Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F16676g1.82ON1994196787380.0
TDEL0C061901.82ON1879185144750.0
NCAS0A005901.82ON1946163340790.0
Suva_14.711.82ON194863321150.0
YNL271C (BNI1)1.82ON195387421120.0
Smik_14.661.82ON195262721090.0
Skud_14.691.82ON194683420900.0
KAFR0D039501.82ON195782620290.0
NDAI0F042201.82ON202289320060.0
CAGL0J08206g1.82ON189863819640.0
Kpol_2000.661.82ON193082319530.0
TPHA0B044901.82ON194067719340.0
TBLA0A054401.82ON217064619010.0
KNAG0F004701.82ON202883818880.0
Kwal_33.133921.82ON196864017630.0
AFR669W1.82ON191860917090.0
SAKL0C02618g1.82ON198865717000.0
KLTH0F02376g1.82ON197663116560.0
Ecym_10861.82ON209164116510.0
KLLA0C02321g1.82ON184258416160.0
NCAS0G001205.717ON13144217773e-83
SAKL0E15224g5.717ON13354187641e-81
Ecym_40045.717ON14544247367e-78
AFR301C5.717ON16554377352e-77
TDEL0F055605.717ON12924227176e-76
ZYRO0B16654g5.717ON14244217152e-75
Kpol_416.105.717ON14914277117e-75
Ecym_5679na 1ON13064177052e-74
KNAG0L022505.717ON13674327018e-74
CAGL0H06765g5.717ON12944266962e-73
AGL364Cna 1ON12604536952e-73
Kwal_55.196205.717ON13894316955e-73
NDAI0F001605.717ON13494286911e-72
KLLA0F10912g5.717ON12834306863e-72
KLTH0E00704g5.717ON13894196803e-71
Smik_9.95.717ON13744336689e-70
TPHA0E001205.717ON16424386662e-69
Skud_9.85.717ON13744316562e-68
YIL159W (BNR1)5.717ON13754396482e-67
TBLA0E018105.717ON14514186482e-67
KAFR0D021205.717ON13244176437e-67
Suva_9.265.717ON13754226044e-62
CAGL0E04884g8.425ON1489139830.83
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F16676g
         (1994 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F16676g Chr6 (1376370..1382354) [5985 bp, 1994 aa] {ON} som...  3370   0.0  
TDEL0C06190 Chr3 (1122358..1127997) [5640 bp, 1879 aa] {ON} Anc_...  1728   0.0  
NCAS0A00590 Chr1 complement(102748..108588) [5841 bp, 1946 aa] {...  1575   0.0  
Suva_14.71 Chr14 complement(124082..126073,126104..129958) [5847...   819   0.0  
YNL271C Chr14 complement(129522..135383) [5862 bp, 1953 aa] {ON}...   818   0.0  
Smik_14.66 Chr14 complement(108587..114445) [5859 bp, 1952 aa] {...   816   0.0  
Skud_14.69 Chr14 complement(118022..123862) [5841 bp, 1946 aa] {...   809   0.0  
KAFR0D03950 Chr4 (770599..776472) [5874 bp, 1957 aa] {ON} Anc_1....   786   0.0  
NDAI0F04220 Chr6 (1024727..1030795) [6069 bp, 2022 aa] {ON}           777   0.0  
CAGL0J08206g Chr10 (809506..815202) [5697 bp, 1898 aa] {ON} simi...   761   0.0  
Kpol_2000.66 s2000 (137817..142124,142127..143611) [5793 bp, 193...   756   0.0  
TPHA0B04490 Chr2 (1052780..1058602) [5823 bp, 1940 aa] {ON} Anc_...   749   0.0  
TBLA0A05440 Chr1 complement(1337261..1343773) [6513 bp, 2170 aa]...   736   0.0  
KNAG0F00470 Chr6 complement(66506..72592) [6087 bp, 2028 aa] {ON}     731   0.0  
Kwal_33.13392 s33 complement(199821..205727) [5907 bp, 1968 aa] ...   683   0.0  
AFR669W Chr6 (1662202..1667958) [5757 bp, 1918 aa] {ON} Syntenic...   662   0.0  
SAKL0C02618g Chr3 complement(240920..246886) [5967 bp, 1988 aa] ...   659   0.0  
KLTH0F02376g Chr6 complement(196194..202124) [5931 bp, 1976 aa] ...   642   0.0  
Ecym_1086 Chr1 complement(173244..179519) [6276 bp, 2091 aa] {ON...   640   0.0  
KLLA0C02321g Chr3 complement(196533..202061) [5529 bp, 1842 aa] ...   627   0.0  
NCAS0G00120 Chr7 (7566..11510) [3945 bp, 1314 aa] {ON} Anc_5.717      303   3e-83
SAKL0E15224g Chr5 complement(1269114..1273121) [4008 bp, 1335 aa...   298   1e-81
Ecym_4004 Chr4 (8927..13291) [4365 bp, 1454 aa] {ON} similar to ...   288   7e-78
AFR301C Chr6 complement(981209..986176) [4968 bp, 1655 aa] {ON} ...   287   2e-77
TDEL0F05560 Chr6 complement(1037567..1041445) [3879 bp, 1292 aa]...   280   6e-76
ZYRO0B16654g Chr2 complement(1351398..1355672) [4275 bp, 1424 aa...   280   2e-75
Kpol_416.10 s416 (35789..38224,38226..40265) [4476 bp, 1491 aa] ...   278   7e-75
Ecym_5679 Chr5 (1380448..1384368) [3921 bp, 1306 aa] {ON} simila...   276   2e-74
KNAG0L02250 Chr12 complement(399706..403809) [4104 bp, 1367 aa] ...   274   8e-74
CAGL0H06765g Chr8 complement(672619..676503) [3885 bp, 1294 aa] ...   272   2e-73
AGL364C Chr7 complement(16861..20643) [3783 bp, 1260 aa] {ON} Sy...   272   2e-73
Kwal_55.19620 s55 (52863..57032) [4170 bp, 1389 aa] {ON} YIL159W...   272   5e-73
NDAI0F00160 Chr6 (21351..25400) [4050 bp, 1349 aa] {ON} Anc_5.717     270   1e-72
KLLA0F10912g Chr6 (1003827..1007678) [3852 bp, 1283 aa] {ON} som...   268   3e-72
KLTH0E00704g Chr5 (70073..74242) [4170 bp, 1389 aa] {ON} some si...   266   3e-71
Smik_9.9 Chr9 (19563..23687) [4125 bp, 1374 aa] {ON} YIL159W (REAL)   261   9e-70
TPHA0E00120 Chr5 (4818..9746) [4929 bp, 1642 aa] {ON} Anc_5.717 ...   261   2e-69
Skud_9.8 Chr9 (18913..23037) [4125 bp, 1374 aa] {ON} YIL159W (REAL)   257   2e-68
YIL159W Chr9 (41825..45952) [4128 bp, 1375 aa] {ON}  BNR1Formin,...   254   2e-67
TBLA0E01810 Chr5 complement(441141..445496) [4356 bp, 1451 aa] {...   254   2e-67
KAFR0D02120 Chr4 (425677..429651) [3975 bp, 1324 aa] {ON} Anc_5....   252   7e-67
Suva_9.26 Chr9 (34756..38883) [4128 bp, 1375 aa] {ON} YIL159W (R...   237   4e-62
CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa] ...    37   0.83 

>ZYRO0F16676g Chr6 (1376370..1382354) [5985 bp, 1994 aa] {ON} some
            similarities with uniprot|P41832 Saccharomyces cerevisiae
            YNL271C BNI1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1994

 Score = 3370 bits (8738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1690/1967 (85%), Positives = 1690/1967 (85%)

Query: 28   LIQGLKRLXXXXXXXXXXXXXXXXXXXRIETGDIXXXXXXXXXXRVTNANDLRPLXXXXX 87
            LIQGLKRL                   RIETGDI          RVTNANDLRPL     
Sbjct: 28   LIQGLKRLANPQSSSSAAASPTPPSNQRIETGDISSPKKVSVPSRVTNANDLRPLNHHYN 87

Query: 88   XXXXXXXSRTPSQQSTGSKYTYPKRTSSSITGGNPSLPSSSATPIPAPVTPGQLSRXXXX 147
                   SRTPSQQSTGSKYTYPKRTSSSITGGNPSLPSSSATPIPAPVTPGQLSR    
Sbjct: 88   HHHNHHHSRTPSQQSTGSKYTYPKRTSSSITGGNPSLPSSSATPIPAPVTPGQLSRQQTN 147

Query: 148  XXXXXXXXXXXXVLSQGSLTNLGRFMRPDGKVRLDMPQDYHEVESLFEDIMYKRNIMQTL 207
                        VLSQGSLTNLGRFMRPDGKVRLDMPQDYHEVESLFEDIMYKRNIMQTL
Sbjct: 148  HSHANSQSSAASVLSQGSLTNLGRFMRPDGKVRLDMPQDYHEVESLFEDIMYKRNIMQTL 207

Query: 208  PPEKQQELRNYDIDKKWLIVRQDXXXXXXXXXXXXXXXXXXXXXXXXXLSLTNTISSHDY 267
            PPEKQQELRNYDIDKKWLIVRQD                         LSLTNTISSHDY
Sbjct: 208  PPEKQQELRNYDIDKKWLIVRQDLSSDLKKMMAKSSSSATQASANTTDLSLTNTISSHDY 267

Query: 268  SDATSIRHMKTXXXXXXXXXXXXXXXXXXXXXTTVNTEKINRPPTYYVKKIIADDLTIDE 327
            SDATSIRHMKT                     TTVNTEKINRPPTYYVKKIIADDLTIDE
Sbjct: 268  SDATSIRHMKTNASSKSLNSNLYSNANANSSNTTVNTEKINRPPTYYVKKIIADDLTIDE 327

Query: 328  LNDLWVTLRTEQLDWVDAFLEHQGHIAMANVLMKSLYKTTQEVKLTEKSLEREASYFKCF 387
            LNDLWVTLRTEQLDWVDAFLEHQGHIAMANVLMKSLYKTTQEVKLTEKSLEREASYFKCF
Sbjct: 328  LNDLWVTLRTEQLDWVDAFLEHQGHIAMANVLMKSLYKTTQEVKLTEKSLEREASYFKCF 387

Query: 388  RVLVMLAQGLYEFTKHAIMAETVAYALFSIRLPTRKMATEIFVCMLEKKNKSRFDVILTA 447
            RVLVMLAQGLYEFTKHAIMAETVAYALFSIRLPTRKMATEIFVCMLEKKNKSRFDVILTA
Sbjct: 388  RVLVMLAQGLYEFTKHAIMAETVAYALFSIRLPTRKMATEIFVCMLEKKNKSRFDVILTA 447

Query: 448  LDKKFMIGENLHMMQFVKNSPQQFIHLKRDSQFKIVQAWLTGLETALQGRGKMGSLVGAS 507
            LDKKFMIGENLHMMQFVKNSPQQFIHLKRDSQFKIVQAWLTGLETALQGRGKMGSLVGAS
Sbjct: 448  LDKKFMIGENLHMMQFVKNSPQQFIHLKRDSQFKIVQAWLTGLETALQGRGKMGSLVGAS 507

Query: 508  EEVRAAGGENSILEYSQWTMVFINHLCMGTDVVNQRVLLRTRLENAGALRIMNRFKLLDY 567
            EEVRAAGGENSILEYSQWTMVFINHLCMGTDVVNQRVLLRTRLENAGALRIMNRFKLLDY
Sbjct: 508  EEVRAAGGENSILEYSQWTMVFINHLCMGTDVVNQRVLLRTRLENAGALRIMNRFKLLDY 567

Query: 568  DKITAQIEYYENGKLDDINNLLESEGRNTQVNMQDPMMMLQTMWDYCKGTENEKTFISLI 627
            DKITAQIEYYENGKLDDINNLLESEGRNTQVNMQDPMMMLQTMWDYCKGTENEKTFISLI
Sbjct: 568  DKITAQIEYYENGKLDDINNLLESEGRNTQVNMQDPMMMLQTMWDYCKGTENEKTFISLI 627

Query: 628  KHLFLSSSKVADDRGDPSKLAKQLKLMDSLXXXXXXXXXXXXXXXXXXIQRLYDAMQTDE 687
            KHLFLSSSKVADDRGDPSKLAKQLKLMDSL                  IQRLYDAMQTDE
Sbjct: 628  KHLFLSSSKVADDRGDPSKLAKQLKLMDSLVANVSVSAVDEESSVNVAIQRLYDAMQTDE 687

Query: 688  VARRAILESRQLTKELEEIQAERDFLRQKLNSTGDGIVGRLEEELKQRDDILAKNQRVNR 747
            VARRAILESRQLTKELEEIQAERDFLRQKLNSTGDGIVGRLEEELKQRDDILAKNQRVNR
Sbjct: 688  VARRAILESRQLTKELEEIQAERDFLRQKLNSTGDGIVGRLEEELKQRDDILAKNQRVNR 747

Query: 748  HLQAXXXXXXXXXXXXXXXXXXXXXXMLTILNARPDDENLAKSTKVTKSVNGLDPDRQTS 807
            HLQA                      MLTILNARPDDENLAKSTKVTKSVNGLDPDRQTS
Sbjct: 748  HLQAELEELKKKHLLEKHEHEVELRKMLTILNARPDDENLAKSTKVTKSVNGLDPDRQTS 807

Query: 808  IQKALQDGLQRTRKDLSVDSKRFGITVQPNKRLRMLRMKMEGIEQEARELEMTNFAEHEE 867
            IQKALQDGLQRTRKDLSVDSKRFGITVQPNKRLRMLRMKMEGIEQEARELEMTNFAEHEE
Sbjct: 808  IQKALQDGLQRTRKDLSVDSKRFGITVQPNKRLRMLRMKMEGIEQEARELEMTNFAEHEE 867

Query: 868  KQLEEPVGTGTKKKAGVRKLSELRKQLSDIQKETNEVTKFNVEERVKELFNQXXXXXXXX 927
            KQLEEPVGTGTKKKAGVRKLSELRKQLSDIQKETNEVTKFNVEERVKELFNQ        
Sbjct: 868  KQLEEPVGTGTKKKAGVRKLSELRKQLSDIQKETNEVTKFNVEERVKELFNQKRLKALKR 927

Query: 928  XXXXXTTYKGFGIDFNANALLESKGGDIHWNDDEIDGQDLQGAQEKMDEMDRIANELTAM 987
                 TTYKGFGIDFNANALLESKGGDIHWNDDEIDGQDLQGAQEKMDEMDRIANELTAM
Sbjct: 928  LKELETTYKGFGIDFNANALLESKGGDIHWNDDEIDGQDLQGAQEKMDEMDRIANELTAM 987

Query: 988  KMKVEIQNQQQHXXXXXXXXXXXXXXGATGSRTDTASEFSQKSFGSGAGSFLEALSQKYG 1047
            KMKVEIQNQQQH              GATGSRTDTASEFSQKSFGSGAGSFLEALSQKYG
Sbjct: 988  KMKVEIQNQQQHTDSSSTESSSEDDDGATGSRTDTASEFSQKSFGSGAGSFLEALSQKYG 1047

Query: 1048 AGQNTTISNSPFPGVDRKSSNHRTSFANRMKKSNATPYFDELTRKVAKAPSLNDPSSPGS 1107
            AGQNTTISNSPFPGVDRKSSNHRTSFANRMKKSNATPYFDELTRKVAKAPSLNDPSSPGS
Sbjct: 1048 AGQNTTISNSPFPGVDRKSSNHRTSFANRMKKSNATPYFDELTRKVAKAPSLNDPSSPGS 1107

Query: 1108 NEPGDDDTLPATSPTVPQSINDTVSKDKNSTSSPEAPPTLDPGSVHSDERAXXXXXXXXS 1167
            NEPGDDDTLPATSPTVPQSINDTVSKDKNSTSSPEAPPTLDPGSVHSDERA        S
Sbjct: 1108 NEPGDDDTLPATSPTVPQSINDTVSKDKNSTSSPEAPPTLDPGSVHSDERAPPPPPPLPS 1167

Query: 1168 MLFGEKAPQHGTGXXXXXXXXXXXXXXIFNQASVKGSTAIXXXXXXXALGGSNXXXXXXX 1227
            MLFGEKAPQHGTG              IFNQASVKGSTAI       ALGGSN       
Sbjct: 1168 MLFGEKAPQHGTGAPAPPPPPPPPPLPIFNQASVKGSTAIPPPPLPPALGGSNSPTPSPT 1227

Query: 1228 XXXXXLFAGQKKMYRSDMSNYLEETPTFRDNYPQPHKKLKQLHWEKLDATEDSIWSSGVA 1287
                 LFAGQKKMYRSDMSNYLEETPTFRDNYPQPHKKLKQLHWEKLDATEDSIWSSGVA
Sbjct: 1228 PPPPPLFAGQKKMYRSDMSNYLEETPTFRDNYPQPHKKLKQLHWEKLDATEDSIWSSGVA 1287

Query: 1288 EKFAGDLYEKGVLAGLEKAFAAREIKNLATKKKEDLKKITFLSHDFSQQFGINLHMYSHM 1347
            EKFAGDLYEKGVLAGLEKAFAAREIKNLATKKKEDLKKITFLSHDFSQQFGINLHMYSHM
Sbjct: 1288 EKFAGDLYEKGVLAGLEKAFAAREIKNLATKKKEDLKKITFLSHDFSQQFGINLHMYSHM 1347

Query: 1348 SVNDLVIKILKCDRDFMQTPSVIEFLSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKP 1407
            SVNDLVIKILKCDRDFMQTPSVIEFLSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKP
Sbjct: 1348 SVNDLVIKILKCDRDFMQTPSVIEFLSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKP 1407

Query: 1408 PEKDPNDLQRADQIYLQLIFNLQAYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAI 1467
            PEKDPNDLQRADQIYLQLIFNLQAYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAI
Sbjct: 1408 PEKDPNDLQRADQIYLQLIFNLQAYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAI 1467

