRSRLQNVSGTRCAT-DFVELPSILMEHFARDKRVLHE 606

Query: 564 LSSHYESGEKIPKDLLQSLISTKHVDGALFALRQLHFGLFDMYVHTSKNVAK----LDLL 619
           +  HYE+ E++ + ++++ +             Q    + D  ++ S+N+ K    +D++
Sbjct: 607 IGFHYETNERVSEYVIEAHLKKMKFLQDCETFSQGKMAMLDQELY-SENIIKDLDHVDVV 665

Query: 620 KLWNELREEVS-LVENGDTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTRFAAD 678
           K++  L E++  LV+N   +      FGH+    Y A YY Y++    A+ ++   FA D
Sbjct: 666 KIYQTLEEDLKVLVDNKSNWC---GKFGHLF--GYGASYYSYLFDRAIASKVWDQLFAKD 720

Query: 679 PLDSKAGVQYRDIVLGRGGL 698
           P   + G ++++ VL  GGL
Sbjct: 721 PFSREGGEKFKNCVLKWGGL 740

>Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {ON}
           YKL134C (REAL)
          Length = 775

 Score =  168 bits (426), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 161/616 (26%), Positives = 270/616 (43%), Gaps = 64/616 (10%)

Query: 120 KEIRDASVQATEFLQNFGIEQSLRHDL--FLQFDKIWNELKDKSFEQGSQEYEIYKYVEK 177
           K  +D   Q  EF+     + SL + L   L   KI ++L ++  + G          + 
Sbjct: 154 KAAQDCHEQMFEFMNVLNTDVSLCNMLKTVLNSPKISSKLSEEELKVG----------KI 203

Query: 178 IHRDYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLG-EQKEFVAFTKEELDGVSESV 236
           +  D+ + G+ +  D R+K  QL  +I+    EF  +        V  +  ELD  + S 
Sbjct: 204 LLDDFEKSGIYMNPDVREKFIQLSQEISLVGQEFINHTDYPGSNSVKISCRELDNSNVSA 263

Query: 237 MDQFEQFKDENGTTKYKV-TFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVET 295
               +  KD  G   YKV TF Y   + +LK+ +  + RK  +        +  K     
Sbjct: 264 FLLKQLNKDVKGQN-YKVPTFGYA-AYALLKSCEKEQVRKKIWTALHSCSDKQIKRLNHL 321

Query: 296 LQLRNELADILGYSTYANYNLELKMAKN----QDNVWKFLNELKDK----LKPLGLKEAE 347
           ++LR  LAD++   +YA Y LE KMAKN    QD +   +N+  DK    LK +   +A+
Sbjct: 322 IKLRANLADLMHKGSYAEYQLEGKMAKNPKDVQDFILTLMNDTIDKTATELKFIAELKAK 381

Query: 348 NLKQ---IKQKECESLGLPYDGHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPIESTISG 404
           +LK+    K  E   L  P+D  YY   +                ++IS Y+ + + I G
Sbjct: 382 DLKKPLATKTDEILKLVRPWDRDYYTGKYLQLNPSNAPSA-----KEISSYFTLGNVIQG 436

Query: 405 MLSIYETLLKLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKY 464
           +  +++ +  +K +E    ++   W  DV++L V       +   +G IY DL  R GK 
Sbjct: 437 LSDLFQHIYGIK-LEPAIADEGETWSPDVRRLNVIS----EEEGIIGIIYCDLFERSGKT 491

Query: 465 GHAANFGISASY-------------VKEDGTRSY---PVTALVCNFXXXXXXXXXXXXH- 507
            + A+F +  S              + E+   S+   PV +LVCNF              
Sbjct: 492 SNPAHFTVCCSRQIYPNETDFSTIQLGENADGSFFQLPVISLVCNFAPIPIASKKSLCFL 551

Query: 508 --NEISTFFHELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNERELHELS 565
             +E+ T FHE+GH +H ++G   +   +G      DFVE PS ++E +  + R L  + 
Sbjct: 552 QLSEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRILTRIG 610

Query: 566 SHYESGEKIPKDLLQSLISTKHVDGALFALRQLHFGLFDMYVHTSK---NVAKLDLLKLW 622
            HYE+GE +  D+LQS + T +         Q    + D   H  +   N+   D++K +
Sbjct: 611 KHYETGETVEPDMLQSFMRTTNFLQNCETYSQAKMAMLDQSFHDEEVISNIDNYDVVKNY 670

Query: 623 NELREEVSLVENGDTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTRFAADPLDS 682
             L   + ++ +  +   G   FGH+    Y A YY Y++    A+ +++  F  DP   
Sbjct: 671 QALERRLKVLVDDQSNWCG--RFGHLF--GYGATYYSYLFDRTIASKIWYALFEDDPYSR 726

Query: 683 KAGVQYRDIVLGRGGL 698
           K G +++  +L  GGL
Sbjct: 727 KNGDKFKKHLLKWGGL 742

>TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {ON}
           Anc_2.432 YKL134C
          Length = 795

 Score =  168 bits (426), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 155/606 (25%), Positives = 276/606 (45%), Gaps = 69/606 (11%)

Query: 131 EFLQNFGIEQSLRHDL--FLQFDKIWNELKDKSFEQGSQEYEIYKYVEKIHRDYTRDGLQ 188
           EF+     +  L + L   L+ +KI ++L D+ ++ G    E          D+ + G+ 
Sbjct: 183 EFMNTLNTDVQLCYTLKHILEDEKICSKLTDEEYKVGKILLE----------DFEKSGIY 232

Query: 189 LPEDKRDKVKQLKIKIAANSLEFSKNLG-EQKEFVAFTKEELDGVSESVMDQFEQFKDEN 247
           +  + R+K  +L  +I+    EF  N     K  +   +E L+ +SE  +    Q K + 
Sbjct: 233 MEPNTREKFIELSQEISLVGQEFISNTDYVTKNNILIDRESLN-LSELELPFTYQLKTDI 291

Query: 248 GTTKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETLQLRNELADILG 307
               YK+    P  + +L    N   RK  +        +  +   + + LR +LA +L 
Sbjct: 292 TGKHYKIPTTGPIPYSILTNCSNETIRKKIWTELHSCSQEQIERLKKMVTLRYKLAKLLK 351

