Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F18370g1.10ON22022010581e-148
TDEL0C069301.10ON1841884584e-57
NDAI0A001901.10ON1711594182e-51
NCAS0B090601.10ON1671633964e-48
KNAG0C002701.10ON1741663522e-41
SAKL0C00572g1.10ON3381653609e-41
KAFR0D001901.10ON1851643202e-36
KLLA0C00594g1.10ON1941732916e-32
TPHA0E039601.10ON1771672871e-31
KLTH0F00572g1.10ON1951682793e-30
Kwal_33.130231.10ON1931592541e-26
TBLA0A049701.10ON1811771878e-17
Ecym_10121.10ON1771511833e-16
Kpol_2002.131.10ON1641571501e-11
Kpol_1050.1117.545ON15693710.70
NCAS0A019604.160ON42967691.8
TPHA0L023105.11ON109274702.0
YCL056C (PEX34)1.10ON144124653.6
Skud_3.81.10ON144120645.1
Suva_3.1571.10ON144138629.1
NOTE: 1 genes in the same pillar as ZYRO0F18370g were not hit in these BLAST results
LIST: Smik_3.19

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F18370g
         (220 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON} conse...   412   e-148
TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1....   181   4e-57
NDAI0A00190 Chr1 complement(17031..17546) [516 bp, 171 aa] {ON} ...   165   2e-51
NCAS0B09060 Chr2 (1741161..1741664) [504 bp, 167 aa] {ON} Anc_1....   157   4e-48
KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON} ...   140   2e-41
SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON...   143   9e-41
KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON} ...   127   2e-36
KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}...   116   6e-32
TPHA0E03960 Chr5 (833382..833915) [534 bp, 177 aa] {ON} Anc_1.10...   115   1e-31
KLTH0F00572g Chr6 complement(42946..43533) [588 bp, 195 aa] {ON}...   112   3e-30
Kwal_33.13023 s33 complement(43697..44278) [582 bp, 193 aa] {ON}...   102   1e-26
TBLA0A04970 Chr1 complement(1220824..1221369) [546 bp, 181 aa] {...    77   8e-17
Ecym_1012 Chr1 complement(22226..22759) [534 bp, 177 aa] {ON} si...    75   3e-16
Kpol_2002.13 s2002 complement(23954..24448) [495 bp, 164 aa] {ON...    62   1e-11
Kpol_1050.111 s1050 complement(248965..249435) [471 bp, 156 aa] ...    32   0.70 
NCAS0A01960 Chr1 (376597..377886) [1290 bp, 429 aa] {ON} Anc_4.160     31   1.8  
TPHA0L02310 Chr12 complement(485671..488949) [3279 bp, 1092 aa] ...    32   2.0  
YCL056C Chr3 complement(26925..27359) [435 bp, 144 aa] {ON}  PEX...    30   3.6  
Skud_3.8 Chr3 complement(14921..15355) [435 bp, 144 aa] {ON} YCL...    29   5.1  
Suva_3.157 Chr3 complement(236677..237111) [435 bp, 144 aa] {ON}...    28   9.1  

>ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON}
           conserved hypothetical protein
          Length = 220

 Score =  412 bits (1058), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 206/220 (93%), Positives = 206/220 (93%)

Query: 1   MDSQQLQDTRRVAADIXXXXXXXXXXXXXXEYPDKIDSPAPGSEVPSPDPNGHIPTFEDT 60
           MDSQQLQDTRRVAADI              EYPDKIDSPAPGSEVPSPDPNGHIPTFEDT
Sbjct: 1   MDSQQLQDTRRVAADITTTSANTTSTNVANEYPDKIDSPAPGSEVPSPDPNGHIPTFEDT 60

Query: 61  LIAGLESICGLFDNVYLLKTLGIISEDNLLYRRLNKGEWGSKLWFVTLLLSARKSFSRLL 120
           LIAGLESICGLFDNVYLLKTLGIISEDNLLYRRLNKGEWGSKLWFVTLLLSARKSFSRLL
Sbjct: 61  LIAGLESICGLFDNVYLLKTLGIISEDNLLYRRLNKGEWGSKLWFVTLLLSARKSFSRLL 120