Query: 1468 LKSENLSNIFNVILAVGNFMNDTAKRAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRG 1527
            LKSENLSNIFNVILAVGNFMNDTAKRAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRG
Sbjct: 1468 LKSENLSNIFNVILAVGNFMNDTAKRAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRG 1527

Query: 1528 NYPSFNDFLKELEPVLNVTKISIDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDR 1587
            NYPSFNDFLKELEPVLNVTKISIDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDR
Sbjct: 1528 NYPSFNDFLKELEPVLNVTKISIDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDR 1587

Query: 1588 VLIKVLPVLPEARKKCDLLDDEVRLSIMEFENLMQKYGEDTGXXXXXXXXXXXXXXXVQE 1647
            VLIKVLPVLPEARKKCDLLDDEVRLSIMEFENLMQKYGEDTG               VQE
Sbjct: 1588 VLIKVLPVLPEARKKCDLLDDEVRLSIMEFENLMQKYGEDTGDKFAKNSFFKKFADFVQE 1647

Query: 1648 YKKAQNQNLKVEEEERVYERHKKMVEEQQRREQTPSKNRDYVVNXXXXXXXXXXXXXXXX 1707
            YKKAQNQNLKVEEEERVYERHKKMVEEQQRREQTPSKNRDYVVN                
Sbjct: 1648 YKKAQNQNLKVEEEERVYERHKKMVEEQQRREQTPSKNRDYVVNEDEDIADDDDQDRRAM 1707

Query: 1708 XXKLLDQLKNAGPTTSDPSSARKRALMRRKLQADKDAAAHLISDLDSNEDSIVYSPNASQ 1767
              KLLDQLKNAGPTTSDPSSARKRALMRRKLQADKDAAAHLISDLDSNEDSIVYSPNASQ
Sbjct: 1708 MDKLLDQLKNAGPTTSDPSSARKRALMRRKLQADKDAAAHLISDLDSNEDSIVYSPNASQ 1767

Query: 1768 DQSANAEEASPTVHKGSNKNNKPVLSDLESPIKASRNADRXXXXXXXXISDKAKNLLMEL 1827
            DQSANAEEASPTVHKGSNKNNKPVLSDLESPIKASRNADR        ISDKAKNLLMEL
Sbjct: 1768 DQSANAEEASPTVHKGSNKNNKPVLSDLESPIKASRNADRNNENEEEEISDKAKNLLMEL 1827

Query: 1828 SGNGAPTRREELLNGHKERLRARRRRTQGHGELISSNKLAFLDDETPPVTPTDSEFNRDA 1887
            SGNGAPTRREELLNGHKERLRARRRRTQGHGELISSNKLAFLDDETPPVTPTDSEFNRDA
Sbjct: 1828 SGNGAPTRREELLNGHKERLRARRRRTQGHGELISSNKLAFLDDETPPVTPTDSEFNRDA 1887

Query: 1888 LSSSHSSHRETPDSGGRSATVTPNRHFEEXXXXXXXXXXXSDGSLNNLKFETRTQDASYT 1947
            LSSSHSSHRETPDSGGRSATVTPNRHFEE           SDGSLNNLKFETRTQDASYT
Sbjct: 1888 LSSSHSSHRETPDSGGRSATVTPNRHFEEQQQQYHHQQHQSDGSLNNLKFETRTQDASYT 1947

Query: 1948 SPPIYEDTMXXXXXXXXXXXXXXFKDVLESVAPEDAGSTEEEAREQR 1994
            SPPIYEDTM              FKDVLESVAPEDAGSTEEEAREQR
Sbjct: 1948 SPPIYEDTMRDDARDDSRDDSASFKDVLESVAPEDAGSTEEEAREQR 1994

>TDEL0C06190 Chr3 (1122358..1127997) [5640 bp, 1879 aa] {ON} Anc_1.82
            YNL271C
          Length = 1879

 Score = 1728 bits (4475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 944/1851 (50%), Positives = 1187/1851 (64%), Gaps = 123/1851 (6%)

Query: 55   RIETGDIXXXXXXXXXXRVTNANDLRPLXX----------------XXXXXXXXXXSRTP 98
            RIET DI          RV+NANDLRPL                            SR+P
Sbjct: 45   RIETSDISSPRKVSVPSRVSNANDLRPLNKKSTMNTQNLSHYMNGKSSAESLSSNHSRSP 104

Query: 99   SQQSTGSKYTYPKRTSSSITGGNPSLPSSSATPIPAPVTPGQLSRXXXXXXXXXXXXXXX 158
            S QS+ +KYTY +R+SS +     S P  ++T    P                       
Sbjct: 105  SVQSS-TKYTYSRRSSSHL-----STPGVNSTLTREPTN---------------QSLSSS 143

Query: 159  XVLSQGSLTNLGRFMRPDGKVRLDMPQDYHEVESLFEDIMYKRNIMQTLPPEKQQELRNY 218
             VLSQ S +NL  FM PDGK++LDMP   HEVE+LFED+MYKRNI+Q L P+KQ+EL +Y
Sbjct: 144  SVLSQDSFSNLAIFMTPDGKIKLDMPSS-HEVENLFEDMMYKRNILQNLSPDKQKELMDY 202

Query: 219  DIDKKWLIVRQDXXX------XXXXXXXXXXXXXXXXXXXXXXLSLTNTISSHDY-SDAT 271
            D+DKKWLIV+QD                               L +++  SS  Y S   
Sbjct: 203  DVDKKWLIVKQDLQNDFKKLLAKGVPAAHAAISSSNSDSLPSSLKVSSPRSSMTYESIQQ 262

Query: 272  SIRHMKTXXXXXX-----XXXXXXXXXXXXXXXTTVNTEKINRPPTYYVKKIIADDLTID 326
            +I+  KT                          +T+ TEKINRPP +YVK+IIAD LT +
Sbjct: 263  AIKFNKTNNGSSSGPASNNKSKLQQLSDKNSSTSTLTTEKINRPPIHYVKRIIADKLTGN 322

Query: 327  ELNDLWVTLRTEQLDWVDAFLEHQGHIAMANVLMKSLYKTTQEVKLTEKSLEREASYFKC 386
            E+NDLWVTLRTEQLDWVD FLEHQGHIAMANVL  S+YKT  E  L+   LE+E ++F+C
Sbjct: 323  EMNDLWVTLRTEQLDWVDGFLEHQGHIAMANVLTTSIYKTDPETPLSYDLLEKEHAFFRC 382

Query: 387  FRVLVMLAQGLYEFTKHAIMAETVAYALFSIRLPTRKMATEIFVCMLEKKNKSRFDVILT 446
            FRVL +L QGLYE ++H IMAETVA  LFS+RL TRKMATEIFVCMLEKKNK RF+ +L 
Sbjct: 383  FRVLSVLTQGLYELSRHNIMAETVANGLFSVRLATRKMATEIFVCMLEKKNKVRFEAVLN 442

Query: 447  ALDKKFMIGENLHMMQFVKNSPQQFIHLKRDSQFKIVQAWLTGLETALQGRGKMGSLVGA 506
            ALDKKF IGENLHM+ ++KNSPQ F H  RDSQFKIVQ+WL  +E +L+GRGKMGSLVGA
Sbjct: 443  ALDKKFKIGENLHMLHYMKNSPQHFSHFTRDSQFKIVQSWLFAVEQSLEGRGKMGSLVGA 502

Query: 507  SEEVRAAGGENSILEYSQWTMVFINHLCMGTDVVNQRVLLRTRLENAGALRIMNRFKLLD 566
            SE+ +A+GGEN+ILEYSQWTMVFINH C GTDV+NQR+LLRTRLENAG LRIMN+FKLLD
Sbjct: 503  SEDFKASGGENAILEYSQWTMVFINHFCNGTDVINQRILLRTRLENAGGLRIMNQFKLLD 562

Query: 567  YDKITAQIEYYENGKLDDINNLLESEGRNTQVNMQDPMMMLQTMWDYCKGTENEKTFISL 626
            YDK+   +E YEN KLDD+N++LE+    + ++M D   +L+ ++DYCKGTE+EK   SL
Sbjct: 563  YDKVMELVEAYENLKLDDLNSVLETGAHASDIDMNDSASLLKKLFDYCKGTESEKLLNSL 622

Query: 627  IKHLFLSSSKVADDRGDPSKLAKQLKLMDSLXXXXXXXXXXXXXXXXXXIQRLYDAMQTD 686
            +KHLFLS+S++ +D  DP+KL+KQL+LMDSL                  IQRLYD+MQTD
Sbjct: 623  VKHLFLSTSRLMEDNQDPTKLSKQLRLMDSLVTNVSVSAVDESSSINMAIQRLYDSMQTD 682

Query: 687  EVARRAILESRQLTKELEEIQAERDFLRQKLNSTGDGIVGRLEEELKQRDDILAKNQRVN 746
            EVARRAILESR LTK+LEE QAERDFL QKL+ TG+G+VG+LE+E++QRDDIL KNQRV 
Sbjct: 683  EVARRAILESRTLTKKLEEAQAERDFLSQKLSKTGNGLVGQLEKEVQQRDDILEKNQRVT 742

Query: 747  RHLQAXXXXXXXXXXXXXXXXXXXXXXMLTILNARPDDENLAKSTKVTKSVNG-LDPDRQ 805
              LQ                       MLTILN+RP+ +   K +  +K+  G LDPD++
Sbjct: 743  LQLQDELEELKKKHLLEKHEHEVELRKMLTILNSRPEGDLSRKGSVHSKAQPGILDPDKK 802

Query: 806  TSIQKALQDGLQRTRKDLSVDSKRFGITVQPNKRLRMLRMKMEGIEQEARELEMTNFAEH 865
            ++IQ+ALQDGL +T+KDLSVDSKRFGITVQPNKRL+MLR++ME IEQEARELEMTNFA+H
Sbjct: 803  STIQQALQDGLLKTKKDLSVDSKRFGITVQPNKRLKMLRLQMEDIEQEARELEMTNFADH 862

Query: 866  EEKQLEEPVGTGTK-----------KKAGVRKLSELRKQLSDIQKETNEVTKFNVEERVK 914
             +  L+ PV   +            K+    KLSELRK L+DIQKE+N V+KFNVEERV 
Sbjct: 863  NKAVLQAPVKVESSNYVRKENELRAKELKANKLSELRKALADIQKESNGVSKFNVEERVN 922

Query: 915  ELFNQXXXXXXXXXXXXXTTYKGFGIDFNANALLESKGGDIHWNDDEIDGQ---DLQGAQ 971
            ELF Q               YK +GID + +  ++ +  +   ++   +G    D +  Q
Sbjct: 923  ELFKQKKLSALDRLNDLENMYKEYGIDLSTHFPIQDEPQESAESEKNAEGPSTLDPRAYQ 982

Query: 972  EKMDEMDRIANELTAMKMKVEIQNQQ---QHXXXXXXXXXXXXXXGATGSRTDTASEFSQ 1028
             K+DE+DRI+ EL  ++MK E++N +   +H                     DT S  ++
Sbjct: 983  AKLDEIDRISKEL--IEMKSELKNDKALRRHESPSKQDTDDDEIQ-------DTGSMVNE 1033

Query: 1029 KSFGSGAGSFLEALSQKYGAGQNTT--ISNSPFPGVDRKSSNHRTSFANRMKKSNATP-Y 1085
                SG  SFLE+LSQKYG G+N T  ++N      +RK  + R SF  RMKK +  P Y
Sbjct: 1034 DLQSSGTSSFLESLSQKYGTGKNATNMLTNDILNSSERK-GHSRQSFMERMKKPSGVPAY 1092

Query: 1086 FDELTRKVAKAPSLNDPSSPGSNEPGDDDTLPATSPTVPQSINDTVSKDKNSTSSPEAPP 1145
             +EL  KV KAP L    +  S++   +D    ++    Q  N         +  P+   
Sbjct: 1093 LEELPLKVPKAPPLGVAETEDSSDNIAEDVEKESAEHDEQEEN---------SGKPDVAS 1143

Query: 1146 TLDPGSVHSDERAXXXXXXXXSMLFGEKAPQHGTGXXXXXXXXXXXXXXIFNQASVKGST 1205
               P                  ML  +K P+  T               +F QA   G  
Sbjct: 1144 QKVPQESGKAGTPHPVPPPMPDML--KKGPETSTA---PPPPPPPPPPPMFAQARNSGPI 1198

Query: 1206 AIXXXXXXXALGGSNXXXXXXXXXXXXLFAGQKKM-YRSDM-SNYLEETPTFRDNYPQPH 1263
                     +L  S                  +KM YR+ + S  L ++P+   +YP+  
Sbjct: 1199 PPPPPPPPPSLTPSTSEAAKLSPPPPPPPLLGQKMAYRTAVPSPLLPQSPSLFSSYPRAR 1258

Query: 1264 KKLKQLHWEKLDATEDSIWSSGVAEKFAGDLYEKGVLAGLEKAFAAREIKNLATKKKEDL 1323
            KKLKQLHWEKLDAT++SIWSSG AEKFAGDLYEKGVL  LEKAFAAREIK+LATKK+EDL
Sbjct: 1259 KKLKQLHWEKLDATDNSIWSSGKAEKFAGDLYEKGVLEDLEKAFAAREIKSLATKKREDL 1318

Query: 1324 KKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQTPSVIEFLSKSEITEVSV 1383
             KITFLS D SQQFGINLHMYS +SV +LV KILKC+RDFM TPSV+EFLSK EI EVS 
Sbjct: 1319 DKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPEIIEVST 1378

Query: 1384 NLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQLIFNLQAYWGSRMRAIKVI 1443
            NLARN+SPYSTDWDG+  +EDAK PEKDP +LQRADQ+YLQLI+NLQ YWGSRMRA++VI
Sbjct: 1379 NLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSRMRALRVI 1438

Query: 1444 TSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGNFMNDTAKRAQGFKLSTLQ 1503
            TSY++EY ELVTKLRKVDKAV  I KS NL N+FNVILAVGN+MND+AK+AQGFKLSTLQ
Sbjct: 1439 TSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGFKLSTLQ 1498

Query: 1504 RLTFIKDTNNSMTFLNYVEKIIRGNYPSFNDFLKELEPVLNVTKISIDQLVNDCNEYCQA 1563
            RLTFIKD NNSMTFLNYVEKI+R NYPSFNDFL++L+PVL+V KISI+QL++DC E+ Q+
Sbjct: 1499 RLTFIKDANNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISDCKEFSQS 1558

Query: 1564 VTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDLLDDEVRLSIMEFENLMQK 1623
            +TNVERSI+IGNL+DSSKFHPLD+VL+KVLPVLPEA K+ +LLD+EV+LSIMEFE+LMQ+
Sbjct: 1559 ITNVERSIDIGNLNDSSKFHPLDKVLVKVLPVLPEASKRVELLDEEVKLSIMEFESLMQR 1618

Query: 1624 YGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQNLKVEEEERVYERHKKMVEEQQRREQTPS 1683
            YGED+                + EYK+AQ QNLK EEEER+Y+ HKKMVEEQQ+R +   
Sbjct: 1619 YGEDSADKFAKNSFFKKFADFINEYKRAQAQNLKAEEEERLYQTHKKMVEEQQKRAEEKE 1678

Query: 1684 KNRDYVVNXXXXXXXXXXXXXXXXXXKLLDQLKNAGPTTSDPSSARKRALMRRKLQADKD 1743
            ++     N                  KLL+QLKNAGP  +DP SARKRA++R+K+  D +
Sbjct: 1679 RSE----NATEEDASEENEDRRAMMDKLLEQLKNAGPVKADPLSARKRAMIRKKMLNDSE 1734

Query: 1744 AAAHLISDLDSNEDSIVYSPNASQDQSANAEEASPTVHKGSNKNNKPVLSDLESPIKASR 1803
            A + ++  +   +DS++YSP   +  +    ++S +  KG+  N +              
Sbjct: 1735 AVSDVLDSIQQEDDSMIYSPEKQEGITNPTGDSSQSPSKGAANNQQ-------------- 1780

Query: 1804 NADRXXXXXXXXISDKAKNLLMELSGNGAPTRREELLNGHKERLRARRRRT 1854
                        I+D+AK LLM L G  +P++R  +LNGHKE+LRARRR+T
Sbjct: 1781 --------DEEEITDRAKALLMGLRGGESPSKRNNVLNGHKEKLRARRRKT 1823

>NCAS0A00590 Chr1 complement(102748..108588) [5841 bp, 1946 aa] {ON}
            Anc_1.82
          Length = 1946

 Score = 1575 bits (4079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 847/1633 (51%), Positives = 1071/1633 (65%), Gaps = 96/1633 (5%)

Query: 304  TEKINRPPTYYVKKIIADDLTIDELNDLWVTLRTEQLDWVDAFLEHQGHIAMANVLMKSL 363
            ++K NRPP +YVK+IIAD +T +E+ DLWVTLRTEQ+DWVDAF+EHQGHIAMAN+LMKSL
Sbjct: 308  SDKTNRPPIHYVKRIIADTITSEEMKDLWVTLRTEQIDWVDAFIEHQGHIAMANILMKSL 367

Query: 364  YKTTQEVKLTEKSLEREASYFKCFRVLVMLAQGLYEFTKHAIMAETVAYALFSIRLPTRK 423
            YKT+ +     + LE+E ++FKCFRVL ML+QGL EFT+H IM++TVA  LFSI L TR+
Sbjct: 368  YKTSSDGTPNPQLLEKENAFFKCFRVLSMLSQGLREFTRHEIMSQTVARGLFSITLSTRR 427

Query: 424  MATEIFVCMLEKKNKSRFDVILTALDKKFMIGENLHMMQFVKNSPQQFIHLKRDSQFKIV 483
            MATEIFVCMLEKKN  RF VIL ALD+KF IG N HM Q +K  P  F HL  DSQ K+ 
Sbjct: 428  MATEIFVCMLEKKNPERFKVILNALDQKFKIGYNAHMTQNIKMFPDYFTHLTLDSQLKVT 487