Query: 308 YSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEAENLKQIKQKECESLGL----- 362
             ++A Y L+ KMAKN + V KF++ L D  KPL +KE  +L ++K  +   LGL     
Sbjct: 352 KKSFAEYQLQGKMAKNPEEVKKFISTLLDFTKPLAIKELTSLAEVKAAD---LGLAFKND 408

Query: 363 ---------PYDGHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPIESTISGMLSIYETLL 413
                    P+D +YY   +R             DL ++  Y+ + + I+G+ +++  + 
Sbjct: 409 SNFIVNLIRPWDRNYYSKINRYENKQTME-----DLNELPYYFSLGNVIAGLSNLFHNIY 463

Query: 414 KLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPE-FVGWIYFDLHPRDGKYGHAANFGI 472
            ++F E   P+    W  +V++L V      S+ E  +G +Y DL  R  K  +AA+F I
Sbjct: 464 GIRF-ELAVPKLEETWLPEVRKLNVI-----SESEGLIGIVYCDLFERPSKKTNAAHFTI 517

Query: 473 SASY---------VKEDGTRS------YPVTALVCNFXXXXXXXXXXXXH---NEISTFF 514
             S            + G  S       P+ +L+CNF                +EI T F
Sbjct: 518 CCSREIGKGEDISTMQVGMNSKGNMFQLPIISLICNFSKSHLFEENGPCFLQLHEIETLF 577

Query: 515 HELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNERELHELSSHYESGEKI 574
           HE+GH +H ++G  RL   +G      DFVE PS ++E +  + R +  +SSHY S E  
Sbjct: 578 HEMGHAMHSVLGRTRLQNTSGTRCAT-DFVELPSILMEHFAKDVRVMESISSHYISQEPA 636

Query: 575 PKDLLQSLISTKHVDGALFALRQLHFGLFDMYVHTS---KNVAKLDLLKLWNELREEVSL 631
             +LLQ+ + +      L    Q    + D  +H++   ++   ++++K +N+L +++ L
Sbjct: 637 SPELLQTWLHSTDNLQNLELYTQAKMSMLDQILHSNEIFEDQKDINVVKSYNDLEKKLEL 696

Query: 632 VENGDTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTRFAADPLDSKAGVQYRDI 691
             +  +   G   FGH+    Y A YY Y++    A+ ++ + F  +P    +G++++D 
Sbjct: 697 FSDDQSNWCG--KFGHLF--GYGASYYSYLFDRAIASKVWESLFKQNPFSRTSGLKFKDS 752

Query: 692 VLGRGG 697
           VL  GG
Sbjct: 753 VLRWGG 758

>Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}
           similar to Ashbya gossypii AFR198W
          Length = 773

 Score =  167 bits (422), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 143/550 (26%), Positives = 253/550 (46%), Gaps = 55/550 (10%)

Query: 181 DYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGEQKEFV--AFTKEELD-----GVS 233
           D+ + G+ +    R++  +L   I+    EF  N     E+V  +F + E D     GVS
Sbjct: 212 DFEKSGIYMNPKVRERFIELSQVISIVGQEFITN----TEYVGTSFVEIETDVLEASGVS 267

Query: 234 ESVMDQFEQFKDENGTTKYKV-TFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLF 292
           + V+ Q    KD +G   YK+ T+ Y   + +++T  +   RK  +        +  K  
Sbjct: 268 QMVLQQLS--KDLSGKF-YKIPTYGYLP-YSIIRTCPSEYIRKKVWTAMYSCPEKQIKRL 323

Query: 293 VETLQLRNELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEAENLKQI 352
            + ++LR +LA I+G   YA Y LE KMAK+  NV  F+N L +  KPL ++E + L  +
Sbjct: 324 KKLVRLRQQLAHIMGKPDYATYQLEGKMAKSPKNVKNFMNTLIEYTKPLAMEELKPLADM 383

Query: 353 KQ-------KECESLGLPYDGHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPIESTISGM 405
           K         E  S   P+D  Y+                 +  + ++ Y+ +   I G+
Sbjct: 384 KHDNHCKDASEILSSVRPWDRDYF---GSMSLLAQPRSVKTMSFQSLNCYFSLGVVIQGL 440

Query: 406 LSIYETLLKLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKYG 465
             +++++  ++ +E    +    W  +V+++ V    N      +G IY DL  R GK  
Sbjct: 441 SDLFQSIYGIR-LEPVVAKTGETWDPEVRKIQVISEANG----VIGVIYCDLFERQGKTP 495

Query: 466 HAANFGISAS---YVKE------------DGTR-SYPVTALVCNFXXXXX--XXXXXXXH 507
           + A+F +  S   Y  E            D ++   PV +LVCNF               
Sbjct: 496 NPAHFTVCCSRQIYPNETDYSTIQVGSHPDKSKFQMPVISLVCNFSHTQADDDSICLLQL 555

Query: 508 NEISTFFHELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNERELHELSSH 567
           +E+ T FHE+GH +H ++G  +L   +G      DFVE PS ++E +  + R L  +SSH
Sbjct: 556 SEVETLFHEMGHAMHSMLGRTQLQNISGTRCAT-DFVELPSILMEHFAKDLRVLSRISSH 614

Query: 568 YESGEKIPKDLLQSLISTKHVDGALFALRQLHFGLFDMYVHTSKNVAKLDLLKLWNELRE 627
           Y +GE++PK++L +               Q+   + D  +H+  + ++ D++ +++ L +
Sbjct: 615 YATGERVPKEMLVNYQQENRFLEHTETFSQIKMAMLDQRLHSLTDNSE-DIVTVYHGLEK 673

Query: 628 EVSLVENGDTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTRFAADPLDSKAGVQ 687
           E+ ++ +  +   G   FGH+    Y A YY Y+     AA +++  F  DP     G +
Sbjct: 674 ELQVLVDDRSNWCG--RFGHLF--GYGASYYSYLMDRAIAAKVWNHLFQHDPFSRAGGEK 729

Query: 688 YRDIVLGRGG 697
           +++ VL  GG
Sbjct: 730 FKNSVLKWGG 739

>AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL134C (OCT1)
          Length = 776

 Score =  167 bits (422), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 152/550 (27%), Positives = 245/550 (44%), Gaps = 55/550 (10%)

Query: 181 DYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGE-QKEFVAFTKEELD--GVSESVM 237
           D+ + G     + R +  QL   I+    +F  N       ++    ++L+  G S  V+
Sbjct: 215 DFEKAGAYASPEVRKQFIQLSQNISIIGQDFINNTESLSSSYIKIPCKDLESSGTSHLVL 274

Query: 238 DQFEQFKDENGTTKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETLQ 297
            Q    KD  G   YK+       + +L    +   R+  +        +  K     LQ
Sbjct: 275 RQLT--KDTMGNN-YKIPTSGYAPYTLLNACPSEAIRRQVWTAMFSCSEKQVKRLKSLLQ 331

Query: 298 LRNELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEAENLKQIKQK-- 355
           LR +LA+I+G + Y +Y LE KMAK+ +NV  FLN L D  KPL   E E L ++K+   
Sbjct: 332 LRRKLANIMGATDYVSYQLEGKMAKSPENVKNFLNTLVDHTKPLAAGELEELAKLKRNVE 391

Query: 356 ---ECESLGL--PYDGHYYVWDHRXXXXXXXXXXXXVD-LEKISEYYPIESTISGMLSIY 409
              E  +L L  P+D  YY                 VD    I+ Y+ +   + G+  ++
Sbjct: 392 NLSETNTLKLMRPWDRDYY----SSLSPNFTRPNHRVDGFTSINTYFSLGVVMQGISDLF 447

Query: 410 ETL--LKLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPE-FVGWIYFDLHPRDGKYGH 466
             +  + LK V     E    W  DV++L V      S+ E  +G IY DL  R GK   
Sbjct: 448 RDIYGISLKPVVAQAGE---TWAPDVRKLQVI-----SETEGIIGLIYCDLLERPGKTTS 499

Query: 467 AANFGISAS---YVKE------------DGTR-SYPVTALVCNFXXXXXXXXXXXXHNEI 510
            ++F +  S   Y +E            DG+R   PV +L+CNF              E+
Sbjct: 500 PSHFTVCCSRQIYPEENDFSTIQVGENPDGSRFQMPVISLICNFRATRHGKNKSLCLLEL 559

Query: 511 S---TFFHELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNERELHELSSH 567
           S   T FHE+GH +H ++G  +L   +G   V  DFVE PS ++E +  + R L  +SS+
Sbjct: 560 SDVETLFHEMGHALHSMLGRTQLQNLSGTRCVT-DFVELPSILMEHFAKDRRVLLRISSN 618

Query: 568 YESGEKIPKDLLQSLISTKHVDGALFALRQLHFGLFDMYVHTSKNVAKLDLLKLWNELRE 627
           Y +GE IP++LL +     +         Q+   + D  +H+  +  + D++ +++ L  
Sbjct: 619 YATGEPIPEELLSAFQEQNNFLKNTETFSQIKMSMLDQRLHSITD--QDDIIAVYHGLER 676

Query: 628 EVSLVENGDTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTRFAADPLDSKAGVQ 687
           E+ ++ +  T   G   FGH+    Y A YY Y+     AA ++   F  DP    +G +
Sbjct: 677 EMEVLVDDQTNWCG--RFGHLF--GYGASYYSYLMDRAIAAKIWDHLFKKDPFSRSSGEK 732

Query: 688 YRDIVLGRGG 697
           +++ VL  GG
Sbjct: 733 FKEGVLKWGG 742

>Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C
           (OCT1) - 1:1 [contig 55] FULL
          Length = 770

 Score =  162 bits (411), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 145/604 (24%), Positives = 263/604 (43%), Gaps = 66/604 (10%)

Query: 131 EFLQNFGIEQSLRHDL--FLQFDKIWNELKDKSFEQGSQEYEIYKYVEKIHRDYTRDGLQ 188
           EF+     +++L   L   L+ + I  EL D+    G+   E          D+ + G+ 
Sbjct: 162 EFMNVLNTDKTLCEVLKHVLRTESIVQELSDEEIRVGNILLE----------DFEKSGID 211

Query: 189 LPEDKRDKVKQLKIKIAANSLEFSKNLG-EQKEFVAFTKEELD--GVSESVMDQFEQ-FK 244
           +     ++   +  +I+    EF  N    + ++V    +ELD  GVS  +++Q  +  K
Sbjct: 212 MEPKVGEQFINISQQISIVGQEFINNTDFPRSDYVKIPCKELDSSGVSTLLLNQLSRDLK 271

Query: 245 DENGTTKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETLQLRNELAD 304
           ++N    YKV       F +L++  N   R   +        +      + + LR  LA 
Sbjct: 272 NQN----YKVPAYGYAAFSILRSCPNENVRMKIWTAMHSCPEKQISRLKQLVMLRGLLAS 327

Query: 305 ILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEAENLKQIK---------QK 355
           I+G  +YA Y L  KMAK+   V  F+  L D  KPL  +E   L ++K         Q 
Sbjct: 328 IMGKKSYAEYQLSGKMAKSPVYVRGFVQSLVDVTKPLAAEELRVLAKLKSGHLGVNVPQS 387

Query: 356 ECESLGL--PYDGHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPIESTISGMLSIYETLL 413
           + + L    P+D  +Y                 ++ E IS Y+ + + + G+  ++E + 
Sbjct: 388 DADVLRFVRPWDRDFY-----STLNALQQQRKTLENEHISSYFSLGTVMQGLSRLFEDIY 442

Query: 414 KLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKYGHAANFGIS 473
            ++ +E    +    W  +V+++ V       K   +G +Y DL  R GK  + A+F + 
Sbjct: 443 GIR-LEPVVAKAGETWSPEVRRINVVS----EKEGIIGVVYCDLFERQGKTSNPAHFTVC 497

Query: 474 ASYVKEDGTR----------------SYPVTALVCNFXXXXXXXX--XXXXHNEISTFFH 515
            S     G                    PV +LVC+F               +++ T FH
Sbjct: 498 CSRTIYPGETDLSTIQVGQLPSGEKFQLPVISLVCSFAQNSASRQGVCLLQLSDVDTLFH 557

Query: 516 ELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNERELHELSSHYESGEKIP 575
           E+GH +H ++G   L   +G      DFVE PS ++E +  + R L  +  HY + + IP
Sbjct: 558 EMGHAMHSMLGRTSLQNISGTRCAT-DFVELPSILMEHFARDSRVLSRIGRHYATDQPIP 616