Query: 121 KIMKAKSKLKEEMKELRTEGDEDLVKQVLRNKFTDALKKCSIIIKDVVLELLQTLAYLAI 180
           KIMKAKSKLKEEMKELRTEGDEDLVKQVLRNKFTDALKKCSIIIKDVVLELLQTLAYLAI
Sbjct: 121 KIMKAKSKLKEEMKELRTEGDEDLVKQVLRNKFTDALKKCSIIIKDVVLELLQTLAYLAI 180

Query: 181 VVIEVFKINVSQKVIKILEPLSHFIAVIRIFTTGYTTLTV 220
           VVIEVFKINVSQKVIKILEPLSHFIAVIRIFTTGYTTLTV
Sbjct: 181 VVIEVFKINVSQKVIKILEPLSHFIAVIRIFTTGYTTLTV 220

>TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1.10
           YCL056C
          Length = 184

 Score =  181 bits (458), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 88/188 (46%), Positives = 128/188 (68%), Gaps = 11/188 (5%)

Query: 33  PDKIDSPAPGSEVPSPDPNGHIPTFEDTLIAGLESICGLFDNVYLLKTLGIISEDNLLYR 92
           P  +  P  GS+           +FED LIAGLES+C  FDNVY  K+LGII E+N LYR
Sbjct: 8   PSSLGKPTGGSKT----------SFEDNLIAGLESVCSFFDNVYFAKSLGIIGENNFLYR 57

Query: 93  RLNKGEWGSKLWFVTLLLSARKSFSRLLKIMKAKSKLKEEMKELRTEGDEDLVKQVLRNK 152
           RLNKG WGSKLWFVTLLLS RK   ++ +I++ + +LK E+K +   G + L+  VL+ K
Sbjct: 58  RLNKGGWGSKLWFVTLLLSVRKCLRQIFQIVRNRIRLKTEIKGMDKNG-KGLMNDVLKEK 116

Query: 153 FTDALKKCSIIIKDVVLELLQTLAYLAIVVIEVFKINVSQKVIKILEPLSHFIAVIRIFT 212
               L+K + ++++ +L+LLQ   YL IVVI+VFK+N+ ++  +ILEPLS+F+ ++R FT
Sbjct: 117 ILLMLQKSNAMMRETLLDLLQNSVYLMIVVIDVFKLNIPKRARQILEPLSNFVTIMRFFT 176

Query: 213 TGYTTLTV 220
            G++++ V
Sbjct: 177 MGFSSVDV 184

>NDAI0A00190 Chr1 complement(17031..17546) [516 bp, 171 aa] {ON}
           Anc_1.10 YCL056C
          Length = 171

 Score =  165 bits (418), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 115/159 (72%), Gaps = 1/159 (0%)

Query: 56  TFEDTLIAGLESICGLFDNVYLLKTLGIISEDNLLYRRLNKGEWGSKLWFVTLLLSARKS 115
           T ED++I GLE IC +FDNVYLLK+LGIISE+NLLYR LNKG +GSK+WFVTL+L+ RK 
Sbjct: 4   TMEDSIIGGLEYICNIFDNVYLLKSLGIISENNLLYRNLNKGNFGSKIWFVTLILTTRKL 63

Query: 116 FSRLLKIMKAKSKL-KEEMKELRTEGDEDLVKQVLRNKFTDALKKCSIIIKDVVLELLQT 174
             +L++ +KA+ +L KE     R   +E+LV  VL  K    +KKCS +I D++LEL QT
Sbjct: 64  VHQLIRAVKARIRLVKERKNSKRITRNENLVSSVLHEKLDIGIKKCSSMIMDLLLELFQT 123

Query: 175 LAYLAIVVIEVFKINVSQKVIKILEPLSHFIAVIRIFTT 213
           L YL +V I +FK+  S K++ +LE LS+ + +IR+F+ 
Sbjct: 124 LVYLFLVSINIFKLKFSDKMVYVLEHLSNLLVLIRMFSA 162

>NCAS0B09060 Chr2 (1741161..1741664) [504 bp, 167 aa] {ON} Anc_1.10
           YCL056C
          Length = 167

 Score =  157 bits (396), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 86/163 (52%), Positives = 120/163 (73%), Gaps = 2/163 (1%)

Query: 58  EDTLIAGLESICGLFDNVYLLKTLGIISEDNLLYRRLNKGEWGSKLWFVTLLLSARKSFS 117
           ED ++  LESIC +FDNVY  K++G++SE N+LYR LNKG++GSKLWF+TLLLS++K  +
Sbjct: 5   EDNVLNALESICNIFDNVYFFKSIGVLSEKNILYRTLNKGDFGSKLWFLTLLLSSKKLIT 64