Query: 484  QAWLTGLETALQGRGKMGSLVGASEEVRAAGGENSILEYSQWTMVFINHLCMGTDVVNQR 543
            QAWL  +E  L GRGKMGSLVGAS++ + +GGEN+ILEY QW+M+FINHLC  +  +NQR
Sbjct: 488  QAWLFAVEHTLDGRGKMGSLVGASDDFKNSGGENAILEYCQWSMIFINHLCSCSSNINQR 547

Query: 544  VLLRTRLENAGALRIMNRFKLLDYDKITAQIEYYENGKLDDINNLLESEGRNTQVNMQDP 603
            +LLRT+LEN G LRIMN+ K LDYDK+  QI+ YEN KLDD+N LLES  +N  +N+QDP
Sbjct: 548  MLLRTKLENCGILRIMNKVKTLDYDKVIEQIDLYENNKLDDLNTLLESNNKNANINLQDP 607

Query: 604  MMMLQTMWDYCKGTENEKTFISLIKHLFLSSSKVADDRGDPSKLAKQLKLMDSLXXXXXX 663
              ML+ +WD CKGTENEK  ISL++HLFLSSS+  +++ DP KL++QLKL+DSL      
Sbjct: 608  TSMLRNLWDACKGTENEKLLISLMQHLFLSSSQFIEEKKDPVKLSRQLKLLDSLVTNVSV 667

Query: 664  XXXXXXXXXXXXIQRLYDAMQTDEVARRAILESRQLTKELEEIQAERDFLRQKLNSTGDG 723
                        IQRLYDAMQTDEVARR+ILESR LTK+LEE+QAERD L QKL +   G
Sbjct: 668  SSTDQEASMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEEVQAERDLLSQKLKNAEHG 727

Query: 724  IVGRLEEELKQRDDILAKNQRVNRHLQAXXXXXXXXXXXXXXXXXXXXXXMLTILNARPD 783
            +VG+L++EL QRD IL+KNQRV   LQ                       MLTILNARP+
Sbjct: 728  LVGQLQDELAQRDRILSKNQRVMEQLQGELEELKKKHLLEKHEQEVELRKMLTILNARPE 787

Query: 784  DENLAKSTKVTKSVN--GLDPDRQTSIQKALQDGLQRTRKDLSVDSKRFGITVQPNKRLR 841
                  ++K TK+ N   LDP ++ SIQ+ALQDGL RT+KD SVD++ FG+T+QPNKRL+
Sbjct: 788  IVEGNGTSKKTKAKNPSALDPSKKQSIQQALQDGLSRTKKDYSVDARNFGMTIQPNKRLK 847

Query: 842  MLRMKMEGIEQEARELEMTNFAEHEEKQLEEPVGTGTKKKA--------GVRKLSELRKQ 893
            +LRM+ME IE EARELEMTNF E+E+++LE P      KK          + KL++LR+ 
Sbjct: 848  LLRMQMEDIENEARELEMTNFTEYEKRKLEAPSKIKKPKKVATKKEIDPSINKLNDLRQT 907

Query: 894  LSDIQKETNEVTKFNVEERVKELFNQXXXXXXXXXXXXXTTYKGFGIDFNANALLESKGG 953
            L++IQ E+N+++KFNV+ERV ELFNQ             T YK FGIDFN + L++S   
Sbjct: 908  LAEIQMESNDISKFNVDERVNELFNQKRITALKRLQDLETKYKDFGIDFNIDELVDSASK 967

Query: 954  DIHWNDDE---IDGQDLQGAQEKMDEMDRIANELTAMKMKVEIQNQQQHXXXXXXXXXXX 1010
            D + N+ +       D +  Q K+DE++R+ +EL  +K KV   +               
Sbjct: 968  DENGNNQQSGDYSSLDPKAYQRKLDELNRLTDELLRVKNKVNASDNNLSSRRPSASSSSE 1027

Query: 1011 XXXGATGS--------RTDTASEFSQKSFGSGAGSFLEALSQKYGAGQNTTISNSPFPGV 1062
                ++ S        R DT S FS  S  +G GSFLEAL+QKY  GQ    S SP    
Sbjct: 1028 SASSSSDSDDGESLIERQDTQSNFSGTS--AGPGSFLEALTQKYATGQK---SASPRDQS 1082

Query: 1063 DRKSSNHRTSFANRMKKSN-ATPYFDELTRKVAKAPSLNDPSSPGSNEPGDDDTLPATSP 1121
             R   N    F NR+K++N A P+ DELT KVA+AP    P      EP +++T+  +S 
Sbjct: 1083 TRMKDN---IFINRIKQTNVAPPFLDELTDKVAEAP----PVEASLAEPDNNNTINESSK 1135

Query: 1122 TVPQSINDTVSKD----KNSTSSPEAPPTLDPGSV----HSDERAXXXXXXXXS------ 1167
                  N T S +    + S S+PE  P  D  SV     SD++A        +      
Sbjct: 1136 EETGEANLTSSDNEVVAQASLSNPEVSPKHDNNSVKDVNESDDKAEVSAKDTSADSQPPP 1195

Query: 1168 ------MLFGEKAPQHGTGXXXXXXXXXXXXXXIFNQASVKGSTAIXXXXXXXALGGSNX 1221
                    F     ++ +               +F  A       +       AL  +  
Sbjct: 1196 PPPPPLPDFFTNEQKNSSSETSIPLPSPPLPEKLFENAGAHPLKHLRQSASSPALNSALP 1255

Query: 1222 XXXXXXXXXXXLFAGQKKMYRSDMSNYLEETPTFRDNYPQPHKKLKQLHWEKLDATEDSI 1281
                          G +K   +  S  L ++ +  +NYP+P KKLKQLHWEKLDAT++SI
Sbjct: 1256 PPPPPPPPPPLPTDGPRKKVIA--SPLLPQSASLFENYPRPQKKLKQLHWEKLDATDNSI 1313

Query: 1282 WSSGVAEKFAGDLYEKGVLAGLEKAFAAREIKNLATKKKEDLKKITFLSHDFSQQFGINL 1341
            W +  AEKFA DLYEKGVL  LEKAFAAREIK+LA+KKKEDL KI+FLS D SQQFGINL
Sbjct: 1314 WKTNKAEKFADDLYEKGVLTDLEKAFAAREIKSLASKKKEDLDKISFLSRDISQQFGINL 1373

Query: 1342 HMYSHMSVNDLVIKILKCDRDFMQTPSVIEFLSKSEITEVSVNLARNFSPYSTDWDGIKS 1401
            HMY+++ V+D+V KILKCDRDF+ TPSVIEFLSK EI EVSVNLARN++PYSTDW+G+KS
Sbjct: 1374 HMYANLPVDDVVKKILKCDRDFLHTPSVIEFLSKPEIVEVSVNLARNYAPYSTDWEGVKS 1433

Query: 1402 LEDAKPPEKDPNDLQRADQIYLQLIFNLQAYWGSRMRAIKVITSYDKEYLELVTKLRKVD 1461
            +EDAK PEKDPN+LQRADQ+YLQLI NLQ+YWGSRMRA+ VIT++DKEY EL+TKLRKVD
Sbjct: 1434 VEDAKAPEKDPNELQRADQLYLQLIINLQSYWGSRMRALTVITTFDKEYNELLTKLRKVD 1493

Query: 1462 KAVGAILKSENLSNIFNVILAVGNFMNDTAKRAQGFKLSTLQRLTFIKDTNNSMTFLNYV 1521
            KAV ++ +SENL N+FNVILAVGN+MNDT+K+AQGFKL+TLQRLTFIKD+ NSMTFLNYV
Sbjct: 1494 KAVSSLQESENLKNVFNVILAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNSMTFLNYV 1553

Query: 1522 EKIIRGNYPSFNDFLKELEPVLNVTKISIDQLVNDCNEYCQAVTNVERSIEIGNLSDSSK 1581
            EKI+R NYPSFNDFL ELEPVL+V KISI+QLV+DC E+ Q++ NVERS+E GNLSDSSK
Sbjct: 1554 EKIVRSNYPSFNDFLTELEPVLDVVKISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSK 1613

Query: 1582 FHPLDRVLIKVLPVLPEARKKCDLLDDEVRLSIMEFENLMQKYGEDTGXXXXXXXXXXXX 1641
            FHP DRVL KVLP+LP+ARKK +LL DEV+L+IMEF  LMQ YGED+             
Sbjct: 1614 FHPQDRVLAKVLPILPDARKKGELLGDEVKLTIMEFLRLMQIYGEDSEDKFAKNSFFKKF 1673

Query: 1642 XXXVQEYKKAQNQNLKVEEEERVYERHKKMVEEQQRREQTPSKNRDYVVNXXXXXXXXXX 1701
               + EYKKAQNQN+K EEEE+VYERHKKMVE+QQ++ Q      +   N          
Sbjct: 1674 ADFITEYKKAQNQNIKAEEEEQVYERHKKMVEDQQKKLQEQENGSNGSEN-GEEGSGDDS 1732

Query: 1702 XXXXXXXXKLLDQLKNAGPTTSDPSSARKRALMRRKLQADKDAAAHLISDLDSNEDSIVY 1761
                    KLLDQLKNAGP+ +DPSSARKRAL+R+KL  +  A   L+ D+++ +DSI+Y
Sbjct: 1733 GDRRAMMDKLLDQLKNAGPSKTDPSSARKRALVRKKLMTESTA---LLKDIETEDDSIIY 1789

Query: 1762 SP------------NASQDQSANAEEASPTVHKGSNKNNKPVLSDLESPIKASRNADRXX 1809
            SP            +   D+S     +SP     S   N  +LSD               
Sbjct: 1790 SPEGKNPFVNPVDLDTPHDESEMDVSSSPIQRSLSPSRNSTLLSD--------------- 1834

Query: 1810 XXXXXXISDKAKNLLMELSGNGAPTRREELLNGHKERLRARRRRTQGHGELISSNKLAFL 1869
                  ++D+AK LLMEL G+  P++R  LL+ HKE+LRARRR+T  + +L S  +L F+
Sbjct: 1835 --DQDEVTDRAKALLMELRGSNTPSKRNSLLDEHKEKLRARRRKT--NSDLHSGTRLQFV 1890

Query: 1870 DDETP-----PVT 1877
             +  P     P+T
Sbjct: 1891 GETVPEKEVEPIT 1903

 Score =  109 bits (272), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 61/71 (85%)

Query: 160 VLSQGSLTNLGRFMRPDGKVRLDMPQDYHEVESLFEDIMYKRNIMQTLPPEKQQELRNYD 219
           +LSQGS TNL +F+ PDGK+ L+MP+D +EVE LFEDIM KRNI+Q+LP +KQ EL +YD
Sbjct: 138 ILSQGSFTNLSKFIAPDGKINLEMPRDPNEVEVLFEDIMLKRNILQSLPTDKQNELMSYD 197

Query: 220 IDKKWLIVRQD 230
           ++KKWLIV+QD
Sbjct: 198 LEKKWLIVKQD 208

>Suva_14.71 Chr14 complement(124082..126073,126104..129958) [5847 bp,
            1948 aa] {ON} YNL271C (REAL)
          Length = 1948

 Score =  819 bits (2115), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/633 (64%), Positives = 495/633 (78%), Gaps = 16/633 (2%)

Query: 1239 KMYRSDMSNYLEETPTFRDNYPQPHKKLKQLHWEKLDATEDSIWSSGVAEKFAGDLYEKG 1298
            +M  +  S  L ++P+  + YP+PHKKLKQLHWEK+D+T++SIW SG AEKFA DLYEKG
Sbjct: 1328 QMKSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKG 1387

Query: 1299 VLAGLEKAFAAREIKNLATKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILK 1358
            VLA LEKAFAAREIK+LATK+KEDL+K+TFLS D SQQFGINLHMYS +SV DLV KILK
Sbjct: 1388 VLADLEKAFAAREIKSLATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILK 1447

Query: 1359 CDRDFMQTPSVIEFLSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRA 1418
            CDRDF+QTPSV+EFLSK EITEVSVNLARN++PYSTDW+GI+ LEDAKPPEKDPNDLQRA
Sbjct: 1448 CDRDFLQTPSVVEFLSKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRA 1507

Query: 1419 DQIYLQLIFNLQAYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFN 1478
            DQIYLQL+ NL+ YWGSRMRA+ V+TSY+KEY EL+ KLRKVD+AVGA+ +S+NL N+FN
Sbjct: 1508 DQIYLQLMVNLEQYWGSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFN 1567

Query: 1479 VILAVGNFMNDTAKRAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRGNYPSFNDFLKE 1538
            VILAVGNFMNDT+K+AQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIR NYPSFNDFLKE
Sbjct: 1568 VILAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKE 1627

Query: 1539 LEPVLNVTKISIDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPE 1598
            LEPVL+V K+SI+QLVNDC ++ Q++ NVERS+EIGNLSDSSKFHPLD+VLIK LPVLPE
Sbjct: 1628 LEPVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPE 1687

Query: 1599 ARKKCDLLDDEVRLSIMEFENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQNLKV 1658
            AR+K DLL+DEV+L+IMEFE+LMQ YGED+G               V EYK+AQ+QNL  
Sbjct: 1688 ARRKGDLLEDEVKLTIMEFESLMQTYGEDSGDKFAKISFFKKFADFVNEYKRAQSQNLAA 1747

Query: 1659 EEEERVYERHKKMVEEQQRREQTPSKNRDYVVNXXXXXXXXXXXXXXXXXXKLLDQLKNA 1718
            EEEER+YE+HKKMVEEQQ+R Q   K+R++                     KLL+QLKNA
Sbjct: 1748 EEEERLYEKHKKMVEEQQKRAQDKEKHREHSA-LPEGNEEEETEDRRAVMDKLLEQLKNA 1806

Query: 1719 GPTTSDPSSARKRALMRRKLQADKDAAAHLISDLDSNEDSIVYSPNAS---QDQSANAEE 1775
            GP  SDPSSARKRAL+R+K  +DKD +A +++DL+  E SI+YSP A+    D   +AE 
Sbjct: 1807 GPAKSDPSSARKRALVRKKYISDKDNSAQVLNDLNDEEGSILYSPEATTPDTDTVIHAES 1866

Query: 1776 ASPTVHKGSNKNNKPVLSDLESPIKASRNADRXXXXXXXXISDKAKNLLMELSGNGAPTR 1835
             +P   +G    N P   DL SP KAS   D+        I+D+A+ LL EL G+ AP +
Sbjct: 1867 PTPLATRGF--MNTP--EDLPSPSKASALEDQ------EEITDRARMLLKELRGSDAPVK 1916

Query: 1836 REELLNGHKERLRARRRRTQGHGELISSNKLAF 1868
            +  +L+ H E+LRAR+ R   +GE  + NKL+F
Sbjct: 1917 QNSILDEHLEKLRARKER--ANGETNTGNKLSF 1947

 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/826 (52%), Positives = 551/826 (66%), Gaps = 31/826 (3%)

Query: 300  TTVNTEKINRPPTYYVKKIIADDLTIDELNDLWVTLRTEQLDWVDAFLEHQGHIAMANVL 359
            +T+  ++ NRPP +YV++I+AD LT DE+ DLWVTLRTEQLDWVDAF++HQGHIAMANVL
Sbjct: 330  STLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIDHQGHIAMANVL 389

Query: 360  MKSLYKTTQEVKLTEKSLEREASYFKCFRVLVMLAQGLYEFTKHAIMAETVAYALFSIRL 419
            M S+YKT     LT++ LE+E S+FKCFRVL ML+QGLYEF+ H +M +TVA  LFS +L
Sbjct: 390  MNSIYKTAPREHLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGLFSTKL 449

Query: 420  PTRKMATEIFVCMLEKKNKSRFDVILTALDKKFMIGENLHMMQFVKNSPQQFIHLKRDSQ 479
             TRKMATEIFVCMLEKKNK+RF+ +LTALDKKF IG+NLHM+Q  K  PQ F HL  +S 
Sbjct: 450  VTRKMATEIFVCMLEKKNKNRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYFSHLTLESH 509

Query: 480  FKIVQAWLTGLETALQGRGKMGSLVGASEEVRAAGGENSILEYSQWTMVFINHLCMGTDV 539
             KI+QAWL  +E  L GRGKMGSLVGAS+E +  GGEN+ILEY QWTMVFINHLC  +D 
Sbjct: 510  LKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFINHLCSCSDN 569

Query: 540  VNQRVLLRTRLENAGALRIMNRFKLLDYDKITAQIEYYENGKLDDINNLLESEGRNTQVN 599
            VNQR+LLRT+LEN G LRIMN+ KLLDYDK+  QIE Y+N KLDD N  LE+  +   V+
Sbjct: 570  VNQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYDNNKLDDFNVKLEASNKAFNVD 629

Query: 600  MQDPMMMLQTMWDYCKGTENEKTFISLIKHLFLSSSKVADDRGDPSKLAKQLKLMDSLXX 659
            ++DP+ +L+ +W+ CKGT+NEK  +SL++HLFLSSSK+ ++  +PSKL+KQLKLMDSL  
Sbjct: 630  LKDPLSLLKNLWEICKGTDNEKLLVSLVQHLFLSSSKLIEENQNPSKLSKQLKLMDSLVT 689

Query: 660  XXXXXXXX-XXXXXXXXIQRLYDAMQTDEVARRAILESRQLTKELEEIQAERDFLRQKLN 718
                             IQRLYDAMQTDEVARRAILESR LTK+LEEIQAERD L +KL 
Sbjct: 690  NVSVASTADEESNMNMAIQRLYDAMQTDEVARRAILESRTLTKKLEEIQAERDSLSEKLG 749