Query: 576 KDLLQSLISTKHVDGALFALRQLHFGLFDMYVHTSKNV--AKLDLLKLWNELREEVSLVE 633
            +LL+   +  +         Q    + D  +H+SK +   KLD++KL++ + +++ ++ 
Sbjct: 617 TELLKLNQTEMNYLQHTETFSQAKMAMLDQELHSSKALTDGKLDVVKLYHGVEKDMEVLA 676

Query: 634 NGDTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTRFAADPLDSKAGVQYRDIVL 693
           +  +   G   FGH++   Y A YY Y++    A+ ++   FA DP + + G ++++ VL
Sbjct: 677 DDQSNWCG--RFGHLL--GYGASYYSYLFDRAIASKIWQHLFAEDPFNRENGEKFKESVL 732

Query: 694 GRGG 697
             GG
Sbjct: 733 KWGG 736

>KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {ON}
           Anc_2.432 YKL134C
          Length = 777

 Score =  159 bits (402), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 153/622 (24%), Positives = 266/622 (42%), Gaps = 57/622 (9%)

Query: 112 FPQQVSADKEIRDASVQATEFLQNFGIEQSLRHDLFLQFDKIWNELKDKSFEQGSQEYEI 171
           F + V  DKE   A+ Q  E  + F    +L  D+ L  DK+   L D        E EI
Sbjct: 143 FIRSVHPDKEFLSAAQQCHE--EMFEFMNTLNTDVEL-CDKLKTLLHDNEILSKLSEEEI 199

Query: 172 YKYVEKIHRDYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGEQKEF---VAFTKEE 228
            K    +  D+ + G+ +    R++  +L  +I+    +F  N  + K     V  +K E
Sbjct: 200 -KVGRILLEDFEKSGIYMNPRIREQFIELSQEISLIGQDFINNANQPKTNYIKVNASKLE 258

Query: 229 LDGVSESVMDQFEQFKDENGTTKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQN 288
             G++  +++     K +     YK+    P  + VLK  KN + R   +        + 
Sbjct: 259 SAGLNRLLLNSL---KKDAIRENYKIPTYGPTPYAVLKDCKNEEVRADIWTALHSCSSEQ 315

Query: 289 EKLFVETLQLRNELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEAEN 348
                  ++LR  LA+++G  +++ Y L+ K+AK   +V  F+  L   ++P   KE + 
Sbjct: 316 ILRLSHLVKLRAMLANLMGAESFSQYQLKGKLAKAPKDVKNFIETLIKYVRPNTEKELKF 375

Query: 349 LKQIKQKECESLGL-----------PYDGHYYVWDHRXXXXXXXXXXXXVDLEKISEYYP 397
           +  +K+++   +             P+D  YY   +                E +S Y+ 
Sbjct: 376 IADLKREDQGKINCGEMDGVLSTVRPWDRDYYSSIYFKGKEKTEHEFT----EPLSSYFT 431

Query: 398 IESTISGMLSIYETLLKLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDL 457
           +     G+  +   +  +K +E   P     W  DV+++ V   +       +G IYFDL
Sbjct: 432 LGGVFEGLSDLLTQIYGIK-LEPAIPVSGETWFNDVRKINVISEEEG----IIGIIYFDL 486

Query: 458 HPRDGKYGHAANFGISASY---------------VKEDGTR-SYPVTALVCNFXXXX--- 498
             R GK  + A+F +  S                 K+DGT    P+ +LVCNF       
Sbjct: 487 FERYGKTSNPAHFTVCCSREMYPEENADSIIQLGSKKDGTIFQLPIISLVCNFSRRTFQS 546

Query: 499 XXXXXXXXHNEISTFFHELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNE 558
                    +EI T FHE+GH IH ++G   L   +G      DFVE PS ++E +  + 
Sbjct: 547 DKTICLLTLSEIETLFHEMGHAIHSMLGRTTLQNVSGTRCAT-DFVELPSILMEHFASDT 605

Query: 559 RELHELSSHYESGEKIPKDLLQSLISTKHVDGALFALRQLHFGLFDMYVHTSK---NVAK 615
           R L ++S HYE+GEKI +  LQ  +       +     Q    + D  +H+ K   N+  
Sbjct: 606 RVLKKMSCHYETGEKIAEKKLQFHLKEGEFLRSCETFSQAKMAMLDQELHSDKIIHNLDN 665

Query: 616 LDLLKLWNELREEVSLVENGDTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTRF 675
           L++++++  L   + ++   D  +     FGH+    Y A YY Y++    A  +++  F
Sbjct: 666 LNVVEIYQNLERRLQVLV--DDRSNWCGKFGHLF--GYGATYYSYLFDRAIARKVWNHLF 721

Query: 676 AADPLDSKAGVQYRDIVLGRGG 697
           A DP +   G ++++ +L  GG
Sbjct: 722 ANDPFNKTNGEKFKESLLKWGG 743

>Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  158 bits (400), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 159/627 (25%), Positives = 272/627 (43%), Gaps = 86/627 (13%)

Query: 120 KEIRDASVQATEFLQNFGIEQSLRHDL--FLQFDKIWNELKDKSFEQGSQEYEIYKYVEK 177
           K  +D   Q  EF+     + SL + L   L   ++ ++L D+  + G          + 
Sbjct: 151 KAAQDCHEQMFEFMNVLNTDVSLCNILKSVLNSPEVSSKLSDEELKVG----------KI 200

Query: 178 IHRDYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLG-EQKEFVAFTKEELDG--VSE 234
           +  D+ + G+ +  D R+K  +L  +I+    EF  +        V    ++LD   VS 
Sbjct: 201 LLDDFEKSGIYMNPDVREKFIELSQEISLIGQEFINHTDYPGSNSVKIPCKDLDNGNVSA 260

Query: 235 SVMDQFEQFKDENGTTKYKV-TFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFV 293
            ++ Q    KD  G   YK+ TF Y   + +LK+ +  + RK  +        +  K   
Sbjct: 261 FLLKQLN--KDVKGQN-YKIPTFGYA-AYALLKSCEKEEVRKKLWTALHSCSDKQIKRLS 316

Query: 294 ETLQLRNELADILGYSTYANYNLELKMAKNQDNVWKFL------------NELK------ 335
             ++LR  LA+++   +YA Y LE KMAKN  +V  F+            NELK      
Sbjct: 317 HLIKLRAILANLMNKESYAEYQLEGKMAKNPKDVQDFILTLMNGTIDKTANELKFIAELK 376