Query: 118 RLLKIMKAKSKLKEEMKELRTEGDED--LVKQVLRNKFTDALKKCSIIIKDVVLELLQTL 175
           RL K +K ++K+K+E+ E   E DED  LV  +LR K   +L KC  II++ VLELLQT+
Sbjct: 65  RLTKSLKIRAKIKKEIDESPKENDEDKSLVNSLLREKLELSLAKCMDIIRNNVLELLQTM 124

Query: 176 AYLAIVVIEVFKINVSQKVIKILEPLSHFIAVIRIFTTGYTTL 218
            YL+I  I VFK+ V QK   +LE LS+ I +IR+F +GY++L
Sbjct: 125 MYLSIAFINVFKVKVPQKWKHLLEQLSNIITIIRVFISGYSSL 167

>KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON}
           Anc_1.10 YCL056C
          Length = 174

 Score =  140 bits (352), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 74/166 (44%), Positives = 115/166 (69%), Gaps = 3/166 (1%)

Query: 56  TFEDTLIAGLESICGLFDNVYLLKTLGIISEDNLLYRRLNKGEWGSKLWFVTLLLSARKS 115
           ++ED L+  LESIC +FDN+YLLK+LGIIS++N LYR+LNKG  GSK+WF+TL+LS RK+
Sbjct: 8   SWEDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTLILSIRKN 67

Query: 116 FSRLLKIMKAKSKLKEEMKEL--RTEGDEDLVKQVLRNKFTDALKKCSIIIKDVVLELLQ 173
             RL+++++ + KL  E++++  + + D+ LV  V+ NK +  L+KC  +I D  L+L Q
Sbjct: 68  LKRLVRLVQTRFKLVFEIEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTFLDLAQ 127

Query: 174 TLAYLAIVVIEVFKINVS-QKVIKILEPLSHFIAVIRIFTTGYTTL 218
            L YL IV  + F I    +K  K L P+S+ + ++R+  + YTT+
Sbjct: 128 LLIYLFIVSGDCFNIPPRFKKFKKYLGPMSNVVTILRMLVSVYTTI 173

>SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON}
           conserved hypothetical protein
          Length = 338

 Score =  143 bits (360), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 72/165 (43%), Positives = 109/165 (66%), Gaps = 1/165 (0%)

Query: 56  TFEDTLIAGLESICGLFDNVYLLKTLGIISEDNLLYRRLNKGEWGSKLWFVTLLLSARKS 115
           +FED LI GLES+  +FD+VYLLK  GII E N +YR LNKG  GSKLW  TL+LS RKS
Sbjct: 175 SFEDILIGGLESLTNVFDDVYLLKNFGIIGETNFVYRHLNKGGLGSKLWLATLVLSLRKS 234

Query: 116 FSRLLKIMKAKSKLKEEMKELRTEGDEDLVKQVLRNKFTDALKKCSIIIKDVVLELLQTL 175
             +L ++ +A+  L++E +    +  +   K ++ +KFT  + +    IKDV+L++LQ L
Sbjct: 235 LGQLFRLARARHMLQKERRSTPHKCSKTFAK-IIADKFTQKIGQLDRQIKDVLLDVLQNL 293

Query: 176 AYLAIVVIEVFKINVSQKVIKILEPLSHFIAVIRIFTTGYTTLTV 220
           AYL +V ++VFK+ +  +  ++LE +S  + V R F TG++T+ V
Sbjct: 294 AYLLVVAVDVFKLKLPHRWRRLLEWVSSLVTVSRFFFTGFSTIAV 338

>KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON}
           Anc_1.10 YCL056C
          Length = 185

 Score =  127 bits (320), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 105/164 (64%), Gaps = 7/164 (4%)

Query: 56  TFEDTLIAGLESICGLFDNVYLLKTLGIISEDNLLYRRLNKGEWGSKLWFVTLLLSARKS 115
           T ED LI  LE IC +FDN+Y LK LG+I EDN +Y++LNKG  GSK+W V+L+LS R+ 
Sbjct: 18  TLEDILIDKLEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNLGSKIWLVSLILSIRRC 77

Query: 116 FSRLLKIMKAKSKLKEEM----KELRTEGDEDLVKQVLRNKFTDALKKCSIIIKDVVLEL 171
           F  L  + + + K   E+    K+     +  LV  +L++K   +L+KC+ II+D++LE 
Sbjct: 78  FKNLTHMYRTRRKYVTELSIVSKKRNQSSENGLVNGILKDKLLQSLQKCNSIIRDLLLEF 137