Query: 719  STGDGIVGRLEEELKQRDDILAKNQRVNRHLQAXXXXXXXXXXXXXXXXXXXXXXMLTIL 778
                G+VG+LE EL  RD ILAKNQRV + L++                      MLTIL
Sbjct: 750  KAEHGLVGQLENELHGRDRILAKNQRVMQQLESELEELKKKHLLEKHQQEVELRKMLTIL 809

Query: 779  NARPDDENLAKSTKVTKSVN-GLDPDRQTSIQKALQDGLQRTRKDLSVDSKRFGITVQPN 837
            N+RP++   +  +K TK +N  L+   + +IQK LQDGL R +KD   DSK+FG+T+QPN
Sbjct: 810  NSRPEES--SDLSKGTKDINPSLNSSEKANIQKVLQDGLSRAKKDYKDDSKKFGMTLQPN 867

Query: 838  KRLRMLRMKMEGIEQEARELEMTNFAEHEEKQL----------------EEPVGTGTKKK 881
            KRL+MLRM+ME IE EAR+LEMTNFAE E+++L                +    +   + 
Sbjct: 868  KRLKMLRMQMENIENEARQLEMTNFAEFEKERLEPPIEIKKPKIKHKKHKIKKSSVKTQG 927

Query: 882  AGVRKLSELRKQLSDIQKETNEVTKFNVEERVKELFNQXXXXXXXXXXXXXTTYKGFGID 941
            A + KL++LR+ L++IQ E+N+++KFNVEERV ELFN+             T YKGFGID
Sbjct: 928  ADMNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRLKELETKYKGFGID 987

Query: 942  FNANALLES--KGGDIHWNDDEIDGQDLQGAQEKMDEMDRIANELTAMKMKVEIQNQQQH 999
            FN    +E+  K      ND      D +  Q K+DE++RI +EL  ++ +V+ + ++  
Sbjct: 988  FNVEEFIETPKKFSVDEENDAAYPSLDPKAYQSKLDEINRITDELLDLQTQVKQETEEDE 1047

Query: 1000 XXXXXXXXXXXXXXGATGSRTDTAS-----EFSQKSFGSGAGSFLEALSQKYGAGQNTTI 1054
                               +  + S     E+S+ S GSG GSFL+ALSQKYG GQN T 
Sbjct: 1048 DEETKSSSSSSDADDDEIYQDASPSQERRGEYSELSAGSGPGSFLDALSQKYGTGQNVTA 1107

Query: 1055 SNS--PFPGVDRKSSNHRTSFANRMKKSNAT--PYFDELTRKVAKA 1096
            S       G     SN   SF NR++KS A+  PY +ELT+KV K 
Sbjct: 1108 SAGLRDNRGSGHMPSNVEKSFINRLRKSTASSAPYLEELTQKVNKV 1153

 Score =  104 bits (259), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 58/130 (44%), Positives = 73/130 (56%), Gaps = 25/130 (19%)

Query: 101 QSTGSKYTYPKRTSSSITGGNPSLPSSSATPIPAPVTPGQLSRXXXXXXXXXXXXXXXXV 160
            S  SKY+Y KRTSS  +                     +L+R                +
Sbjct: 118 HSVQSKYSYSKRTSSQASN--------------------KLTRQHTGQSHSATS-----L 152

Query: 161 LSQGSLTNLGRFMRPDGKVRLDMPQDYHEVESLFEDIMYKRNIMQTLPPEKQQELRNYDI 220
           LS GSLTNL +F  PDGK+ L+MP D +EVE LFEDIMYKRNI Q+L  +KQ+EL +Y  
Sbjct: 153 LSLGSLTNLSKFTTPDGKIHLEMPSDPYEVEVLFEDIMYKRNIFQSLSGDKQEELMSYST 212

Query: 221 DKKWLIVRQD 230
           +KKWLIV+QD
Sbjct: 213 EKKWLIVKQD 222

>YNL271C Chr14 complement(129522..135383) [5862 bp, 1953 aa] {ON}
            BNI1Formin, nucleates the formation of linear actin
            filaments, involved in cell processes such as budding and
            mitotic spindle orientation which require the formation
            of polarized actin cables, functionally redundant with
            BNR1
          Length = 1953

 Score =  818 bits (2112), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/874 (50%), Positives = 569/874 (65%), Gaps = 50/874 (5%)

Query: 300  TTVNTEKINRPPTYYVKKIIADDLTIDELNDLWVTLRTEQLDWVDAFLEHQGHIAMANVL 359
            +T+  ++ NRPP +YV++I+AD LT DE+ DLWVTLRTEQLDWVDAF++HQGHIAMANVL
Sbjct: 327  STLPGDRTNRPPIHYVQRILADKLTSDEMKDLWVTLRTEQLDWVDAFIDHQGHIAMANVL 386

Query: 360  MKSLYKTTQEVKLTEKSLEREASYFKCFRVLVMLAQGLYEFTKHAIMAETVAYALFSIRL 419
            M S+YKT     LT++ LE+E S+FKCFRVL ML+QGLYEF+ H +M +TVA  LFS +L
Sbjct: 387  MNSIYKTAPRENLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGLFSTKL 446

Query: 420  PTRKMATEIFVCMLEKKNKSRFDVILTALDKKFMIGENLHMMQFVKNSPQQFIHLKRDSQ 479
             TRKMATEIFVCMLEKKNKSRF+ +LT+LDKKF IG+NLHM+Q  K  PQ F HL  +S 
Sbjct: 447  ATRKMATEIFVCMLEKKNKSRFEAVLTSLDKKFRIGQNLHMIQNFKKMPQYFSHLTLESH 506

Query: 480  FKIVQAWLTGLETALQGRGKMGSLVGASEEVRAAGGENSILEYSQWTMVFINHLCMGTDV 539
             KI+QAWL  +E  L GRGKMGSLVGAS+E +  GGEN+ILEY QWTMVFINHLC  +D 
Sbjct: 507  LKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFINHLCSCSDN 566

Query: 540  VNQRVLLRTRLENAGALRIMNRFKLLDYDKITAQIEYYENGKLDDINNLLESEGRNTQVN 599
            +NQR+LLRT+LEN G LRIMN+ KLLDYDK+  QIE Y+N KLDD N  LE+  +   V+
Sbjct: 567  INQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYDNNKLDDFNVKLEANNKAFNVD 626

Query: 600  MQDPMMMLQTMWDYCKGTENEKTFISLIKHLFLSSSKVADDRGDPSKLAKQLKLMDSLXX 659
            + DP+ +L+ +WD CKGTENEK  +SL++HLFLSSSK+ ++  + SKL KQLKLMDSL  
Sbjct: 627  LHDPLSLLKNLWDICKGTENEKLLVSLVQHLFLSSSKLIEENQNSSKLTKQLKLMDSLVT 686

Query: 660  XXXXXXXX-XXXXXXXXIQRLYDAMQTDEVARRAILESRQLTKELEEIQAERDFLRQKLN 718
                             IQRLYDAMQTDEVARRAILESR LTK+LEEIQAERD L +KL+
Sbjct: 687  NVSVASTSDEETNMNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDSLSEKLS 746

Query: 719  STGDGIVGRLEEELKQRDDILAKNQRVNRHLQAXXXXXXXXXXXXXXXXXXXXXXMLTIL 778
                G+VG+LE+EL +RD ILAKNQRV + L+A                      MLTIL
Sbjct: 747  KAEHGLVGQLEDELHERDRILAKNQRVMQQLEAELEELKKKHLLEKHQQEVELRKMLTIL 806

Query: 779  NARPDDENLAKSTKVTKSVNGLDPDRQTSIQKALQDGLQRTRKDLSVDSKRFGITVQPNK 838
            N+RP +E+  K+       + L+   + +IQK LQDGL R +KD   DSK+FG+T+QPNK
Sbjct: 807  NSRP-EESFNKNEGTRGMNSSLNSSEKANIQKVLQDGLSRAKKDYKDDSKKFGMTLQPNK 865

Query: 839  RLRMLRMKMEGIEQEARELEMTNFAEHEEKQLEEPVGTGTK----------------KKA 882
            RL+MLRM+ME IE EAR+LEMTNFAE E+ +LE P+                     ++A
Sbjct: 866  RLKMLRMQMENIENEARQLEMTNFAEFEKDRLEPPIHIKKPKVKKMKNKDRKPLVKPQEA 925

Query: 883  GVRKLSELRKQLSDIQKETNEVTKFNVEERVKELFNQXXXXXXXXXXXXXTTYKGFGIDF 942
             V KL++LR+ L++IQ E+N+++KFNVEERV ELFN+             T YKGFGIDF
Sbjct: 926  DVNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRLKELETKYKGFGIDF 985

Query: 943  NANALLES---KGGDIHWNDD-EIDGQDLQGAQEKMDEMDRIANELTAMKMKVEIQNQQQ 998
            N + +++S     GD+   +D      D +  Q+K+DE++RI ++L      ++IQ Q +
Sbjct: 986  NVDEIMDSPKKNTGDVETEEDANYASLDPKTYQKKLDEINRITDQL------LDIQTQTE 1039

Query: 999  HXXXXXXXXXXXXXXGATGSRT-----------DTASEFSQKSFGSGAGSFLEALSQKYG 1047
            H               ++   +           +  SE S+ S GSG GSFL+ALSQKYG
Sbjct: 1040 HEIQVEEDGESDLSSSSSDDESEEIYQDASPTQELRSEHSELSSGSGPGSFLDALSQKYG 1099

Query: 1048 AGQNTTIS-----NSPFPGVDRKSSNHRTSFANRMKKS--NATPYFDELTRKVAKAPSLN 1100
             GQN T S     N+   G+    S    +F NR++KS  ++ PY +ELT+KV K     
Sbjct: 1100 TGQNVTASAAFGENNNGSGIGPLHSKVEKTFMNRLRKSTVSSAPYLEELTQKVNKV---- 1155

Query: 1101 DPSSPGSNEPGDDDTLPATSPTVPQSINDTVSKD 1134
            +P     +E  D  +LP  S     S  D   KD
Sbjct: 1156 EPYEQNEDEGLDKKSLPENSTASAASAFDKAEKD 1189

 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/627 (63%), Positives = 483/627 (77%), Gaps = 16/627 (2%)

Query: 1246 SNYLEETPTFRDNYPQPHKKLKQLHWEKLDATEDSIWSSGVAEKFAGDLYEKGVLAGLEK 1305
            S  L ++P+  + YP+PHKKLKQLHWEKLD T++SIW +G AEKFA DLYEKGVLA LEK
Sbjct: 1338 SPLLPQSPSLFEKYPRPHKKLKQLHWEKLDCTDNSIWGTGKAEKFADDLYEKGVLADLEK 1397

Query: 1306 AFAAREIKNLATKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQ 1365
            AFAAREIK+LA+K+KEDL+KITFLS D SQQFGINLHMYS +SV DLV KIL CDRDF+Q
Sbjct: 1398 AFAAREIKSLASKRKEDLQKITFLSRDISQQFGINLHMYSSLSVADLVKKILNCDRDFLQ 1457

Query: 1366 TPSVIEFLSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQL 1425
            TPSV+EFLSKSEI EVSVNLARN++PYSTDW+G+++LEDAKPPEKDPNDLQRADQIYLQL
Sbjct: 1458 TPSVVEFLSKSEIIEVSVNLARNYAPYSTDWEGVRNLEDAKPPEKDPNDLQRADQIYLQL 1517

Query: 1426 IFNLQAYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGN 1485
            + NL++YWGSRMRA+ V+TSY++EY EL+ KLRKVDKAV A+ +S+NL N+FNVILAVGN
Sbjct: 1518 MVNLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVSALQESDNLRNVFNVILAVGN 1577

Query: 1486 FMNDTAKRAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRGNYPSFNDFLKELEPVLNV 1545
            FMNDT+K+AQGFKLSTLQRLTFIKDT NSMTFLNYVEKI+R NYPSFNDFL ELEPVL+V
Sbjct: 1578 FMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIVRLNYPSFNDFLSELEPVLDV 1637

Query: 1546 TKISIDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDL 1605
             K+SI+QLVNDC ++ Q++ NVERS+EIGNLSDSSKFHPLD+VLIK LPVLPEARKK DL
Sbjct: 1638 VKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARKKGDL 1697

Query: 1606 LDDEVRLSIMEFENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQNLKVEEEERVY 1665
            L+DEV+L+IMEFE+LM  YGED+G               + EYKKAQ QNL  EEEER+Y
Sbjct: 1698 LEDEVKLTIMEFESLMHTYGEDSGDKFAKISFFKKFADFINEYKKAQAQNLAAEEEERLY 1757

Query: 1666 ERHKKMVEEQQRREQTPSKNRDYVVN-XXXXXXXXXXXXXXXXXXKLLDQLKNAGPTTSD 1724
             +HKK+VEEQQ+R Q   K ++   +                   KLL+QLKNAGP  SD
Sbjct: 1758 IKHKKIVEEQQKRAQEKEKQKENSNSPSSEGNEEDEAEDRRAVMDKLLEQLKNAGPAKSD 1817

Query: 1725 PSSARKRALMRRKLQADKDAAAHLISDLDSNEDSIVYSPNA---SQDQSANAEEASPTVH 1781
            PSSARKRAL+R+K  ++KD A  L++DLD+ E SI+YSP A   + D   +AE  +P   
Sbjct: 1818 PSSARKRALVRKKYLSEKDNAPQLLNDLDTEEGSILYSPEAMDPTADTVIHAESPTPLAT 1877

Query: 1782 KGSNKNNKPVLSDLESPIKASRNADRXXXXXXXXISDKAKNLLMELSGNGAPTRREELLN 1841
            +G    ++    DL SP K S   D+        ISD+A+ LL EL G+  P ++  +L+
Sbjct: 1878 RGVMNTSE----DLPSPSKTSALEDQ------EEISDRARMLLKELRGSDTPVKQNSILD 1927

Query: 1842 GHKERLRARRRRTQGHGELISSNKLAF 1868
             H E+LRAR+ R+   GE  + N+L+F
Sbjct: 1928 EHLEKLRARKERSI--GEASTGNRLSF 1952

 Score =  105 bits (261), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 57/71 (80%)

Query: 160 VLSQGSLTNLGRFMRPDGKVRLDMPQDYHEVESLFEDIMYKRNIMQTLPPEKQQELRNYD 219
           +LSQGSLTNL +F  PDGK+ L+MP D +EVE LFEDIMYKRNI Q+L  +KQ+ L  Y 
Sbjct: 152 LLSQGSLTNLSKFTTPDGKIYLEMPSDPYEVEVLFEDIMYKRNIFQSLSEDKQEALMGYS 211

Query: 220 IDKKWLIVRQD 230
           I+KKWLIV+QD
Sbjct: 212 IEKKWLIVKQD 222

>Smik_14.66 Chr14 complement(108587..114445) [5859 bp, 1952 aa] {ON}
            YNL271C (REAL)
          Length = 1952

 Score =  816 bits (2109), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/627 (65%), Positives = 490/627 (78%), Gaps = 16/627 (2%)

Query: 1246 SNYLEETPTFRDNYPQPHKKLKQLHWEKLDATEDSIWSSGVAEKFAGDLYEKGVLAGLEK 1305
            S  L ++P+  + YP+PHKKLKQLHWEKLD+T++SIW +G AEKFA DLYEKGVLA LEK
Sbjct: 1337 SPLLPQSPSLFEKYPRPHKKLKQLHWEKLDSTDNSIWGTGKAEKFADDLYEKGVLADLEK 1396

Query: 1306 AFAAREIKNLATKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQ 1365
            AFAAREIK+LATK+KEDLKKITFLS D SQQFGINLHMYS +SV DLV KIL CDRDF+Q
Sbjct: 1397 AFAAREIKSLATKRKEDLKKITFLSRDISQQFGINLHMYSSLSVTDLVKKILNCDRDFLQ 1456

Query: 1366 TPSVIEFLSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQL 1425
            TPSV+EFLSK EI EVSVNLARN++PYSTDW+G+K+L+DAKPPEKDPNDLQRADQIYLQL
Sbjct: 1457 TPSVVEFLSKPEIIEVSVNLARNYAPYSTDWEGVKNLKDAKPPEKDPNDLQRADQIYLQL 1516

Query: 1426 IFNLQAYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGN 1485
            + NL++YWGSRMRA+ V+TSY+KEY EL+TKLRKVDKAVGA+ +S+NL N+FNVILAVGN
Sbjct: 1517 MVNLESYWGSRMRALIVVTSYEKEYNELLTKLRKVDKAVGALQESDNLRNVFNVILAVGN 1576

Query: 1486 FMNDTAKRAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRGNYPSFNDFLKELEPVLNV 1545
            FMNDT+K+AQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIR NYPSFNDFLKELEPVL+V
Sbjct: 1577 FMNDTSKQAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDV 1636

Query: 1546 TKISIDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDL 1605
             K+SI+QLVNDC ++ Q++ NVERS+EIGNLSDSSKFHPLD++LIK LPVLPEARKK DL
Sbjct: 1637 VKVSIEQLVNDCRDFSQSIVNVERSVEIGNLSDSSKFHPLDKILIKTLPVLPEARKKGDL 1696

Query: 1606 LDDEVRLSIMEFENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQNLKVEEEERVY 1665
            L+DEV+L+IMEFE+LM  YGED+G               + EYKKAQ+QNL  EEEER+Y
Sbjct: 1697 LEDEVKLTIMEFESLMHTYGEDSGDKFAKISFFKKFADFINEYKKAQSQNLAAEEEERIY 1756

Query: 1666 ERHKKMVEEQQRREQTPSKNRDYVVNXXXXXXXXXXXX-XXXXXXKLLDQLKNAGPTTSD 1724
            E+HKK+VEEQQ+R Q   K ++   +                   KLL+QLKNAGP  SD
Sbjct: 1757 EKHKKIVEEQQKRAQEREKQKENSNSSSSEGNEEDEAEDRRAVMDKLLEQLKNAGPGKSD 1816