Query: 336 --DKLKPLGLKEAENLKQIKQKECESLGLPYDGHYYVWDHRXXXXXXXXXXXXVDLEKIS 393
             D  KPL  K  + L+ ++         P+D  YY   +              + ++IS
Sbjct: 377 TKDLKKPLATKTDDILRLVR---------PWDRDYYTGKY-----LQLNPSDAPNAKEIS 422

Query: 394 EYYPIESTISGMLSIYETLLKLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWI 453
            Y+ + + I G+  +++ +  ++   E   E  + W  DV++L V       +   +G I
Sbjct: 423 YYFTLGNVIEGLSDLFQHIYGIRLEPEIADEGET-WSPDVRRLNVIS----EEEGIIGII 477

Query: 454 YFDLHPRDGKYGHAANFGISASY-------------VKEDGTRSY---PVTALVCNFXXX 497
           Y DL  R+GK  + A+F +  S              V E+   SY   PV +LVCNF   
Sbjct: 478 YCDLFERNGKTSNPAHFTVCCSRQIYPNETDFSTIQVGENPDGSYFQLPVISLVCNFAPI 537

Query: 498 XXXXXXXXXH---NEISTFFHELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPSQMLEFW 554
                        +E+ T FHE+GH +H ++G   +   +G      DFVE PS ++E +
Sbjct: 538 PIASKKTLCFLQLSEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHF 596

Query: 555 TWNERELHELSSHYESGEKIPKDLLQSLISTKHVDGALFALRQLHFGLFDMYVHTSKNVA 614
             + R L ++S HYE+GE I   +LQS + T +         Q    + D   H  + ++
Sbjct: 597 AKDIRILTKISKHYETGETIQAGMLQSFMRTTNFLQNCETYSQAKMAMLDQSFHDEEIIS 656

Query: 615 KL---DLLKLWNELREEVSLVENGDTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMY 671
            +   D++K +  L   + ++ +  +   G   FGH+    Y A YY Y++    A+ ++
Sbjct: 657 DIDNFDIVKNYQALERRLKVLVDDQSNWCG--RFGHLF--GYGATYYSYLFDRTIASKIW 712

Query: 672 HTRFAADPLDSKAGVQYRDIVLGRGGL 698
           +  F  DP   K G +++  +L  GGL
Sbjct: 713 YALFEDDPYSRKNGDKFKKHLLKWGGL 739

>ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 786

 Score =  157 bits (396), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 135/556 (24%), Positives = 247/556 (44%), Gaps = 58/556 (10%)

Query: 181 DYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLG-EQKEFVAFTKEEL--DGVSESVM 237
           D+ + G+ +  + R++   L  +I+    +F  N    +  ++    E +   G+++ ++
Sbjct: 216 DFEKSGIYMNPEIREQFIALSQEISIVGQDFINNTDFVRTNYITVDCETIHNSGINQLIL 275

Query: 238 DQFEQFKDENGTTKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETL- 296
            Q    KD  G   YK+       + VL+   +   RK  +       P  + + ++ L 
Sbjct: 276 SQLS--KDIKGK-HYKIPTHGYIAYSVLRACPDEIVRKKLWTA-MHSCPDKQIVRLDQLV 331

Query: 297 QLRNELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEAENLKQIKQKE 356
           +LR  LA ++G  +YA Y LE KMAK+ + V  F++ L    +P   +E   +  +K+K 
Sbjct: 332 RLRAVLAFLMGKKSYAEYQLEGKMAKSPEEVTDFIDSLIKVTQPKAKQELGFISDLKRKH 391

Query: 357 CE------------SLGLPYDGHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPIESTISG 404
            +             +  P+D  +Y                 +D ++IS Y+ + + + G
Sbjct: 392 MDLPPSETSNLDTLDIVRPWDRDFY----HTIYSIQQRRQSPIDDQQISMYFTLGNVMQG 447

Query: 405 MLSIYETLLKLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKY 464
           +  ++  +  ++ +E    +K   W  +V++L V       +   +G +Y DL  RDGK 
Sbjct: 448 LSDLFHQIYGIR-LEPVIAQKGETWSPEVRRLNVVS----DEEGVIGVVYCDLFERDGKT 502

Query: 465 GHAANFGISAS---YVKE------------DGTR-SYPVTALVCNFXXXXXX--XXXXXX 506
            + ++F +  S   Y KE            DGT+   P+ +LVCNF              
Sbjct: 503 SNPSHFTVCCSRQIYPKENDLSTIQIGTNKDGTKFQLPIISLVCNFASSVVSFGQSLCLL 562

Query: 507 H-NEISTFFHELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNERELHELS 565
           H +EI T FHE+GH +H ++G  RL   +G      DFVE PS ++E +  + R L ++ 
Sbjct: 563 HISEIETLFHEMGHAMHSMLGRTRLQNLSGTRCAT-DFVELPSILMEHFARDTRVLRQIG 621

Query: 566 SHYESGEKIPKDLLQSLISTKHVDGALFALRQLHFGLFDMYVHTSKNVA---KLDLLKLW 622
            H  +GE +P+ LL + +             Q    + D  +H  + +     LD++ L+
Sbjct: 622 KHCNTGEPVPESLLTNYLQDLQYMQYCETFSQAKMAMLDQRLHGKEIITGMDTLDVVALY 681

Query: 623 NELREEVS-LVENGDTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTRFAADPLD 681
             L  E+  LV++  T+      FGH+    Y A YY Y++    A+ ++ + F  DP  
Sbjct: 682 QNLERELRVLVDDQSTWC---GRFGHLF--GYGATYYSYLFDRAIASKVWESLFQEDPFS 736

Query: 682 SKAGVQYRDIVLGRGG 697
              G ++++ VL  GG
Sbjct: 737 RAGGQRFKEYVLKWGG 752

>YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON}
           OCT1Mitochondrial intermediate peptidase, cleaves
           destabilizing N-terminal residues of a subset of
           proteins upon import, after their cleavage by
           mitochondrial processing peptidase (Mas1p-Mas2p); may
           contribute to mitochondrial iron homeostasis
          Length = 772

 Score =  156 bits (395), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 148/564 (26%), Positives = 247/564 (43%), Gaps = 74/564 (13%)

Query: 181 DYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLG-EQKEFVAFTKEELDG--VSESVM 237
           D+ + G+ +  D R+K  QL  +I+    EF  +        V    ++LD   VS  ++
Sbjct: 204 DFEKSGIYMNPDVREKFIQLSQEISLVGQEFINHTDYPGSNSVKIPCKDLDNSKVSTFLL 263