Query: 172 LQTLAYLAIVVIEVFKINVSQKVIK---ILEPLSHFIAVIRIFT 212
           LQ L YL IV+IEVFK+   ++ +K    LE LS+ I V RI T
Sbjct: 138 LQVLLYLIIVIIEVFKVKSLERYVKGIRNLEILSNLITVTRIIT 181

>KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}
           conserved hypothetical protein
          Length = 194

 Score =  116 bits (291), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 65/173 (37%), Positives = 107/173 (61%), Gaps = 3/173 (1%)

Query: 45  VPSPDPNGHIPT--FEDTLIAGLESICGLFDNVYLLKTLGIISEDNLLYRRLNKGEWGSK 102
           + S   N   P+   ED LI  L S+   FD++YLL++ GIIS+ N LY++LNKG+ GSK
Sbjct: 19  IKSLIANEDAPSNSLEDLLIDSLTSVSSFFDDLYLLRSFGIISDTNFLYQKLNKGDIGSK 78

Query: 103 LWFVTLLLSARKSFSRLLKIMKAKSKLKEEMKELRTEGDEDLVKQVLRNKFTDALKKCSI 162
           +W V+LLLS R+S +RL  +++ K KL++E   + +       K++++ K      + S+
Sbjct: 79  VWLVSLLLSIRRSLTRLYTLIRLKLKLRKECMNIASTYSPGF-KKLVKEKILAESNQLSL 137

Query: 163 IIKDVVLELLQTLAYLAIVVIEVFKINVSQKVIKILEPLSHFIAVIRIFTTGY 215
            I+ + ++LLQ L Y+ IV I++FKIN+S K  + LE +S    V++  ++ Y
Sbjct: 138 KIRSLCMDLLQDLLYMIIVSIDIFKINLSLKFKRALELISSAATVLKFVSSSY 190

>TPHA0E03960 Chr5 (833382..833915) [534 bp, 177 aa] {ON} Anc_1.10
           YCL056C
          Length = 177

 Score =  115 bits (287), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 70/167 (41%), Positives = 106/167 (63%), Gaps = 6/167 (3%)

Query: 48  PDPNGHIPTFEDTLIAGLESICGLFDNVYLLKTLGIISEDNLLYRRLNKGEWGSKLWFVT 107
            D NG+   FE TL+  LESI  +FD V+ L++ G+I E+N  YR LN+   GSK+WFVT
Sbjct: 8   SDENGNEEGFESTLLNYLESITNIFDLVFFLRSTGLIKENNFFYRNLNRSNIGSKIWFVT 67

Query: 108 LLLSARKSFSRLLKIMKAKSKLKEEMKELRTEGD--EDLVKQVLRNKFTDALKKCSIIIK 165
           L+LS RK +  +LK  K  S LK E+ ++    D   D++ Q ++N  T   KK    IK
Sbjct: 68  LILSIRKLYKNILKSTKLLSLLKTELTKIEKNNDLTSDIILQKIQNNNTILKKK----IK 123

Query: 166 DVVLELLQTLAYLAIVVIEVFKINVSQKVIKILEPLSHFIAVIRIFT 212
           + ++EL+Q   YL IV +E+FKI++S+K+   LE LS+ +++++ FT
Sbjct: 124 NFIIELIQDFIYLIIVSLEIFKISISKKLNHRLEILSNSVSMLKFFT 170

>KLTH0F00572g Chr6 complement(42946..43533) [588 bp, 195 aa] {ON}
           conserved hypothetical protein
          Length = 195

 Score =  112 bits (279), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 57/168 (33%), Positives = 105/168 (62%), Gaps = 1/168 (0%)

Query: 52  GHIPTFEDTLIAGLESICGLFDNVYLLKTLGIISEDNLLYRRLNKGEWGSKLWFVTLLLS 111
           G     E  L++GLE+I G+FD++ LL++ G+I E+N+ Y++LNK  + SK W V+L LS
Sbjct: 28  GQGKNIESALVSGLETIAGIFDDLQLLRSFGVIGENNVFYQKLNKSGFCSKAWLVSLTLS 87