Query: 1725 PSSARKRALMRRKLQADKDAAAHLISDLDSNEDSIVYSPNA---SQDQSANAEEASPTVH 1781
            PSSARKRAL+R++  +DKD +  L++DLD+ E SI+YSP A     D   +AE  +P   
Sbjct: 1817 PSSARKRALVRKRYLSDKDNSQQLLNDLDNEEGSILYSPEALDPDADAVIHAESPTPLTT 1876

Query: 1782 KGSNKNNKPVLSDLESPIKASRNADRXXXXXXXXISDKAKNLLMELSGNGAPTRREELLN 1841
            +G+   N P   DL SP KAS   D+        ISD+AK LL EL G+  P ++  +L+
Sbjct: 1877 RGT--LNIP--EDLPSPSKASTLEDQ------EEISDRAKMLLKELRGSDTPVKQNSILD 1926

Query: 1842 GHKERLRARRRRTQGHGELISSNKLAF 1868
             H E+LRAR+ RT G G   + NKL+F
Sbjct: 1927 EHLEKLRARKERTIGEGS--AGNKLSF 1951

 Score =  808 bits (2086), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/833 (51%), Positives = 555/833 (66%), Gaps = 40/833 (4%)

Query: 300  TTVNTEKINRPPTYYVKKIIADDLTIDELNDLWVTLRTEQLDWVDAFLEHQGHIAMANVL 359
            +T+  ++ NRPP +YV++I+AD LT DE+ DLWVTLRTEQLDWVDAF++HQGHIAMANVL
Sbjct: 328  STLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIDHQGHIAMANVL 387

Query: 360  MKSLYKTTQEVKLTEKSLEREASYFKCFRVLVMLAQGLYEFTKHAIMAETVAYALFSIRL 419
            M S+YKT     LT++ LE+E S+FKCFRVL ML+QGLYEF+ H +M +TVA  LFS RL
Sbjct: 388  MNSIYKTAPRDSLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGLFSTRL 447

Query: 420  PTRKMATEIFVCMLEKKNKSRFDVILTALDKKFMIGENLHMMQFVKNSPQQFIHLKRDSQ 479
             TRKMATEIFVCMLEKKNKSRF+ +LTALDKKF IG+NLHM+Q  K  PQ F HL  +S 
Sbjct: 448  ATRKMATEIFVCMLEKKNKSRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYFSHLTLESH 507

Query: 480  FKIVQAWLTGLETALQGRGKMGSLVGASEEVRAAGGENSILEYSQWTMVFINHLCMGTDV 539
             KI+QAWL  +E  L GRGKMGSLVGAS+E +  GGEN+ILEY QWTMVFINHLC  +D 
Sbjct: 508  LKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFINHLCSCSDN 567

Query: 540  VNQRVLLRTRLENAGALRIMNRFKLLDYDKITAQIEYYENGKLDDINNLLESEGRNTQVN 599
            +NQR+LLRT+LEN G LRIMN+ KLLDYDK+  QIE Y+N KLDD N  LE+  +   V+
Sbjct: 568  INQRMLLRTKLENCGVLRIMNKIKLLDYDKVMDQIELYDNNKLDDFNVRLEANNKAFNVD 627

Query: 600  MQDPMMMLQTMWDYCKGTENEKTFISLIKHLFLSSSKVADDRGDPSKLAKQLKLMDSLXX 659
            +QDP+ +L+ +WD CKGTENEK  +SL++HLFLSSSK+ ++  +PSKL KQLK+MDSL  
Sbjct: 628  LQDPLSLLKNLWDICKGTENEKLLVSLVQHLFLSSSKLIEENQNPSKLTKQLKVMDSLVT 687

Query: 660  XXXXXXXX-XXXXXXXXIQRLYDAMQTDEVARRAILESRQLTKELEEIQAERDFLRQKLN 718
                             IQRLYDAMQTDEVARRAILESR LTK+LEEIQAERD L +KL+
Sbjct: 688  SVSIASTSDEESNMNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDSLSEKLS 747

Query: 719  STGDGIVGRLEEELKQRDDILAKNQRVNRHLQAXXXXXXXXXXXXXXXXXXXXXXMLTIL 778
                G+VG+LE+EL  RD ILAKNQRV + L+A                      MLTIL
Sbjct: 748  KAEHGLVGQLEDELHGRDRILAKNQRVMQQLEAELEELKKKHLLEKHQQEVELRKMLTIL 807

Query: 779  NARPDDENLAKSTKVTKSVNGLDPDRQTSIQKALQDGLQRTRKDLSVDSKRFGITVQPNK 838
            N+RP +EN + +  +    + L+   + +IQK LQDGL R +KD   DSK+FG+T+QPNK
Sbjct: 808  NSRP-EENSSINEGIRGKNSSLNSSEKANIQKVLQDGLSRAKKDYKDDSKKFGMTLQPNK 866

Query: 839  RLRMLRMKMEGIEQEARELEMTNFAEHEEKQLEEPVGTGTK----------------KKA 882
            RL+MLRM+ME IE EAR+LEMTNFAE E+  LE P+                     ++ 
Sbjct: 867  RLKMLRMQMENIENEARQLEMTNFAEFEKDHLEPPIQIKKPKLKKIKHKDKKLISRPQEV 926

Query: 883  GVRKLSELRKQLSDIQKETNEVTKFNVEERVKELFNQXXXXXXXXXXXXXTTYKGFGIDF 942
             + KL++LR+ L++IQ E+N+++KFNVEERV ELFN+             T YKGFGIDF
Sbjct: 927  DMNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRLKELETKYKGFGIDF 986

Query: 943  NANALLESKGGDIHWNDDEIDGQ-----DLQGAQEKMDEMDRIANELTAMKMKVEIQNQQ 997
            N   ++ES   +   N+ + DG      D +  Q K+DE++RI ++L    + ++ Q +Q
Sbjct: 987  NVEEIMESPKKN-SANERKEDGANYSSLDPRTYQNKLDEINRITDQL----LDLQAQTKQ 1041

Query: 998  QHXXXXXXXXXXXXXXGATGSR-----TDTASEFSQKSFGSGAGSFLEALSQKYGAGQNT 1052
                            G    +      +  SE S+ S  SG+GSFL+ALSQKYG GQN 
Sbjct: 1042 DDGGVSSLSSSSSSAEGEDVYQDAFPAQEVRSENSELSVESGSGSFLDALSQKYGTGQNN 1101

Query: 1053 TIS----NSPFPGV-DRKSSNHRTSFANRMKKSNAT--PYFDELTRKVAKAPS 1098
            T+S    +S +  V     S    +F N+++KS A+  PY +ELT+KV K  S
Sbjct: 1102 TVSVGLRDSDYVSVIGHMPSKVEKTFMNKLRKSTASSAPYLEELTQKVNKVES 1154

 Score =  103 bits (257), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 46/71 (64%), Positives = 57/71 (80%)

Query: 160 VLSQGSLTNLGRFMRPDGKVRLDMPQDYHEVESLFEDIMYKRNIMQTLPPEKQQELRNYD 219
           +LSQGSLTNL +F  PDGK+ L+MP D +EVE LFEDIMYKRNI Q+L  +KQ+ L +Y 
Sbjct: 153 LLSQGSLTNLSKFTTPDGKIHLEMPSDPYEVEVLFEDIMYKRNIFQSLSGDKQEALMSYS 212

Query: 220 IDKKWLIVRQD 230
            +KKWLIV+QD
Sbjct: 213 TEKKWLIVKQD 223

>Skud_14.69 Chr14 complement(118022..123862) [5841 bp, 1946 aa] {ON}
            YNL271C (REAL)
          Length = 1946

 Score =  809 bits (2090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/834 (51%), Positives = 548/834 (65%), Gaps = 42/834 (5%)

Query: 300  TTVNTEKINRPPTYYVKKIIADDLTIDELNDLWVTLRTEQLDWVDAFLEHQGHIAMANVL 359
            +T+  ++ NRPP +YV++I+AD LT DE+ DLWVTLRTEQLDWVDAF+EHQGHIAMANVL
Sbjct: 326  STLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVL 385

Query: 360  MKSLYKTTQEVKLTEKSLEREASYFKCFRVLVMLAQGLYEFTKHAIMAETVAYALFSIRL 419
            M S+YKT     LT++ LE+E S+FKCFRVL ML+QGLYEF+ H +M +TVA  LFS +L
Sbjct: 386  MNSMYKTAPRDNLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGLFSTKL 445

Query: 420  PTRKMATEIFVCMLEKKNKSRFDVILTALDKKFMIGENLHMMQFVKNSPQQFIHLKRDSQ 479
             T+KMATEIFVCMLEKKNKSRF+ +LTALDKKF IG+NLHM+Q  K  PQ F HL  +S 
Sbjct: 446  ATKKMATEIFVCMLEKKNKSRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYFSHLTLESH 505

Query: 480  FKIVQAWLTGLETALQGRGKMGSLVGASEEVRAAGGENSILEYSQWTMVFINHLCMGTDV 539
             KI+QAWL  +E  L GRGKMGSLVGAS++ +  GGEN+ILEY QWTMVFINHLC  +D 
Sbjct: 506  LKIIQAWLFAVEQTLDGRGKMGSLVGASDDFKNGGGENAILEYCQWTMVFINHLCSCSDN 565

Query: 540  VNQRVLLRTRLENAGALRIMNRFKLLDYDKITAQIEYYENGKLDDINNLLESEGRNTQVN 599
            +NQR+LLRT+LEN G LRIMN+ KLLDYDK+  QI+ Y+N KLDD N  LE+      V+
Sbjct: 566  INQRMLLRTKLENCGVLRIMNKIKLLDYDKVIDQIDLYDNNKLDDFNVKLEANNEAFNVD 625

Query: 600  MQDPMMMLQTMWDYCKGTENEKTFISLIKHLFLSSSKVADDRGDPSKLAKQLKLMDSLXX 659
            +QDP+ +L+ +W  CKGTENEK  +SL++HLFLSSSK+ ++  + SKL KQLKLMDSL  
Sbjct: 626  LQDPLSLLKNLWGICKGTENEKLLVSLVQHLFLSSSKLIEENQNSSKLTKQLKLMDSLVT 685

Query: 660  XXXXXXXX-XXXXXXXXIQRLYDAMQTDEVARRAILESRQLTKELEEIQAERDFLRQKLN 718
                             IQRLYDAMQTDEVARRAILESR LTK+LEEIQAERD L +KL+
Sbjct: 686  NVSIASAADEESNLNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDSLSEKLS 745

Query: 719  STGDGIVGRLEEELKQRDDILAKNQRVNRHLQAXXXXXXXXXXXXXXXXXXXXXXMLTIL 778
                G+VG+LE+EL +RD ILAKNQRV + L++                      MLTIL
Sbjct: 746  KAEHGLVGQLEDELHERDHILAKNQRVMQQLESELEELKKKHLLEKHQQEVELRKMLTIL 805

Query: 779  NARPDDENLAKSTKVTKSVNGLDP----DRQTSIQKALQDGLQRTRKDLSVDSKRFGITV 834
            N+RP++     S+ + +    +DP      + +IQK LQDGL R +KD   DSK+FG+T+
Sbjct: 806  NSRPEE-----SSDINEGTRNIDPSLNFSEKANIQKVLQDGLSRAKKDYKDDSKKFGMTL 860

Query: 835  QPNKRLRMLRMKMEGIEQEARELEMTNFAEHEEKQLEEPVGT----------------GT 878
            QPNKRL+MLRM+ME IE EAR+LEMTNFAE E+++LE P+                    
Sbjct: 861  QPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLEPPIQIKKPKLKKNKHKDKNFLAR 920

Query: 879  KKKAGVRKLSELRKQLSDIQKETNEVTKFNVEERVKELFNQXXXXXXXXXXXXXTTYKGF 938
             ++A + KL++LR+ L+DIQ E+N ++KFNVEERV ELFN+             T YKGF
Sbjct: 921  AQEADMNKLNDLRRALADIQMESNNISKFNVEERVNELFNEKKSLALKRLKELETKYKGF 980

Query: 939  GIDFNANALLESKG----GDIHWNDDEIDGQDLQGAQEKMDEMDRIANELTAMKMKV--- 991
            GIDFN   ++ES       D    D      D +  Q+K+DE++RI +EL  ++ +    
Sbjct: 981  GIDFNVEKIMESPKKLSVADEREGDARYSSLDPKAYQKKLDEINRITDELLDLQTQTKQE 1040

Query: 992  --EIQNQQQHXXXXXXXXXXXXXXGATGSRTDTASEFSQKSFGSGAGSFLEALSQKYGAG 1049
              E +N +                       +  SE S+ S GSG GSFL+ALSQKYG G
Sbjct: 1041 TKEEENGKSSFSSSSSDADDDEVYQDASPTHEIRSENSELSAGSGPGSFLDALSQKYGTG 1100

Query: 1050 QNTTIS-----NSPFPGVDRKSSNHRTSFANRMKKS--NATPYFDELTRKVAKA 1096
            QN T S     +    G+    S    +F NR+K+S  N+ PY +ELT+KV K 
Sbjct: 1101 QNVTASAGLRDSGYVSGLGHTPSKVEKTFMNRLKRSTVNSAPYLEELTQKVNKV 1154

 Score =  777 bits (2006), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/641 (61%), Positives = 482/641 (75%), Gaps = 30/641 (4%)

Query: 1239 KMYRSDMSNYLEETPTFRDNYPQPHKKLKQLHWEKLDATEDSIWSSGVAEKFAGDLYEKG 1298
            +M  +  S  L ++P+  + YP+PHKKLKQLHWEKLD+T++SIW SG AEKFA DLYEKG
Sbjct: 1324 QMKSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEKG 1383

Query: 1299 VLAGLEKAFAAREIKNLATKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILK 1358
            VLA LEKAFAAREIK+LATK+KEDL+KITFLS D SQQFGINLHMYS +SV DLV K+L 
Sbjct: 1384 VLADLEKAFAAREIKSLATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLN 1443

Query: 1359 CDRDFMQTPSVIEFLSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRA 1418
            CDRDF+QTPSV+EFLSK+EI EVSVNLARN++PYSTDW+G+++L+DAKPPEKDPNDLQRA
Sbjct: 1444 CDRDFLQTPSVVEFLSKTEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRA 1503

Query: 1419 DQIYLQLIFNLQAYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFN 1478
            DQ+YLQL+ NL++YWGSRMRA+ V+TSY++EY EL+ KLRKVDKAVGA+  S+NL N+FN
Sbjct: 1504 DQVYLQLMINLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFN 1563

Query: 1479 VILAVGNFMNDTAKRAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRGNYPSFNDFLKE 1538
            VILAVGNFMNDT+K+AQGFKLSTLQRLTFIKDT NSMTFLNYVEKIIR NYP+FNDFLKE
Sbjct: 1564 VILAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFLKE 1623

Query: 1539 LEPVLNVTKISIDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPE 1598
            LEPVL+V K+SI+QLVNDC ++ Q++ NVERS+EIGNLSDSSKFHPLD+VLIK LPVLPE
Sbjct: 1624 LEPVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPE 1683

Query: 1599 ARKKCDLLDDEVRLSIMEFENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQNLKV 1658
            AR+K DLL DEV+L+IMEFE+LMQ YGED+G               + EYKKAQ QNL  
Sbjct: 1684 ARRKGDLLKDEVKLTIMEFESLMQTYGEDSGDKFAKISFFKKFADFINEYKKAQAQNLAG 1743

Query: 1659 EEEERVYERHKKMV----------EEQQRREQTPSKNRDYVVNXXXXXXXXXXXXXXXXX 1708
            EEEER+YE+HKK+V          E+Q+ R  +PS   +                     
Sbjct: 1744 EEEERLYEKHKKLVEEQQKKAQEKEKQKERSASPSPEGN---------EEDEAEDRRDVM 1794

Query: 1709 XKLLDQLKNAGPTTSDPSSARKRALMRRKLQADKDAAAHLISDLDSNEDSIVYSPNASQD 1768
             KLL+QLKNAGP  +DPSSARKRAL+R+K  +DKD+A  L++DLD+ E SI+YSP A+  
Sbjct: 1795 DKLLEQLKNAGPAKTDPSSARKRALVRKKYLSDKDSAPQLLNDLDNEEGSILYSPEATTP 1854

Query: 1769 QSANAEEA-SPTVHKGSNKNNKPVLSDLESPIKASRNADRXXXXXXXXISDKAKNLLMEL 1827
             +  A  A SPT        N P   DL SP KA    D+        ISD+A+ LL EL
Sbjct: 1855 DTYTAVHAESPTPLATRGLMNTP--EDLPSPSKAPALEDQ------EEISDRARMLLKEL 1906

Query: 1828 SGNGAPTRREELLNGHKERLRARRRRTQGHGELISSNKLAF 1868
             G+    ++   L+ H E+LRAR+ R     E  + NKL+F
Sbjct: 1907 RGSEISVKQNSTLDEHLEKLRARKER--ASSETNTGNKLSF 1945

 Score =  102 bits (255), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 46/71 (64%), Positives = 56/71 (78%)

Query: 160 VLSQGSLTNLGRFMRPDGKVRLDMPQDYHEVESLFEDIMYKRNIMQTLPPEKQQELRNYD 219
           +LSQGSLTNL +F  PDGK+ L+MP D +EVE LFEDIMYKRNI Q+L  +KQ+ L  Y 
Sbjct: 151 LLSQGSLTNLSKFTTPDGKIHLEMPSDPYEVEILFEDIMYKRNIFQSLSGDKQEALMGYS 210

Query: 220 IDKKWLIVRQD 230
            +KKWLIV+QD
Sbjct: 211 TEKKWLIVKQD 221

>KAFR0D03950 Chr4 (770599..776472) [5874 bp, 1957 aa] {ON} Anc_1.82
            YNL271C
          Length = 1957