Query: 238 DQFEQFKDENGTTKYKV-TFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETL 296
            Q    KD  G   YKV TF Y   + +LK+ +N   RK  +        +  K     +
Sbjct: 264 KQLN--KDVKGQN-YKVPTFGYA-AYALLKSCENEMVRKKLWTALHSCSDKQVKRLSHLI 319

Query: 297 QLRNELADILGYSTYANYNLELKMAKNQDNVWKFL------------NEL--------KD 336
           +LR  LA+++  ++YA Y LE KMAKN  +V  F+            NEL        KD
Sbjct: 320 KLRAILANLMHKTSYAEYQLEGKMAKNPKDVQDFILTLMNNTIEKTANELKFIAELKAKD 379

Query: 337 KLKPLGLKEAENLKQIKQKECESLGLPYDGHYYVWDHRXXXXXXXXXXXXVDLEKISEYY 396
             KPL     E LK ++         P+D  YY   +              + ++IS Y+
Sbjct: 380 LKKPLTTNTDEILKLVR---------PWDRDYYTGKY-----FQLNPSNSPNAKEISYYF 425

Query: 397 PIESTISGMLSIYETLLKLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFD 456
            + + I G+  +++ +  ++ +E    ++   W  DV++L V       +   +G IY D
Sbjct: 426 TLGNVIQGLSDLFQQIYGIR-LEPAITDEGETWSPDVRRLNVIS----EEEGIIGIIYCD 480

Query: 457 LHPRDGKYGHAANFGISAS---YVKE------------DGTR-SYPVTALVCNFXXXXXX 500
           L  R+GK  + A+F +  S   Y  E            DGT    PV +LVCNF      
Sbjct: 481 LFERNGKTSNPAHFTVCCSRQIYPSETDFSTIQVGENPDGTYFQLPVISLVCNFSPILIA 540

Query: 501 XXXXXXH---NEISTFFHELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWN 557
                     +E+ T FHE+GH +H ++G   +   +G      DFVE PS ++E +  +
Sbjct: 541 SKKSLCFLQLSEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKD 599

Query: 558 ERELHELSSHYESGEKIPKDLLQSLISTKHVDGALFALRQLHFGLFDMYVHTSKNVAKL- 616
            R L ++  HY +GE I  D+LQ  + + +         Q    + D   H  K ++ + 
Sbjct: 600 IRILTKIGKHYGTGETIQADMLQRFMKSTNFLQNCETYSQAKMAMLDQSFHDEKIISDID 659

Query: 617 --DLLKLWNELREEVSLVENGDTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTR 674
             D+++ +  L   + ++ +  +   G   FGH+    Y A YY Y++    A+ +++  
Sbjct: 660 NFDVVENYQALERRLKVLVDDQSNWCG--RFGHLF--GYGATYYSYLFDRTIASKIWYAL 715

Query: 675 FAADPLDSKAGVQYRDIVLGRGGL 698
           F  DP   K G +++  +L  GGL
Sbjct: 716 FEDDPYSRKNGDKFKKHLLKWGGL 739

>TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {ON}
           Anc_2.432 YKL134C
          Length = 787

 Score =  155 bits (392), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 138/558 (24%), Positives = 249/558 (44%), Gaps = 62/558 (11%)

Query: 181 DYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLG-EQKEFVAFTKEELD--GVSESVM 237
           D+ + G+ +  + RD+   L  +I+    EF  N    +  ++    EE+D  G+++ ++
Sbjct: 217 DFEKSGIYMNPEVRDQFIALSQEISLVGQEFINNTDYVRSNYIKIKCEEVDNSGINKLLI 276

Query: 238 DQFEQFKDENGTTKYKVTFKYPDIFPVLKTAKNPKTRK---LAFARDQDKVPQNEKLFVE 294
            Q    KD  G   YK+       + +L++  + + R     A  R  DK  Q  +L  +
Sbjct: 277 SQLP--KDVRGKY-YKIPTHGYIAYSILRSCPDEEIRMNLWTAMHRCSDK--QINRL-DQ 330

Query: 295 TLQLRNELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEAENLKQIKQ 354
            L+LR  LA ++G  ++A Y LE KMA+    V  F+  L + ++P  ++E + + ++K 
Sbjct: 331 LLRLRAILAKLMGKESFAQYQLEGKMAQTPQQVRDFIGTLVNYMRPKTIEELKFIYELKS 390

Query: 355 KE-------------CESLGLPYDGHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPIEST 401
           K+               S+  P+D  YY                 +D E+IS Y+ + + 
Sbjct: 391 KQEKREIQPSPSEQDIASMVRPWDREYYT-----SMYSLQQRRDAIDDEQISSYFTLGNV 445

Query: 402 ISGMLSIYETLLKLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRD 461
           I G+  ++E++  ++ +E   P+    +  +V++L V       +   +G +Y DL  R 
Sbjct: 446 IQGLSDLFESIYGIR-LEPVVPKTGETFSPEVRRLNVV----CEQEGVIGVVYCDLFERA 500

Query: 462 GKYGHAANFGISAS---YVKE-------DGTRS------YPVTALVCNFXXXXXX---XX 502
           GK  + ++F +  S   Y KE        G  S       PV ALVCNF           
Sbjct: 501 GKTSNPSHFTVCCSRQIYPKETEFSTIQTGFNSEGLMFQLPVIALVCNFSSSTDSEGKSI 560

Query: 503 XXXXHNEISTFFHELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNERELH 562
                NE+ T FHE+GH +H ++G  RL   +G      DFVE PS ++E +  + R L 
Sbjct: 561 CLLQLNEVETLFHEMGHAMHSMLGRTRLQNISGTRCAT-DFVELPSILMEHFARDVRVLE 619

Query: 563 ELSSHYESGEKIPKDLLQSLISTKHVDGALFALRQLHFGLFDMYVHTSKNVAK---LDLL 619
            +  H+ +G  I + LL + +             Q    + D  +H  K +      D+ 
Sbjct: 620 RIGKHHRTGAPISEKLLLNYLEETKFMQHCETFSQAKMAMLDQDLHGEKVIKDFDHFDVT 679

Query: 620 KLWNELREEVSLVENGDTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTRFAADP 679
             + +L  ++ ++ +  +   G   FGH+    Y A YY Y++    A+ ++ + F++DP
Sbjct: 680 AAYQQLERDMKVLVDDKSNWCG--KFGHLF--GYGATYYSYLFDRAIASKVWDSLFSSDP 735

Query: 680 LDSKAGVQYRDIVLGRGG 697
                G ++++ VL  GG
Sbjct: 736 YSRVNGEKFKECVLKWGG 753

>Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  154 bits (390), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 147/555 (26%), Positives = 245/555 (44%), Gaps = 56/555 (10%)

Query: 181 DYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLG-EQKEFVAFTKEELDG--VSESVM 237
           D+ + G+ +    R+K  QL  +I+    EF  ++       V    ++LD   VS  ++
Sbjct: 204 DFEKSGIYMNPGVREKFIQLSQEISLVGQEFINHIDYPGSNSVKIPCKDLDSSKVSTFLL 263

Query: 238 DQFEQFKDENGTTKYKV-TFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETL 296
            Q    KD  G   YKV TF Y   F +LK+ +    RK  +        +  K     +
Sbjct: 264 KQLN--KDVKGQN-YKVPTFGYA-AFALLKSCEIEVVRKKIWTALHSCSDKQIKRLDRLI 319

Query: 297 QLRNELADILGYSTYANYNLELKMAKN----QDNVWKFLNELKDK----LKPLGLKEAEN 348
           +LR  LA+++   +YA Y LE KMAKN    QD +   +N   DK    LK +   +A++
Sbjct: 320 KLRAVLANLMHKGSYAEYQLEGKMAKNPKDVQDFILTLMNNTIDKTANELKFIADLKAKD 379

Query: 349 LKQ---IKQKECESLGLPYDGHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPIESTISGM 405
           LK+       E   L  P+D  YY   +                ++IS Y+ + + I G+
Sbjct: 380 LKKPLTTNTDEILKLVRPWDRDYYTGKYIQLNPSNVPSA-----KEISYYFTLGNVIQGL 434

Query: 406 LSIYETLLKLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKYG 465
             +++ +  ++ +E    ++   W  DV++L V       +   +G IY DL  R+GK  
Sbjct: 435 SDLFQQIYGIR-LEPAIADEGETWSPDVRRLNVIS----EEEGIIGIIYCDLFERNGKTS 489

Query: 466 HAANFGISASY-------------VKEDGTRSY---PVTALVCNFXXXXXXXXXXXXH-- 507
           + A+F +  S              V E+   SY   PV +LVCNF               
Sbjct: 490 NPAHFTVCCSRQIYPHETDFSTIQVGENPNGSYFQLPVISLVCNFSPVPIASKKSLCFLQ 549

Query: 508 -NEISTFFHELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNERELHELSS 566
            +E+ T FHE+GH +H ++G   +   +G      DFVE PS ++E +  + R L  +  
Sbjct: 550 LSEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRVLTRIGK 608

Query: 567 HYESGEKIPKDLLQSLISTKHVDGALFALRQLHFGLFDMYVHTSKNVAKLD---LLKLWN 623
           HYE+GE I K +LQ  + T +         Q    + D   H  K ++ +D   ++  + 
Sbjct: 609 HYETGETIQKGMLQCFMKTTNFLQNCETYSQAKMAMLDQSFHDEKIMSDIDNFNVVDNYQ 668

Query: 624 ELREEVSLVENGDTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTRFAADPLDSK 683
            L   + ++ +  +   G   FGH+    Y A YY Y++    A+ +++T F  DP    
Sbjct: 669 ALERHLKVLVDDQSNWCG--RFGHLF--GYGATYYSYLFDRTIASKIWYTLFDDDPYSRN 724

Query: 684 AGVQYRDIVLGRGGL 698
            G +++  +L  GGL
Sbjct: 725 NGDKFKKHLLKWGGL 739

>KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 772

 Score =  154 bits (389), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 130/553 (23%), Positives = 248/553 (44%), Gaps = 55/553 (9%)

Query: 181 DYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLG-EQKEFVAFTKEELD--GVSESVM 237
           D+ + G+ +  +  ++   L  +I+    EF  N    + E+V  +  EL+  G+S  ++
Sbjct: 205 DFEKSGIDMAPEVGEQFINLSQQISIVGQEFISNTDFPKSEYVKVSCNELETSGISPLLL 264

Query: 238 DQFEQFKDENGTTKYKV-TFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETL 296
           +     +D  G   YKV T+ Y   F +L++  +   R   +        +        +
Sbjct: 265 NHLS--RDTKGQN-YKVPTYGYI-AFSILRSCPSENIRMKVWTAVHSCPEKQITRLKHLV 320

Query: 297 QLRNELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEAENLKQIKQ-- 354
           +LR  LA I+G ++Y++Y LE KMAK+   V  F+  L + +KPL ++E   L  +K   
Sbjct: 321 KLRGLLAQIMGKNSYSDYQLEGKMAKSPVYVRGFVESLAEAIKPLAMRELRALANLKSSH 380

Query: 355 ---------KECESLGLPYDGHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPIESTISGM 405
                    +E      P+D  +Y                 ++ E+I+ Y+ + + + G+
Sbjct: 381 LDLPIPKTDEEVLKFVRPWDRDFY-----STLISLQQQRKTLENEQINSYFSLGTVMQGL 435

Query: 406 LSIYETLLKLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKYG 465
            S+ E +  ++ +E    +    W  +V+++ V       +   +G +Y DL  R GK  
Sbjct: 436 SSLLEDIYGIR-LEPAVAKVGETWSPEVRRINVVS----DQEGVIGVVYCDLFERQGKTS 490

Query: 466 HAANFGISAS---YVKEDGTRSY--------------PVTALVCNFXXXXXXX--XXXXX 506
           + A+F +  S   Y +E    +               PV +LVC+F              
Sbjct: 491 NPAHFTVCCSRQIYPEETDLSTIQVGQQPSSGQIFQLPVISLVCSFSQNSGSKKDVCLLQ 550

Query: 507 HNEISTFFHELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNERELHELSS 566
            +E+ T FHE+GH IH ++G   L   +G      DFVE PS ++E +  + R L  +  
Sbjct: 551 LSEVDTLFHEMGHAIHSMLGRTSLQNISGTRCAT-DFVELPSILMEHFAHDSRVLSRIGK 609