Query: 112 ARKSFSRLLKIMKAKSKLKEEMKELRTEGDEDLVKQVLRNKFTDALKKCSIIIKDVVLEL 171
           +R++ S ++ +  ++S+LK E  E       + V++VL  K T  +++ +  +  V LEL
Sbjct: 88  SRRNASDIINLAISRSRLKREQAEFMRR-PVNPVRKVLNAKVTARIQEINQKLILVALEL 146

Query: 172 LQTLAYLAIVVIEVFKINVSQKVIKILEPLSHFIAVIRIFTTGYTTLT 219
           +Q + YL +V  +V    +++K  ++LE +S   A+ R+  +G+++LT
Sbjct: 147 IQNIGYLTLVAADVLAFGLTEKWKRLLERVSSIFAIARLLFSGFSSLT 194

>Kwal_33.13023 s33 complement(43697..44278) [582 bp, 193 aa] {ON}
           [contig 123] FULL
          Length = 193

 Score =  102 bits (254), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 57/159 (35%), Positives = 98/159 (61%), Gaps = 2/159 (1%)

Query: 58  EDTLIAGLESICGLFDNVYLLKTLGIISEDNLLYRRLNKGEWGSKLWFVTLLLSARKSFS 117
           E+  I+G+ES+ GLFD+++LLK+ GIISE N +YR+LNK  + SK+W ++L+LS RK   
Sbjct: 34  ENFCISGMESVAGLFDDIHLLKSFGIISESNYVYRKLNKSGFCSKVWLLSLVLSTRKCIR 93

Query: 118 RLLKIMKAKSKLKEEMKELRTEGDEDLVKQVLRNKFTDALKKCSIIIKDVVLELLQTLAY 177
            L  +  ++S+L++E           L ++ L +K    +K  +  +  V LE++Q +AY
Sbjct: 94  DLNNLWMSRSRLRKEEVHFTMHSSNSL-RRALSDKIALKIKDVNRRLILVALEIMQNIAY 152

Query: 178 LAIVVIEVFKINVSQKVIKILEPLSHFIAVIR-IFTTGY 215
           L IV  +VF +N+ ++   +LE  S  + V++ +F + Y
Sbjct: 153 LIIVAADVFTLNLVERWKNLLEKCSSLLTVLKFLFLSIY 191

>TBLA0A04970 Chr1 complement(1220824..1221369) [546 bp, 181 aa] {ON}
           Anc_1.10 YCL056C
          Length = 181

 Score = 76.6 bits (187), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 67/177 (37%), Positives = 111/177 (62%), Gaps = 15/177 (8%)

Query: 51  NGHIPTFEDTLIAGLESICGLFDNVYLLKTLGIISEDNLLYRRLNKGEWGSKLWFVTLLL 110
           N  I  F+  ++ GLESIC +FDN+Y L+++G+IS+ NL YR LN+ E GSK+W +TL+L
Sbjct: 5   NNSIWKFD--ILYGLESICSVFDNIYFLRSIGLISDTNLFYRLLNRSELGSKIWLITLVL 62

Query: 111 SARKSFSRLLKIMKAKSKLKEEMK----ELRTEGDEDLVKQV---LRNKFTDALKKCSII 163
           + RK    LLK++K K+K+ +E++    +L+ E   +  K V   +++K  ++LK  +  
Sbjct: 63  NIRKDTLELLKLLKLKTKISDELEFQLTKLKMEKIGNYSKDVTLIIKDKLQNSLKIINNS 122

Query: 164 IKDVVLELLQTLAYLAIVVI----EVFKINVSQKVIKILEPLSHFIAVIRIFTTGYT 216
           IKD + +L+Q L YL I++I      +K    Q+   ILE +S+ + V R+F+T + 
Sbjct: 123 IKDRIFDLIQNLIYLLILLINIGGHYYK--SLQRFKHILEIISNMLIVSRVFSTNFN 177

>Ecym_1012 Chr1 complement(22226..22759) [534 bp, 177 aa] {ON}
           similar to XP_452220 - K. lactis - KLLA0C00594g
          Length = 177

 Score = 75.1 bits (183), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 51/151 (33%), Positives = 82/151 (54%), Gaps = 15/151 (9%)

Query: 49  DPNGHIPTFEDTLIAGLESICGLFDNVYLLKTLGIISEDNLLYRRLNKGEW--GSKLWFV 106
           D NG   TFED L   L S    +D +YL +++GII +DN++Y+ L  G+   GS+L F 
Sbjct: 25  DTNGSPTTFEDQLTENLRSAVTFYDLIYLFQSIGIIKKDNVIYKALAVGKINSGSRLLF- 83