 Score =  786 bits (2029), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/826 (49%), Positives = 544/826 (65%), Gaps = 35/826 (4%)

Query: 300  TTVNTEKINRPPTYYVKKIIADDLTIDELNDLWVTLRTEQLDWVDAFLEHQGHIAMANVL 359
            +T++++K NRPP  YV+KIIAD L+ DE+ DLWVTLRTEQLDWVD+FLE+QGHIAMAN+L
Sbjct: 306  STLSSDKTNRPPNRYVEKIIADKLSPDEMRDLWVTLRTEQLDWVDSFLENQGHIAMANIL 365

Query: 360  MKSLYKTTQEVKLTEKSLEREASYFKCFRVLVMLAQGLYEFTKHAIMAETVAYALFSIRL 419
            MK +YKTT +  L+ K LE+E S+FKCF+VL ML+QG+YEF+KH +M +T+A  LFS RL
Sbjct: 366  MKQIYKTTPKDHLSSKLLEKENSFFKCFKVLSMLSQGIYEFSKHKLMTDTIARGLFSTRL 425

Query: 420  PTRKMATEIFVCMLEKKNKSRFDVILTALDKKFMIGENLHMMQFVKNSPQQFIHLKRDSQ 479
             TRKMA EIFVCMLEK+NKSRF+ IL +LD+ F IG N HM Q +K  PQ FIHL  DS 
Sbjct: 426  GTRKMAIEIFVCMLEKRNKSRFEAILNSLDQNFRIGSNFHMFQNLKKLPQYFIHLTPDSH 485

Query: 480  FKIVQAWLTGLETALQGRGKMGSLVGASEEVRAAGGENSILEYSQWTMVFINHLCMGTDV 539
             K++QAWL  +E  + GRGKMGSLVGAS +++ +GGEN+ILEY  WTMVF+N LC  + +
Sbjct: 486  LKVLQAWLFSIENTIDGRGKMGSLVGASTDLKNSGGENAILEYCLWTMVFVNMLCNASTI 545

Query: 540  VNQRVLLRTRLENAGALRIMNRFKLLDYDKITAQIEYYENGKLDDINNLLESEGRNTQVN 599
            + QR+LLRT+LEN+G LRIMN+ KLL+Y+K+  +IE YEN KLDD N +LES+ +N+ VN
Sbjct: 546  IQQRMLLRTKLENSGFLRIMNKIKLLNYEKVIDEIESYENNKLDDFNLMLESKNKNSNVN 605

Query: 600  MQDPMMMLQTMWDYCKGTENEKTFISLIKHLFLSSSKVADDRGDPSKLAKQLKLMDSLXX 659
            +QDP+ +L  +W  CKGTENEK  ISLI+HLFLSSS++ ++  DP+KL+KQLKLMDSL  
Sbjct: 606  LQDPVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRLIEEVDDPTKLSKQLKLMDSLVT 665

Query: 660  XXXXXXXX-XXXXXXXXIQRLYDAMQTDEVARRAILESRQLTKELEEIQAERDFLRQKLN 718
                             IQRLYD+MQTDEVARRAILESR LTK+LEE+QAE+D L +KL+
Sbjct: 666  NVSSSSTADEESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEELQAEKDLLHEKLS 725

Query: 719  STGDGIVGRLEEELKQRDDILAKNQRVNRHLQAXXXXXXXXXXXXXXXXXXXXXXMLTIL 778
               +G+VG+LE +L +RD ILAKNQRV + LQ+                      MLTIL
Sbjct: 726  KAENGLVGQLENDLNERDQILAKNQRVTQQLQSELEELKKKHLLEKHEHEVELRKMLTIL 785

Query: 779  NARPDDENLAKSTKVTK-SVNGLDPDRQTSIQKALQDGLQRTRKDLSVDSKRFGITVQPN 837
            N R    + AK+    K +++ L+  +  +IQK LQDGL R + D ++D+K+FG+TVQPN
Sbjct: 786  NTRSSTNDGAKTIDKDKDNISKLNLQKHENIQKVLQDGLIRAKNDFTIDAKKFGMTVQPN 845

Query: 838  KRLRMLRMKMEGIEQEARELEMTNFAEHEEKQLEEPVGT-------------------GT 878
            KRL+MLRM+ME IE EAR+LEMTNF E E K+LE PV                       
Sbjct: 846  KRLKMLRMQMEDIENEARQLEMTNFTEFERKKLEPPVEVTKPKHRHKKHKIEKINQQESN 905

Query: 879  KKKAGVRKLSELRKQLSDIQKETNEVTKFNVEERVKELFNQXXXXXXXXXXXXXTTYKGF 938
             +K+ + KL++LR+ L++IQ E+N ++KFN+EERV ELFN+             T YK F
Sbjct: 906  DQKSRINKLNDLREALAEIQTESNNISKFNLEERVNELFNEKKLKALQRLKELETKYKDF 965

Query: 939  GIDFNANALLESK---GGDIHWNDDEIDGQDLQGAQEKMDEMDRIANELTAMKMKVEIQN 995
            GI+F     LE+K   G      ++E +  D +  ++K+D++DR+  +L      + +Q 
Sbjct: 966  GINFEMKDFLENKPNDGTKEGSTEEEYESLDPKIYEKKLDDIDRLTEQL------LNLQK 1019

Query: 996  QQQHXXXXXXXXXXXXXXGATGSRTDTASEFSQKSFGSGAGSFLEALSQKYGAGQ-NTTI 1054
             Q+                         +  S K  GSG  SFLE LS+KYG GQ N  +
Sbjct: 1020 TQELREESSSSYSSSESDEENDDDEIFVASSSSKPAGSGTRSFLETLSEKYGTGQKNVAM 1079

Query: 1055 SNSPFPGVDRKSSNHRTSFANRMKKSN-ATPYFDELTRKVAKAPSL 1099
            + +P   +  +S      F +RM++S+ A P+  ELT KVA A S+
Sbjct: 1080 TATPNSRIVTQSEKQ---FLDRMRRSSTAAPFLQELTEKVAPALSV 1122

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/624 (62%), Positives = 473/624 (75%), Gaps = 19/624 (3%)

Query: 1249 LEETPTFRDNYPQPHKKLKQLHWEKLDATEDSIWSSGVAEKFAGDLYEKGVLAGLEKAFA 1308
            L ++P+  + YP+  KK+KQLHWEK++ T++SIW++G AE+FA DL+EKGV + LEKAFA
Sbjct: 1293 LPQSPSLFERYPRSQKKMKQLHWEKIETTDNSIWTTGKAERFADDLFEKGVFSNLEKAFA 1352

Query: 1309 AREIKNLATKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQTPS 1368
            ARE+K+LA+K+K+DL KITFLS D SQQFGINLHMYS +SV DLV KILKCDRDF+ TPS
Sbjct: 1353 AREVKSLASKRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPS 1412

Query: 1369 VIEFLSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQLIFN 1428
            VIEFLSK EITEVSVNLARN+SPY+TDW+G+KS+EDAKPPEKDPNDLQRADQIYLQL+ N
Sbjct: 1413 VIEFLSKPEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVN 1472

Query: 1429 LQAYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGNFMN 1488
            LQ YW SRMRA+K+IT+Y+KEY EL+ KLRKVDKAVG++ +SENL N+FNVILAVGN+MN
Sbjct: 1473 LQPYWASRMRALKIITTYEKEYNELLLKLRKVDKAVGSLQESENLRNVFNVILAVGNYMN 1532

Query: 1489 DTAKRAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRGNYPSFNDFLKELEPVLNVTKI 1548
            DT+K+AQGFKLSTLQRLTFIKD+ NSMTFLNYVEKIIR NYPSFN FL+ELEPVL V KI
Sbjct: 1533 DTSKQAQGFKLSTLQRLTFIKDSTNSMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKI 1592

Query: 1549 SIDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDLLDD 1608
            SI+QL NDC E+ Q+VTNVERSIEIGNLSDSSKFHPLDRVL KVLP LP+ RKK DLL+D
Sbjct: 1593 SIEQLANDCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLND 1652

Query: 1609 EVRLSIMEFENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQNLKVEEEERVYERH 1668
            EV L++MEF+ LMQ YGEDT                + EY+KAQ QN+KVEEEE  YERH
Sbjct: 1653 EVNLTLMEFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVEEEEEAYERH 1712

Query: 1669 KKMVEEQQRR-EQTPSKNRDYVVNXXXXXXXXXXXXXXXXXXKLLDQLKNAGPTTSDPSS 1727
            K+MVEEQQR+ E+  +KN++ +                    KLL+QLKN GP+ +DPSS
Sbjct: 1713 KRMVEEQQRKAERKEAKNQNNI--DENEDDDQERTDRRGTMDKLLEQLKNVGPSRADPSS 1770

Query: 1728 ARKRALMRRKLQADKDAAAHLISDLDSNEDSIVYSPNASQDQSANAEEASPTVHKGSNKN 1787
            ARKRAL R+K+  DK+   +++ DL++  DSI+YSP    D  A            S+K 
Sbjct: 1771 ARKRALARKKMLTDKEGTVNMMHDLETESDSIIYSP----DNKAIGSTPFGANGASSHKQ 1826

Query: 1788 NKPVLSDLESPIKASRNADRXXXXXXXXISDKAKNLLMELSGNGAPTRREELLNGHKERL 1847
            N   L    SP K  R+           IS++AK LLM L G  +P++R  +L+ HKE+L
Sbjct: 1827 NSNEL----SPSKGFRD-----DLSEEEISERAKTLLMGLRGTASPSKRNSMLDEHKEKL 1877

Query: 1848 RARRRRTQGHGELIS-SNKLAFLD 1870
            RARRRRT  + +L S SNKL F D
Sbjct: 1878 RARRRRT--NNDLPSGSNKLKFYD 1899

 Score = 95.1 bits (235), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 52/67 (77%)

Query: 164 GSLTNLGRFMRPDGKVRLDMPQDYHEVESLFEDIMYKRNIMQTLPPEKQQELRNYDIDKK 223
            S  N  +F+ PDGK  L+MP+D  E+E+LFE+IMYKRNI+Q L  EKQ+EL NYD+ KK
Sbjct: 153 SSYINFSKFITPDGKTNLEMPRDPKEIENLFEEIMYKRNILQNLSVEKQRELMNYDVRKK 212

Query: 224 WLIVRQD 230
           WLIV+QD
Sbjct: 213 WLIVKQD 219

>NDAI0F04220 Chr6 (1024727..1030795) [6069 bp, 2022 aa] {ON} 
          Length = 2022

 Score =  777 bits (2006), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/893 (48%), Positives = 557/893 (62%), Gaps = 51/893 (5%)

Query: 301  TVNTEKINRPPTYYVKKIIADDLTIDELNDLWVTLRTEQLDWVDAFLEHQGHIAMANVLM 360
            T  T+K NR P  YVKKII+D LT +E+ DLWVTLRTEQLDWVDAF+EHQGHIAMANVLM
Sbjct: 328  TTLTDKTNRLPIEYVKKIISDTLTSEEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLM 387

Query: 361  KSLYKTTQEVKLTEKSLEREASYFKCFRVLVMLAQGLYEFTKHAIMAETVAYALFSIRLP 420
            KS+YKTT   KLT + LE+E S+FKCFRVL ML+QGL EFTKH +MA+T+A  LFS  L 
Sbjct: 388  KSIYKTTPNEKLTSQLLEKENSFFKCFRVLSMLSQGLREFTKHELMAQTIARGLFSTTLS 447

Query: 421  TRKMATEIFVCMLEKKNKSRFDVILTALDKKFMIGENLHMMQFVKNSPQQFIHLKRDSQF 480
            TRKMATEIFVCML KKN  RF VIL  LD+KF IG+NLHM   +K   + F  L  DS  
Sbjct: 448  TRKMATEIFVCMLNKKNPERFKVILNVLDQKFKIGQNLHMAHNLKKFGEYFGPLTLDSNL 507

Query: 481  KIVQAWLTGLETALQGRGKMGSLVGASEEVRAAGGENSILEYSQWTMVFINHLCMGTDVV 540
            K+ +AWL  +E +L GRGKMGS VGAS++ + +GGEN+ LEY QW+M+FINHLC+ +D +
Sbjct: 508  KVTRAWLFAVEHSLDGRGKMGSFVGASDDYKNSGGENATLEYCQWSMIFINHLCLCSDNI 567

Query: 541  NQRVLLRTRLENAGALRIMNRFKLLDYDKITAQIEYYENGKLDDINNLLESEGRNTQVNM 600
            NQR+LLR +LE  G +RIMN+ K L Y+K+  QI+ YEN KLDDIN LLE   +N  +N+
Sbjct: 568  NQRMLLRNKLEYCGIVRIMNQIKSLHYEKVIEQIDVYENSKLDDINKLLELSNKNANINL 627

Query: 601  QDPMMMLQTMWDYCKGTENEKTFISLIKHLFLSSSKVADDRGDPSKLAKQLKLMDSLXXX 660
             DP  +++ +WD CKGTENEK  ISL++HLFLSSS++ +D+ D ++L+KQLKLMDSL   
Sbjct: 628  HDPTSLVKNLWDACKGTENEKLLISLVQHLFLSSSQLIEDKQDATQLSKQLKLMDSLVTN 687

Query: 661  XXXXXXXXXXXXXXXIQRLYDAMQTDEVARRAILESRQLTKELEEIQAERDFLRQKLNST 720
                           IQRLYDAMQTDEVARR+ILESR LTK+LEE QAE D L QKL + 
Sbjct: 688  VSVASTDQESTMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEESQAEIDLLSQKLKNA 747

Query: 721  GDGIVGRLEEELKQRDDILAKNQRVNRHLQAXXXXXXXXXXXXXXXXXXXXXXMLTILNA 780
              G+VG+L++EL+QRD + AKNQR+   LQA                      MLTILNA
Sbjct: 748  EHGLVGQLQDELRQRDRMFAKNQRITEQLQAELEDLKKKHLLEKHEQEVELRKMLTILNA 807

Query: 781  RPDDENL-AKSTKVTKSVNG-LDPDRQTSIQKALQDGLQRTRKDLSVDSKRFGITVQPNK 838
            R D   +  KS+K  K + G  +  ++ +IQK LQ+GL RT+KD ++DSK FG+TVQPNK
Sbjct: 808  RSDKGEIEKKSSKKHKRIPGSFESSKKQNIQKVLQEGLNRTKKDFTMDSKSFGMTVQPNK 867

Query: 839  RLRMLRMKMEGIEQEARELEMTNFAEHEEKQLE------------EPVGTGTKKKAGVRK 886
            RL+ LRM+ME IE EARELEMTNFAE E+K+LE            +      ++   ++K
Sbjct: 868  RLKALRMQMEDIENEARELEMTNFAEFEKKKLEPAPKIKKLKQKKQNKNEKKEEDDKIKK 927

Query: 887  LSELRKQLSDIQKETNEVTKFNVEERVKELFNQXXXXXXXXXXXXXTTYKGFGIDFNANA 946
            L+ELR+ L++IQ E+N+++KFNVEERV ELFN+             T YK FGI+FN + 
Sbjct: 928  LNELRQTLANIQNESNDISKFNVEERVNELFNEKRSTALQRLKELETKYKDFGINFNIDD 987

Query: 947  LLESKGGDIHWNDD--EIDGQDLQGAQEKMDEMDRIANELTAMKMKVEIQNQQQHXXXXX 1004
            + E   G  +  D   E    D    Q K+DE++RI  +L   + K+  +N +       
Sbjct: 988  ISEKTTGIDNSGDKSTEYSSLDPNAYQIKLDELNRITEQLLDAQAKLNEKNLKDSSNKST 1047

Query: 1005 XXXXXXXXXGATGSRT----------------DTASEFSQKSFGSGAGSFLEALSQKYGA 1048
                      ++ S +                D  SE S +S  S AGSFLEALSQKY  
Sbjct: 1048 FSESSSSSSSSSSSSSSSSSSDEEEIDDIKSRDRQSEISAQSTSSAAGSFLEALSQKYAM 1107

Query: 1049 GQNTTISNSPFPGVDRKSSNHRTSFANRMKKSNATPYF-DELTRKVAKAPS-------LN 1100
            GQN    N   P  DR     +  F NR++K+N TP F +EL+ KV    S       + 
Sbjct: 1108 GQN----NPSSPQRDRPVKASQYDFINRVRKNNITPQFLEELSGKVVPPSSGLSTTTKVV 1163

Query: 1101 DPSSPGSNEPGDDDTLPATS-PTVPQSI------NDTVSKDKNSTSSPEAPPT 1146
            D +S G +E   ++ L  T+ P    S       ND + +++N T      PT
Sbjct: 1164 DVTSGGKSETATENVLENTTEPVTEHSFRNAVLSNDKIDREENDTVISTTEPT 1216

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/646 (59%), Positives = 489/646 (75%), Gaps = 26/646 (4%)

Query: 1236 GQKKMYRSDMSNYLEETPTFRDNYPQPHKKLKQLHWEKLDATEDSIWSSGVAEKFAGDLY 1295
            G KK+  S +   L ++P+  +NYP+PHKKLKQLHWEK++AT++SIW +  AE+FA DLY
Sbjct: 1329 GPKKVLSSPL---LPQSPSLFENYPRPHKKLKQLHWEKVEATDNSIWRANKAEQFADDLY 1385

Query: 1296 EKGVLAGLEKAFAAREIKNLATKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIK 1355
            EKGVL+ LE AFAAREIK+LA+K+K+DL+KITFLSHD SQQFGINLHMY+ + V DL+ K
Sbjct: 1386 EKGVLSELENAFAAREIKSLASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITK 1445

Query: 1356 ILKCDRDFMQTPSVIEFLSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDL 1415
            ILKCDRDF+QTPSVIEFLS+ EI +VSVNLARN++PY  DW+GIK++EDAKPPEK+PN+L
Sbjct: 1446 ILKCDRDFLQTPSVIEFLSRPEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNEL 1505