Query: 567 HYESGEKIPKDLLQSLISTKHVDGALFALRQLHFGLFDMYVHTSKNV--AKLDLLKLWNE 624
           HY + E +P +LL    +            Q    + D  +H+ + +    +D++++++E
Sbjct: 610 HYITNEPVPDELLHLNQNELKYLQNTETFSQAKMAMLDQEMHSPRMLTDGPVDVVEIYHE 669

Query: 625 LREEVSLVENGDTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTRFAADPLDSKA 684
           + +++ ++ +  +   G   FGH++   Y A YY Y++    A+ ++   FA DP   K+
Sbjct: 670 VEKQMGVLTDDKSNWCG--RFGHLL--GYGASYYSYLFDRAIASKVWQHLFANDPFSRKS 725

Query: 685 GVQYRDIVLGRGG 697
           G ++++ VL  GG
Sbjct: 726 GEKFKNSVLRWGG 738

>KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]
           {ON} similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134C OCT1 Mitochondrial intermediate peptidase
           cleaves N-terminal residues of a subset of proteins upon
           import after their cleavage by mitochondrial processing
           peptidase (Mas1p-Mas2p) may contribute to mitochondrial
           iron homeostasis
          Length = 779

 Score =  148 bits (373), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 139/556 (25%), Positives = 242/556 (43%), Gaps = 56/556 (10%)

Query: 181 DYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLG-EQKEFVAFTKEELDG-VSESVMD 238
           D+ + G+ +  + R+K  QL  +I+    +F  N    +  ++  + E +D  V++ V  
Sbjct: 206 DFEKSGIYMKPEIREKFIQLSQEISVIGQDFINNTEYVRSNYIKISCELMDAHVNKMVCS 265

Query: 239 QFEQFKDENGTTKYKV-TFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETLQ 297
           Q +  KD  G   YKV T+ Y     +L+T  +   R   +           +   + + 
Sbjct: 266 QMK--KDITGEY-YKVPTYGYIP-HTLLRTCSDEVIRMKIWTEMHSCSDAQIERLTKLIS 321

Query: 298 LRNELADILGYSTYANYNLELKMAKNQDNVWKFLNEL--------KDKLKPLGLKEAE-N 348
           LR ELA +LG   +A Y L  KMAK  +NV  FL  L          +LKPL + ++E  
Sbjct: 322 LRVELAKLLGSQNFAQYQLHGKMAKTPENVSGFLESLVHSTRIKAASELKPLAVLKSELT 381

Query: 349 LKQIKQKECESLGL--PYDGHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPIESTISGML 406
             Q      E L L  P+D  YY                  + E IS  + +   + G+ 
Sbjct: 382 GTQTPHTSEEVLELMKPWDRDYY---GSIQALAQRRSSSLDNGESISSSFSLGVVMQGLS 438

Query: 407 SIYETLLKLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKYGH 466
            ++E +  +K V  T P+    W  DV+++ V    +      +G +Y DL  R+GK  +
Sbjct: 439 DLFEKIYGIKLVPAT-PKTGETWSPDVRRIDVVDEHDG----LIGVMYCDLFEREGKTPN 493

Query: 467 AANFGISAS---YVKEDGTRS-------------YPVTALVCNFXXXXXXXXXXXXH--- 507
            A+F +  S   Y+ E  T +              PV +LVC+F                
Sbjct: 494 PAHFTVCCSRNMYLNEADTSTIQVGVNSNGQKFQLPVISLVCDFRWVEVNMGDGKHQQMC 553

Query: 508 ----NEISTFFHELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNERELHE 563
               NEI T FHE+GH +H ++G  +L   +G      DFVE PS ++E +  + R L  
Sbjct: 554 LLQLNEIETLFHEMGHAMHSMLGRTQLQNVSGTRCAT-DFVELPSILMEHFARDTRVLSS 612

Query: 564 LSSHYESGEKIPKDLLQSLISTKHVDGALFALRQLHFGLFDMYVHTSKNV--AKLDLLKL 621
           +SSHY++G+ +  ++L++               Q+     D  +H   +     +D++ +
Sbjct: 613 ISSHYKTGKSLDVEVLKNHQLENQFLQNCETFSQIKMSFLDQELHNLDHTTDGSIDVIAI 672

Query: 622 WNELREEVSLVENGDTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTRFAADPLD 681
           ++ L   ++++ +  +   G   FGH+    Y A YY Y++    A+ ++   F  DP +
Sbjct: 673 YHRLERRLAVLPDDQSNWCG--KFGHLF--GYGASYYSYLFDRAIASKIWDHLFEQDPFN 728

Query: 682 SKAGVQYRDIVLGRGG 697
              G ++++ +L  GG
Sbjct: 729 RTNGTKFKEGLLQWGG 744

>CAGL0J06534g Chr10 (625604..630616) [5013 bp, 1670 aa] {ON} similar
            to uniprot|P52593 Saccharomyces cerevisiae YML103c NUP188
            nuclear pore protein
          Length = 1670

 Score = 33.1 bits (74), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 58/133 (43%), Gaps = 21/133 (15%)

Query: 202  IKIAANSLEFSKNLGEQKEFVAFTKEELDGVSESVM-----DQFEQFKDENGTTKYKVTF 256
            I  A N+   ++NL E  +F+     +L+ + ++ +     D  +   D+    +YK+  
Sbjct: 1037 ISYAFNTWSNARNLDEDNDFIVSLLNKLENLMDATVGTNSSDDSQVTHDKELKRRYKLIA 1096

Query: 257  KYPDIFPV-LKTAKNPKTRKLAFARDQDKVPQNEKLFVETLQLRNELADILGYSTYANYN 315
            +  +IF + + T+KNP +  ++       VP  +K F+           I GY +    N
Sbjct: 1097 RIVEIFALYIFTSKNPNSDLMSLLESDKIVPHLQKFFL-----------IEGYQSDLQTN 1145

Query: 316  LELKMAKNQDNVW 328
            LE    KN   +W
Sbjct: 1146 LE----KNISEIW 1154

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 79,231,203
Number of extensions: 3586835
Number of successful extensions: 12423
Number of sequences better than 10.0: 124
Number of HSP's gapped: 12788
Number of HSP's successfully gapped: 130
Length of query: 725
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 608
Effective length of database: 40,065,477
Effective search space: 24359810016
Effective search space used: 24359810016
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)