Query: 107 TLLLSARKSFSRLLKIMKAKSKLKEEMKELRTEGDEDLVKQVLRNKFTDALKKCSIIIKD 166
            LLL ARK+F +LL++++    LK  +               ++ K+ +   +    I  
Sbjct: 84  -LLLVARKTFLKLLRLVRLWYALKNVLPP-----------ASIKKKYNETKSRVKRSILR 131

Query: 167 VVLELLQTLAYLAIVVIEVFKINVSQKVIKI 197
           + ++LL TL YL +V+I++FK  VS    K+
Sbjct: 132 LSVDLLDTLVYLIVVLIDLFKFKVSDSTRKL 162

>Kpol_2002.13 s2002 complement(23954..24448) [495 bp, 164 aa] {ON}
           complement(23954..24448) [495 nt, 165 aa]
          Length = 164

 Score = 62.4 bits (150), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 56/157 (35%), Positives = 92/157 (58%), Gaps = 4/157 (2%)

Query: 57  FEDTLIAGLESICGLFDNVYLLKTLGIISEDNLLYRRLNKGEWGSKLWFVTLLLSARKSF 116
           +ED ++ GLE IC LFD++Y +KTLGII++ + LYR++ +  +  KLW  TLLL  +K  
Sbjct: 6   WEDIVLDGLEGICSLFDSIYFIKTLGIITDKSFLYRKIIQNNFSLKLWLATLLLIIKKLV 65

Query: 117 SRLLKIMKAKSKLKEEMKE----LRTEGDEDLVKQVLRNKFTDALKKCSIIIKDVVLELL 172
            +L +  K    LK E+K+           + +  +L  K    + +    IK  +L+L+
Sbjct: 66  VKLFQNYKILRFLKIELKQHINNNNNNNKNNHINSILLEKLNKKINQHYNFIKLNLLDLI 125

Query: 173 QTLAYLAIVVIEVFKINVSQKVIKILEPLSHFIAVIR 209
           Q L Y AIV+IE+ K+ +S+K   ILE L++ I +++
Sbjct: 126 QNLLYCAIVIIELLKLKISKKSKFILELLANSITIVK 162

>Kpol_1050.111 s1050 complement(248965..249435) [471 bp, 156 aa]
           {ON} complement(248965..249435) [471 nt, 157 aa]
          Length = 156

 Score = 32.0 bits (71), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 42/93 (45%), Gaps = 9/93 (9%)

Query: 78  LKTLGIISEDNLLYRRLNKGEWGSKLWFVTLLLSARKSFSRLLKIMKAKSKLKEEMKELR 137
            KTLG+   +N L   LN G  G ++ F   L     SF +      +K +L++  K + 
Sbjct: 44  FKTLGVTIGENELDGMLNSGGVGEEVSFPEFLRVMSGSFEQF----SSKKELEDSFKNIS 99

Query: 138 TEGDEDLVKQVL-----RNKFTDALKKCSIIIK 165
           +E D ++ +Q L        F DA  + S I K
Sbjct: 100 SESDGNVSQQELTMHLKEAGFQDAESQFSEITK 132

>NCAS0A01960 Chr1 (376597..377886) [1290 bp, 429 aa] {ON} Anc_4.160
          Length = 429

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 31/67 (46%), Gaps = 5/67 (7%)

Query: 33  PDKIDSPAPGSEVPSPDPNGHIPTFEDTLIAGLESICGLFDNVYLLKTLGIISEDNLLYR 92
           P  ++    GS   S + + HI T  D +IA   S   L   V  +  +G I     LYR
Sbjct: 269 PSDMNQERLGSLETSNNMSDHILTDVDFVIAKQYSSSSLRFYVANVTNIGCI-----LYR 323

Query: 93  RLNKGEW 99
           R N+GEW
Sbjct: 324 RTNRGEW 330

>TPHA0L02310 Chr12 complement(485671..488949) [3279 bp, 1092 aa]
           {ON} Anc_5.11 YMR308C
          Length = 1092

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 10/74 (13%)

Query: 149 LRNKFTDALKKCSIIIKDVVLELLQTLAYLAIVVIEVFKINVSQKVIKILEPLSHFI--- 205
           +R+K +DA+ +C+    D   ELLQTL    +  I+    N  +   +IL  + H I   
Sbjct: 118 IRHKLSDAVAECATEDMDDWPELLQTL----MEAIKNSNPNFRESSFRILSSVPHLINAV 173