Query: 1416 QRADQIYLQLIFNLQAYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSN 1475
            QRADQIYLQL+ NLQ+YWGSRMRA+KVIT+++KEY EL+TKLRKVD+AV ++ +SENL N
Sbjct: 1506 QRADQIYLQLMVNLQSYWGSRMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKN 1565

Query: 1476 IFNVILAVGNFMNDTAKRAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRGNYPSFNDF 1535
            +F VILAVGN+MNDT+K+AQGFKL+TLQRLTFIKD+ N+MTFLNYVEKI+R NYP+FN F
Sbjct: 1566 VFGVILAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFNKF 1625

Query: 1536 LKELEPVLNVTKISIDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPV 1595
            L ELEPVL+V KISI+QLV+DC E+ Q++ NVERSIEIGNLSDSSKFHP DRVL KVLP 
Sbjct: 1626 LVELEPVLDVVKISIEQLVDDCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPS 1685

Query: 1596 LPEARKKCDLLDDEVRLSIMEFENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQN 1655
            LP+ARKK +LL DEV+L+IMEF  LMQ YGED+G               + EYKKAQ QN
Sbjct: 1686 LPDARKKGELLGDEVKLTIMEFLRLMQIYGEDSGDKFAKNSFFKKFADFITEYKKAQTQN 1745

Query: 1656 LKVEEEERVYERHKKMVEEQQRREQTPSKNRDYVVNXXXXXXXXXXXXXXXXXXKLLDQL 1715
            L++EEEE+VYERHKKMVEEQQR+ Q    +R                        LL+QL
Sbjct: 1746 LRLEEEEKVYERHKKMVEEQQRKAQEAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQL 1805

Query: 1716 KNAGPTT-SDPSSARKRALMRRKLQADKDAAAHLISDLDSNEDSIVYSPNASQDQSANAE 1774
            KN  PT  +DPSSARKRAL+R+KL    ++ ++++ D+D+ +DSI+YSP+A +  +   +
Sbjct: 1806 KNVTPTNKTDPSSARKRALVRKKLMG--ESTSNILKDIDTEDDSIIYSPDAKKPMATTVD 1863

Query: 1775 EASPT------VHKGSNKNNKPVLSDLESPIKASRNADRXXXXXXXXISDKAKNLLMELS 1828
             A+ T      V   +  N+ P+ +++      S N D         I ++A+ LL++L+
Sbjct: 1864 MANTTLESELDVSSPTRHNSSPIKNEI------SMNVDE----EEEEIGNRAQALLIQLT 1913

Query: 1829 GNGAPTRREELLNGHKERLRARRRRTQGHGELISSNKLAFL-DDET 1873
            G+ +PT+R  LLN HKERLRARRRRT    E +S  KL F+ +DET
Sbjct: 1914 GSHSPTKRHSLLNEHKERLRARRRRTT--NEFVSG-KLQFVGEDET 1956

 Score = 97.8 bits (242), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 44/71 (61%), Positives = 56/71 (78%)

Query: 160 VLSQGSLTNLGRFMRPDGKVRLDMPQDYHEVESLFEDIMYKRNIMQTLPPEKQQELRNYD 219
           VLSQGS +NL +FM  DGK+ L+MP D  E+E L+++IM KRNI+Q+LP  KQ EL +YD
Sbjct: 149 VLSQGSYSNLSKFMTHDGKLNLEMPTDPSEIEYLYQEIMIKRNILQSLPGTKQDELMSYD 208

Query: 220 IDKKWLIVRQD 230
           I KKWLIV+QD
Sbjct: 209 IGKKWLIVKQD 219

>CAGL0J08206g Chr10 (809506..815202) [5697 bp, 1898 aa] {ON} similar
            to uniprot|P41832 Saccharomyces cerevisiae YNL271c BNI1
            regulator of budding
          Length = 1898

 Score =  761 bits (1964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/638 (60%), Positives = 476/638 (74%), Gaps = 25/638 (3%)

Query: 1246 SNYLEETPTFRDNYPQPHKKLKQLHWEKLDATEDSIWSSGVAEKFAGDLYEKGVLAGLEK 1305
            S  L ++P+  +NYP+P KKLKQLHWEK+++T++SIW S  AEKFA DLYEKGVL+ LEK
Sbjct: 1245 SPLLPQSPSLFENYPRPQKKLKQLHWEKVESTDNSIWGSQKAEKFADDLYEKGVLSELEK 1304

Query: 1306 AFAAREIKNLATKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQ 1365
            AFAAREIK+LAT+KKEDL+KI+FLSHD SQQFGINLHMYS+++VN  V K+LKC+RDFM 
Sbjct: 1305 AFAAREIKSLATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMN 1364

Query: 1366 TPSVIEFLSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQL 1425
            TPSVIEFLSK EI EVS NLARN++PYSTDW+GIK +EDAK PEKDPN+LQRADQIYLQL
Sbjct: 1365 TPSVIEFLSKQEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQL 1424

Query: 1426 IFNLQAYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGN 1485
            + NLQ+YW SRMRAI++ITSY++EY EL+ KL +VDKAVG++  S+NL NIFNVILAVGN
Sbjct: 1425 MVNLQSYWASRMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGN 1484

Query: 1486 FMNDTAKRAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRGNYPSFNDFLKELEPVLNV 1545
            FMND+AK+A+GFKLSTLQRLTFIKD +NSMTFLNYVEKI+R NYP FN+FL ELEPVL V
Sbjct: 1485 FMNDSAKQAKGFKLSTLQRLTFIKDADNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEV 1544

Query: 1546 TKISIDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDL 1605
             K+SI+QLVNDCN++ Q + NVERSIEIGNLSDSSKFHPLD+VL+KVLP L EARKK +L
Sbjct: 1545 VKVSIEQLVNDCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGEL 1604

Query: 1606 LDDEVRLSIMEFENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQNLKVEEEERVY 1665
            L DE++L+IMEFE +MQ YGED G               + EYKKAQ QN+KVEEEE  Y
Sbjct: 1605 LADEMKLTIMEFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAY 1664

Query: 1666 ERHKKMVEEQQRREQT-PSKNRDYVVNXXXXXXXXXXXXXXXXXXKLLDQLKNAGPTTSD 1724
            ERHKKMVEEQQR+ Q   SK  +                      KLL+QLKNAG   +D
Sbjct: 1665 ERHKKMVEEQQRKAQEDASKLNENSSQTGNSDEEEESEDRRAVMDKLLEQLKNAGQVKTD 1724

Query: 1725 PSSARKRALMRRKLQADKDAAAHLISDLDSNEDSIVYSPNASQDQSANAEEASPT----- 1779
            P+SARKRAL+R+K+ + +++ +  ++++    DS++YSP+A +        ASPT     
Sbjct: 1725 PTSARKRALLRKKIHSSEESESSPLAEMQVGGDSLIYSPDAKEQIELEIHMASPTPKTKE 1784

Query: 1780 ---VHKGSNKNNKPVLSDLESPIKASRNADRXXXXXXXXISDKAKNLLMELSGNGAPTRR 1836
               +  G N N        ESP+K   N D         I D+AK LLMEL G+ A   R
Sbjct: 1785 DGKLGTGENSNG-------ESPLKKI-NEDE-------EIGDRAKTLLMELRGSDALMDR 1829

Query: 1837 EELLNGHKERLRARRRRTQGHGELISSNKLAFLDDETP 1874
               L+ HKERLRARR+RT  + ++ SSN+L F+D+++P
Sbjct: 1830 NTALDEHKERLRARRKRTDSN-KIPSSNRLKFVDEKSP 1866

 Score =  756 bits (1951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/805 (49%), Positives = 535/805 (66%), Gaps = 23/805 (2%)

Query: 300  TTVNTEKINRPPTYYVKKIIADDLTIDELNDLWVTLRTEQLDWVDAFLEHQGHIAMANVL 359
            +T+ ++K NRPP +YVKKI+ D L+ DE+ DLWVTLRTEQLDWVDAFLE+QGHIAMAN+L
Sbjct: 315  STIQSDKANRPPIHYVKKIVDDKLSKDEMKDLWVTLRTEQLDWVDAFLENQGHIAMANIL 374

Query: 360  MKSLYKTTQEVKLTEKSLEREASYFKCFRVLVMLAQGLYEFTKHAIMAETVAYALFSIRL 419
            MKS+YKTT + K++E  L++E ++FKCFRVL +L+QGL+EFT H++M +T+A  LFS RL
Sbjct: 375  MKSIYKTTPKDKVSEPLLDKENAFFKCFRVLAVLSQGLHEFTIHSLMTDTIAQGLFSGRL 434

Query: 420  PTRKMATEIFVCMLEKKNKSRFDVILTALDKKFMIGENLHMMQFVKNSPQQFIHLKRDSQ 479
             TRKMATEIFV +LEKKNK RF+ +L++LDK F+IG+N HM +  K  PQ F HL  +S 
Sbjct: 435  ATRKMATEIFVFLLEKKNKKRFESVLSSLDKNFIIGQNSHMNESYKKLPQYFTHLTSNSN 494

Query: 480  FKIVQAWLTGLETALQGRGKMGSLVGASEEVRAAGGENSILEYSQWTMVFINHLCMGTDV 539
             K++QAWL  +E  L GRGKMGSLVGASE+ + AGGEN+ILEY QWTMVFINHLC  ++ 
Sbjct: 495  LKVIQAWLFAVEQTLDGRGKMGSLVGASEDYKNAGGENAILEYCQWTMVFINHLCSSSEN 554

Query: 540  VNQRVLLRTRLENAGALRIMNRFKLLDYDKITAQIEYYENGKLDDINNLLESEGRNTQVN 599
            +NQR LLR +LEN G LRIMN+ KLLDY+K+  QIE YEN KLDD N LLES  +N  V+
Sbjct: 555  INQRTLLRRKLENCGILRIMNKIKLLDYEKVIDQIELYENNKLDDFNALLESNKKNINVD 614

Query: 600  MQDPMMMLQTMWDYCKGTENEKTFISLIKHLFLSSSKVADDRGDPSKLAKQLKLMDSLXX 659
            +QDP+ +++ + D CKGTENEKT +SL++H+FL +SK+ D++ DP+K+ KQLKLMDSL  
Sbjct: 615  LQDPVSLMKNLLDACKGTENEKTLVSLVQHIFLPTSKLLDEKQDPNKVTKQLKLMDSLVT 674

Query: 660  XXXXXXXXXXXXXXXXIQRLYDAMQTDEVARRAILESRQLTKELEEIQAERDFLRQKLNS 719
                            IQRLYD+MQTDEVARRAILESR LTK+LEE++AERD L +KL+ 
Sbjct: 675  NVSVTSTEEGSNVNMAIQRLYDSMQTDEVARRAILESRTLTKKLEEMEAERDMLVEKLSK 734

Query: 720  TGDGIVGRLEEELKQRDDILAKNQRVNRHLQAXXXXXXXXXXXXXXXXXXXXXXMLTILN 779
               G+VG+LE E+K+RD ILAKNQRV + L++                      MLTILN
Sbjct: 735  AEHGLVGQLEMEVKERDRILAKNQRVMKQLESELEELKKKHLLEKHEQEVELRKMLTILN 794

Query: 780  ARPDDENLAKSTKVTKSVNGLDPDRQTSIQKALQDGLQRTRKDLSVDSKRFGITVQPNKR 839
            +RP     AK+ +  K +  ++   +  +Q+ALQ GLQ+ +KD   DSK+FG+T+QPN+R
Sbjct: 795  SRP-----AKTKEQKKKIGSIEASEKEDLQRALQSGLQKAKKDFKDDSKKFGMTIQPNQR 849

Query: 840  LRMLRMKMEGIEQEARELEMTNFAEHEEKQLEEPVGTGTK--------KKAGVRKLSELR 891
            L++LRM+ME IE EAR+LEMTNFAE+E+K L+ P     K        K+  ++KL+ELR
Sbjct: 850  LKVLRMQMESIENEARKLEMTNFAEYEKKGLKPPANVQKKSKPISELNKEQRIQKLNELR 909

Query: 892  KQLSDIQKETNEVTKFNVEERVKELFNQXXXXXXXXXXXXXTTYKGFGIDFNANALLESK 951
             +L  IQ E+N+V+KFNV+ERV ELFN              T YKGFGIDF         
Sbjct: 910  DKLRRIQMESNDVSKFNVDERVNELFNDKKRTALQRLKELETKYKGFGIDFKVEDFTHES 969

Query: 952  GGDIHWNDDEIDGQDLQGAQEKMDEMDRIANELTAMKMKVEIQNQQQHXXXXXXXXXXXX 1011
                  +++     D +  Q+K+DE+ +I+ EL   K ++E                   
Sbjct: 970  TDS---SNEGYSSLDPKVYQDKLDEITKISEELLQQKNELETTQTSSSESNSDSESSSDS 1026

Query: 1012 XXGATGSRTDTASEFSQKSFGS--GAGSFLEALSQKYGAGQNTTISNSPFPGVDRKSSNH 1069
                  + T+        S  S   +GSFL+ L+QKYG GQ   I  SP   V   S+ +
Sbjct: 1027 DDSMEDALTNNKDINGTSSNVSDLASGSFLDTLTQKYGTGQAEPIQ-SP---VGHYSNRN 1082

Query: 1070 RTSFANRMKKSNATP-YFDELTRKV 1093
              SF +RMK+++  P Y +EL++K+
Sbjct: 1083 EKSFVDRMKRNSRVPSYVEELSKKM 1107

 Score =  122 bits (306), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 79/135 (58%), Gaps = 18/135 (13%)

Query: 96  RTPSQQSTGSKYTYPKRTSSSITGGNPSLPSSSATPIPAPVTPGQLSRXXXXXXXXXXXX 155
           RT S QS G KY+Y +R+S  ++                 + P  +              
Sbjct: 108 RTDSTQS-GFKYSYSRRSSGQVS-----------------MAPSSMGNINLTRHNTNTSF 149

Query: 156 XXXXVLSQGSLTNLGRFMRPDGKVRLDMPQDYHEVESLFEDIMYKRNIMQTLPPEKQQEL 215
               VLS GS+TNL RFM PDGK+ L MP D +EVESLFEDIMYKRNI+Q+LP EKQ EL
Sbjct: 150 SSASVLSHGSITNLSRFMTPDGKINLTMPSDPYEVESLFEDIMYKRNILQSLPQEKQNEL 209

Query: 216 RNYDIDKKWLIVRQD 230
            +Y I+KKWLIV+QD
Sbjct: 210 MSYSIEKKWLIVKQD 224

>Kpol_2000.66 s2000 (137817..142124,142127..143611) [5793 bp, 1930 aa]
            {ON} (137817..142124,142127..143611) [5793 nt, 1931 aa]
          Length = 1930

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/823 (49%), Positives = 537/823 (65%), Gaps = 37/823 (4%)

Query: 300  TTVNTEKINRPPTYYVKKIIADDLTIDELNDLWVTLRTEQLDWVDAFLEHQGHIAMANVL 359
            +++ T++INRPP +YVKKIIAD LT +E+NDLWVTLRTEQLDWVDAFLEHQGHIAMANVL
Sbjct: 319  SSIATDRINRPPIHYVKKIIADRLTSEEMNDLWVTLRTEQLDWVDAFLEHQGHIAMANVL 378

Query: 360  MKSLYKTTQEVKLTEKSLEREASYFKCFRVLVMLAQGLYEFTKHAIMAETVAYALFSIRL 419
            M ++YK     +LT +  E+E S+FKCFRVL ML+QGLYEF KH +M++T+A  LFS RL
Sbjct: 379  MNTIYKCAPGSELTPELQEKEHSFFKCFRVLSMLSQGLYEFAKHKLMSDTIANGLFSSRL 438

Query: 420  PTRKMATEIFVCMLEKKNKSRFDVILTALDKKFMIGENLHMMQFVKNSPQQFIHLKRDSQ 479
             TRKMATE+ VCM+EK+N  RF+V+L +LD+ F   ENL+M+   K  P ++     +++
Sbjct: 439  ATRKMATEVLVCMIEKRNNMRFEVVLASLDRYFRQEENLNMVHLSKTLPGEYPQSTPNTK 498

Query: 480  FKIVQAWLTGLETALQGRGKMGSLVGASEEVRAAGGENSILEYSQWTMVFINHLCMGTDV 539
            +KI+QAWL  L+  L GRGKMGSLVGAS++ R+A GEN+ILEY  WTMVFINHLC  + +
Sbjct: 499  YKIIQAWLIALDETLNGRGKMGSLVGASDDYRSA-GENAILEYCLWTMVFINHLCSNSSL 557

Query: 540  VNQRVLLRTRLENAGALRIMNRFKLLDYDKITAQIEYYENGKLDDINNLLESEGRNTQVN 599
            +NQR+LLRT+LEN GALRIM + K LDY+K+T QIE Y+N KLDD N +LE+E +N++VN
Sbjct: 558  LNQRILLRTKLENLGALRIMTKLKRLDYEKLTEQIELYDNNKLDDFNTVLETESKNSKVN 617

Query: 600  MQDPMMMLQTMWDYCKGTENEKTFISLIKHLFLSSSKVADDRGDPSKLAKQLKLMDSLXX 659
            MQ+P  +++ +W+ CKG++NEK  +SLI+HL+LSSSK+  ++ DP+KL+KQLKL+DSL  
Sbjct: 618  MQNPNSLIENLWESCKGSDNEKLLLSLIQHLYLSSSKLMGEKEDPTKLSKQLKLIDSLLT 677

Query: 660  XXXXXXXXXXXXXXXXIQRLYDAMQTDEVARRAILESRQLTKELEEIQAERDFLRQKLNS 719
                            IQRLYD+MQTDEVARRAILESR LTK+LEE  AERD+L  KL++
Sbjct: 678  NVNGSMFDEESHMNLAIQRLYDSMQTDEVARRAILESRTLTKKLEEAHAERDYLSNKLSN 737