Query: 206 ---AVIRIFTTGYT 216
              +++ IF +G++
Sbjct: 174 AVNSILAIFESGFS 187

>YCL056C Chr3 complement(26925..27359) [435 bp, 144 aa] {ON}
           PEX34Peroxisomal integral membrane protein that
           regulates peroxisome populations; interacts with Pex11p,
           Pex25p, and Pex27p to control both constitutive
           peroxisome division and peroxisome morphology and
           abundance during peroxisome proliferation
          Length = 144

 Score = 29.6 bits (65), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 63/124 (50%), Gaps = 17/124 (13%)

Query: 59  DTLIAGLESICGLFDNVYLLKTLGIISEDNLLYRRLNKGEWGSKLWFVTLLLSARKSFSR 118
           + + +G+ S   L D   +L+ LG+++ D L    L +     K+W     +S  K   +
Sbjct: 17  ENIWSGVSS---LLDFFAVLENLGVVN-DKLYVSGLLR-----KVWLCYSCISVIKCVWK 67

Query: 119 LLKIMKAKSKLKEEMKELRTEGDEDLVKQVLRNKFTDALKKCSIIIKDVVLELLQTLAYL 178
           L+K+ K K K+ +     R +G+ +    ++++K  +  KK +  I+ +   LLQ L+YL
Sbjct: 68  LIKLCKVKFKIDQ-----RLDGEGN---GLVKDKLINFKKKYNEHIRHITAALLQDLSYL 119

Query: 179 AIVV 182
            +++
Sbjct: 120 MVLI 123

>Skud_3.8 Chr3 complement(14921..15355) [435 bp, 144 aa] {ON}
           YCL056C (REAL)
          Length = 144

 Score = 29.3 bits (64), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 55/120 (45%), Gaps = 20/120 (16%)

Query: 66  ESICGLFDNVYLLKTLGIISEDNLLYRRLNKGEWGSKLWFVTLLLSARKSFSRLLKIMKA 125
            S   L D   +L+ LG++ +   L   L       K+W     +S  +   +L+K+ K 
Sbjct: 21  NSASSLLDFFAVLENLGVVDDKLYLSGIL------RKVWLCYSWVSVVRCIWKLIKLCKV 74

Query: 126 KSKLKEEMKELRTEGDEDLVKQVL---RNKFTDALKKCSIIIKDVVLELLQTLAYLAIVV 182
           K K+ E    L  +G+  L+K+ L   R  + D        I+ ++  LLQ L+YL +++
Sbjct: 75  KFKIDER---LNGQGN-GLIKEKLVNFRKMYNDQ-------IRQIIANLLQDLSYLMVLI 123

>Suva_3.157 Chr3 complement(236677..237111) [435 bp, 144 aa] {ON}
           YCL056C (REAL)
          Length = 144

 Score = 28.5 bits (62), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 57/138 (41%), Gaps = 20/138 (14%)

Query: 48  PDPNGHIPTFEDTLIAGLESICGLFDNVYLLKTLGIISEDNLLYRRLNKGEWGSKLWFVT 107
           P  N       D        +  L D   +L+ LG++ +   L   L       K+W   
Sbjct: 3   PKENAGEIGGRDPWTKVWNGVSSLLDFFAVLENLGVVDDKLYLSGIL------RKVWLCY 56

Query: 108 LLLSARKSFSRLLKIMKAKSKLKEEMKELRTEGDEDLVKQVLRN---KFTDALKKCSIII 164
             +S  +   +L+K+ + K K+ E    L  +G+  L+K+ L N    + D        I
Sbjct: 57  SWISVVRCVWKLIKLCRVKFKINER---LNGQGN-GLIKEKLINFGKMYNDQ-------I 105

Query: 165 KDVVLELLQTLAYLAIVV 182
           K +   LLQ L+YL +++
Sbjct: 106 KQITANLLQDLSYLMVLI 123

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.138    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,573,541
Number of extensions: 837884
Number of successful extensions: 3213
Number of sequences better than 10.0: 36
Number of HSP's gapped: 3247
Number of HSP's successfully gapped: 36
Length of query: 220
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 115
Effective length of database: 41,441,469
Effective search space: 4765768935
Effective search space used: 4765768935
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 63 (28.9 bits)