Query: 720  TGDGIVGRLEEELKQRDDILAKNQRVNRHLQAXXXXXXXXXXXXXXXXXXXXXXMLTILN 779
              +G+VG+LE +LKQRD+IL KNQRV + L++                      MLTILN
Sbjct: 738  AENGLVGQLESDLKQRDNILEKNQRVMKQLESELEDLKKKHLLEKHEHEVELRKMLTILN 797

Query: 780  ARPDDENLAKSTKVTKSVNGLDPDRQTSIQKALQDGLQRTRKDLSVDSKRFGITVQPNKR 839
            +R    N  ++  V      LDP+++  IQKAL+  L +T+KDLS DSKRFGITVQPNKR
Sbjct: 798  SR----NGTQNPDVDDVTITLDPNKKLDIQKALELELNKTKKDLSNDSKRFGITVQPNKR 853

Query: 840  LRMLRMKMEGIEQEARELEMTNFAEHEEKQLEEPVGTGT-----------------KKKA 882
            L+MLRM+ME IE EAR+LEMTNFA+H+   L++PV                     + + 
Sbjct: 854  LKMLRMQMEDIENEARQLEMTNFADHKRTNLKKPVIVKKEKKLRKKKKINTEEFDKENEM 913

Query: 883  GVRKLSELRKQLSDIQKETNEVTKFNVEERVKELFNQXXXXXXXXXXXXXTTYKGFGIDF 942
              +KL +LRK L+ IQ ETN+++KFNVE RV E+F                 YK F I F
Sbjct: 914  KTKKLMQLRKALAAIQSETNDISKFNVEGRVNEMFQDKKLKALQRLKQLEAKYKDFEIPF 973

Query: 943  NANALLESKGGDIHWNDDEIDGQDLQGAQEKMDEMDRIANELTAMKMKVEIQNQQQHXXX 1002
            +    L+        ++ +    D    Q+K++E+D I++EL  M    +  N       
Sbjct: 974  DE---LQDLDDRELDDEQQHSTLDPTYLQKKINELDEISDELYLMNYDSDANNGNTSDSS 1030

Query: 1003 XXXXXXXXXXXGATGSRTDTASEFSQK-SFG-SGAGSFLEALSQKYGAGQNTTISNSPFP 1060
                        A G  TD+    S   S G S AGSFLE+LSQKYG GQN   S +   
Sbjct: 1031 SSSE--------ADGDGTDSMRSVSNAPSKGISEAGSFLESLSQKYGTGQNAISSPTSIT 1082

Query: 1061 GV-DRKSSNHRTSFANRMKKSN-ATPYFDELTRKVAKAPSLND 1101
               +R +S    SF NR+K+   A P+ +ELT+KV    S++D
Sbjct: 1083 SPNERIASQGEKSFMNRLKRQTMAAPFLEELTQKVNDTSSIDD 1125

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/657 (57%), Positives = 477/657 (72%), Gaps = 33/657 (5%)

Query: 1236 GQKKMYRS--DMSNYLEETPTFRDNYPQPHKKLKQLHWEKLDATEDSIWSSGVAEKFAGD 1293
            G+K+ Y+S  D  + L+ T +  D  P+P KKLKQLHW+KLD+T+ SIWS G+AE+FA D
Sbjct: 1248 GKKEPYKSVVDQPSLLQLTNS--DRLPRPQKKLKQLHWDKLDSTDSSIWSKGMAERFADD 1305

Query: 1294 LYEKGVLAGLEKAFAAREIKNLATKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLV 1353
            LYEKGVL  LEKAFAAREIK++ T+KKEDL KI+FLSHD SQQFGINLHMY  ++V +L+
Sbjct: 1306 LYEKGVLRNLEKAFAAREIKSIGTRKKEDLSKISFLSHDISQQFGINLHMYGSLAVPELI 1365

Query: 1354 IKILKCDRDFMQTPSVIEFLSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPN 1413
             K+LKCDR+ + TPSVIEFL+KSEI EVSVNLARN++PY+TDW+G+KSL+  K       
Sbjct: 1366 EKVLKCDRNLINTPSVIEFLAKSEIVEVSVNLARNYAPYTTDWEGVKSLKMQK------- 1418

Query: 1414 DLQRADQI-YLQLI------FNLQAYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGA 1466
              QR  Q+ Y +LI       NLQ+YW SRMRA+KVITSY++EY ELVTKLRKVDKAVGA
Sbjct: 1419 -FQRRIQMTYRELIKFIYNMVNLQSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGA 1477

Query: 1467 ILKSENLSNIFNVILAVGNFMNDTAKRAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIR 1526
            + +SENL N+FNVILAVGN+MNDT+K+AQGFKLSTLQRLTFIKD  NSMTFLNYVEKI+R
Sbjct: 1478 VQRSENLKNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDATNSMTFLNYVEKIVR 1537

Query: 1527 GNYPSFNDFLKELEPVLNVTKISIDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLD 1586
             NYPSFNDF+ +LEPVL+V K+S++QL++DCNE+ Q++ NVERS+EIGNLSDSSKFHP D
Sbjct: 1538 DNYPSFNDFIDDLEPVLDVVKLSVEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSD 1597

Query: 1587 RVLIKVLPVLPEARKKCDLLDDEVRLSIMEFENLMQKYGEDTGXXXXXXXXXXXXXXXVQ 1646
            +VL KVLPVLPEA KK  LL DEV+L+IMEFE LM+KYGED G               + 
Sbjct: 1598 KVLTKVLPVLPEAAKKSSLLTDEVKLTIMEFEALMKKYGEDAGDKFAKNSFFKKFADFIT 1657

Query: 1647 EYKKAQNQNLKVEEEERVYERHKKMVEEQQRREQTPSKNRDYVVNXXXXXXXXXXXXXXX 1706
            EYKKAQ+QNLK EEEER YE+HK+M+EEQQ ++    +    V                 
Sbjct: 1658 EYKKAQSQNLKQEEEERAYEKHKRMIEEQQHKQDLEEERSREV----EGEPGEEQSDRRA 1713

Query: 1707 XXXKLLDQLKNAGPTTSDPSSARKRALMRRKLQADKDAAAHLISDLDSNEDSIVYSPNA- 1765
               KLL++LKNAGP  +DPSSARKRAL+R+KL  DK+  AH++ D+D+ +DSIVYSPN  
Sbjct: 1714 MMDKLLEKLKNAGPGKADPSSARKRALVRKKLLTDKEVTAHILQDIDTGDDSIVYSPNTP 1773

Query: 1766 SQDQSANAEEASPTVHKGSNKNNKPVLSDLESPIKASRNADRXXXXXXXXISDKAKNLLM 1825
            +Q+   +   ASPT    S+     VL+ + SP K S  AD         ISD+AK LL+
Sbjct: 1774 TQEGPNDIHLASPTPSGKSD----LVLASV-SPTKES-TAD--GIAEDEFISDRAKALLL 1825

Query: 1826 ELSGNGAPTRREELLNGHKERLRARRRRTQGHGELISSNKLAFLDDETPPVTPTDSE 1882
            EL G     +R   L   KE+L+ARR R +   E ISSNKL F D+E+   +P++S+
Sbjct: 1826 ELRG-SENMKRNSQLEEQKEKLKARRSRRRTQTESISSNKLFFTDEESHSTSPSESK 1881

 Score =  107 bits (267), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 61/136 (44%), Positives = 81/136 (59%), Gaps = 25/136 (18%)

Query: 95  SRTPSQQSTGSKYTYPKRTSSSITGGNPSLPSSSATPIPAPVTPGQLSRXXXXXXXXXXX 154
           +R  S QS  +KY+Y +R SS+ TG                  P +LSR           
Sbjct: 101 TRAHSSQS-ATKYSYSRR-SSTATG------------------PIKLSRQQTTQSLGSSS 140

Query: 155 XXXXXVLSQGSLTNLGRFMRPDGKVRLDMPQDYHEVESLFEDIMYKRNIMQTLPPEKQQE 214
                VLSQGS TNL +++  DGK+ L+MP+D HEVE+LFED+MYKRNI Q LP +KQ+E
Sbjct: 141 -----VLSQGSYTNLLKYIDSDGKINLEMPRDPHEVEALFEDLMYKRNIFQALPQDKQKE 195

Query: 215 LRNYDIDKKWLIVRQD 230
           L +YD+ KKW +V+QD
Sbjct: 196 LMSYDVTKKWTLVKQD 211

>TPHA0B04490 Chr2 (1052780..1058602) [5823 bp, 1940 aa] {ON} Anc_1.82
            YNL271C
          Length = 1940

 Score =  749 bits (1934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/677 (58%), Positives = 484/677 (71%), Gaps = 32/677 (4%)

Query: 1234 FAGQKKMYRS-DMSNYLEETPTFRDNYPQPHKKLKQLHWEKLDATEDSIWSSGVAEKFAG 1292
            F G  KMYRS D S  L E+P+    YP+P KKLKQLHW+KLD +E SIWSS +AE+FA 
Sbjct: 1237 FMGLNKMYRSGDGSQILNESPSLYSKYPRPQKKLKQLHWDKLDDSEGSIWSSAMAEQFAD 1296

Query: 1293 DLYEKGVLAGLEKAFAAREIKNLATKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDL 1352
            DLYEKGVL  LEKAFAAREIK+LA KKKEDL KI+FLS D SQQFGINLHM+  ++V++L
Sbjct: 1297 DLYEKGVLHNLEKAFAAREIKSLANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDEL 1356

Query: 1353 VIKILKCDRDFMQTPSVIEFLSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDP 1412
            VIKILKC+RD M TPSVIEFLSK EIT+VS+NLARN++PY TDW+G+K +EDAK PEK  
Sbjct: 1357 VIKILKCNRDVMNTPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSV 1416

Query: 1413 NDLQRADQIYLQLIFNLQAYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSEN 1472
            + LQRADQIY+QL+ NLQ+YW SRMRAIKVITSY+KEY ELVTKLR++D AV AI KS+N
Sbjct: 1417 DGLQRADQIYVQLMVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDN 1476

Query: 1473 LSNIFNVILAVGNFMNDTAKRAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRGNYPSF 1532
            L+N+FNVILAVGN+MND++K+AQGFKL+TLQRLTFIKD+ NSMTFLNYVEKIIR NYP F
Sbjct: 1477 LTNLFNVILAVGNYMNDSSKQAQGFKLNTLQRLTFIKDSTNSMTFLNYVEKIIRENYPEF 1536

Query: 1533 NDFLKELEPVLNVTKISIDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKV 1592
            N F++ELEPVL+V KIS++QLVNDCNE+ Q++ NVERS+EIGNLSDSSKFHPLD+V+ KV
Sbjct: 1537 NGFIEELEPVLDVVKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKV 1596

Query: 1593 LPVLPEARKKCDLLDDEVRLSIMEFENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQ 1652
            LPVLPEA KK DLL DEV+L+ MEFE LMQK+GED+G               + EYKKA+
Sbjct: 1597 LPVLPEATKKSDLLTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKAR 1656

Query: 1653 NQNLKVEEEERVYERHKKMVEEQQRREQTPSKNRDYV-VNXXXXXXXXXXXXXXXXXXKL 1711
             QNLK EEE R YERHK+MVEEQQR+ +   KN  Y+                     KL
Sbjct: 1657 AQNLKAEEEVRKYERHKQMVEEQQRKAKEQEKN--YMETGVSDSESAEAKGDNRGHMDKL 1714

Query: 1712 LDQLKNAGPTTSDPSSARKRALMRRKLQADKDAAAHLISDLDSNEDSIVYSPNASQ--DQ 1769
            L QLKNAGP  SDPSSARKRA+MR+KL ++KD+ + ++ DL++ + SI+YSP   +  D 
Sbjct: 1715 LAQLKNAGPARSDPSSARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYSPTTDKVVDT 1774

Query: 1770 SANAEEA---SPTVHKGSN----------KNNKPVLSDLESPIKASRNAD------RXXX 1810
            S   +E    SPT     N          +N+   + D+E     +   D          
Sbjct: 1775 SLGEDEMILKSPTPKSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAETDITDDGNSNGD 1834

Query: 1811 XXXXXISDKAKNLLMELSGNGAPTRREELLNGHKERL-RARRRRTQGHGE---LISSNKL 1866
                 I+D+AK LLMEL G+  P+++   L+  +E+L   R RR Q  GE      SN+L
Sbjct: 1835 GEDEVITDRAKALLMELRGSQTPSKKNSHLDDQREKLRSRRNRRRQTFGEESNSTPSNRL 1894

Query: 1867 AFLDDETPPVTPTDSEF 1883
             F+ DE    +PT +EF
Sbjct: 1895 TFVSDEN---SPTATEF 1908

 Score =  694 bits (1792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/824 (45%), Positives = 514/824 (62%), Gaps = 62/824 (7%)

Query: 304  TEKINRPPTYYVKKIIADDLTIDELNDLWVTLRTEQLDWVDAFLEHQGHIAMANVLMKSL 363
            ++K N  P +YV+KI++D L+ +ELNDLWVTLRTEQLDWVDAFLEHQGHIA+AN L++ +
Sbjct: 327  SDKTNIAPIHYVRKILSDTLSKNELNDLWVTLRTEQLDWVDAFLEHQGHIAIANNLIRCI 386

Query: 364  YKTTQEVKLTEKSLEREASYFKCFRVLVMLAQGLYEFTKHAIMAETVAYALFSIRLPTRK 423
            YKT     L+++ +E+E  +FKCFRVL ML QGLYEFTKH +M +T+A+ LFS R+ TRK
Sbjct: 387  YKTAPGSNLSDELIEKEYGFFKCFRVLAMLDQGLYEFTKHKLMMDTLAFGLFSTRVSTRK 446

Query: 424  MATEIFVCMLEKKNKSRFDVILTALDKKFMIGENLHMMQFVKNSPQQFIHLKRDSQFKIV 483
            MA EI V ++ KKN  RF+ ++ +LD+ F + ENL+M++ +      F     D+QFKI 
Sbjct: 447  MALEILVYIINKKNTQRFESVIMSLDRFFRLSENLNMLKIITQFGGAFSRTSPDTQFKIF 506

Query: 484  QAWLTGLETALQGRGKMGSLVGASEEVRAAGGENSILEYSQWTMVFINHLCMGTDVVNQR 543
            QA++  LE+ L GRGKMGS VGAS++ + +GGEN+ILEY  W ++FIN LC  +D +NQR
Sbjct: 507  QAFVISLESTLNGRGKMGSKVGASDDFKVSGGENAILEYCLWALIFINKLCNFSDELNQR 566

Query: 544  VLLRTRLENAGALRIMNRFKLLDYDKITAQIEYYENGKLDDINNLLESEGRNTQVNMQDP 603
            V+LRT+ EN G LR+M + KL+DY+K+T Q+E YE+ KLDD N+LLE +  + Q+NMQDP
Sbjct: 567  VVLRTKFENLGGLRVMTKLKLMDYEKMTVQVENYEDHKLDDFNSLLEMKSSSAQINMQDP 626

Query: 604  MMMLQTMWDYCKGTENEKTFISLIKHLFLSSSKVADDRGDPSKLAKQLKLMDSLXXXXXX 663
              ++ ++W+ CKGTENEK  +SL++HLFLSSSK+ DD+ +P+KL+KQLKLMDSL      
Sbjct: 627  TSLIGSLWEVCKGTENEKLLLSLMQHLFLSSSKLVDDKREPAKLSKQLKLMDSLMTNITA 686

Query: 664  XXXXXXXXXXXXIQRLYDAMQTDEVARRAILESRQLTKELEEIQAERDFLRQKLNSTGDG 723
                        IQRLYD+MQTD+VARRAILE+R L+K+LEE+ AE+++L++KL+   +G
Sbjct: 687  SEVDEQTHMNLAIQRLYDSMQTDDVARRAILETRTLSKKLEEVTAEKEYLKEKLSKAENG 746

Query: 724  IVGRLEEELKQRDDILAKNQRVNRHLQAXXXXXXXXXXXXXXXXXXXXXXMLTILNARPD 783
            +VG+LE EL+QRD+IL K+QRV + LQA                      +LTI+N   D
Sbjct: 747  LVGQLELELEQRDNILTKSQRVTKQLQAELEDLKKKHLLEKHEHEVELRKILTIVNTNTD 806

Query: 784  -DENLAKSTKVTKSVNGLDPDRQTSIQKALQDGLQRTRKDLSVDSKRFGITVQPNKRLRM 842
             D +L  S+           D++ +IQKAL+  L RT+KDL+ D K+FGI+VQPNKRLRM
Sbjct: 807  ADASLNNSS-----------DKKHNIQKALETELSRTKKDLNNDVKKFGISVQPNKRLRM 855

Query: 843  LRMKMEGIEQEARELEMTNFAEHEEKQLEEPV-----------------------GTGTK 879
            LR++ME IE+EARELEMTNF+EH++  LE P                            +
Sbjct: 856  LRLQMEDIEKEARELEMTNFSEHQKLSLESPAVLNKTKKETKKKSKKKSKSSKSKEENNR 915

Query: 880  KKAGV---RKLSELRKQLSDIQKETNEVTKFNVEERVKELFNQXXXXXXXXXXXXXTTYK 936
            K+A     +KL ELR+ L+ IQ ETN+V+KFNV++RV ELF +               YK
Sbjct: 916  KRANAIKKQKLLELRRDLAMIQAETNDVSKFNVDKRVNELFKEKKHEALNRLQMLEKKYK 975

Query: 937  GFGIDFNAN----ALLESKGGDIHWNDDEIDGQDLQGAQEKMDEMDRIANELTAMKMKVE 992
             F IDF+ N    A L+S            +  D     +K+ ++DRIA+EL A      
Sbjct: 976  SFEIDFDPNDFKQAQLDSNAS--------YESLDPNFVTKKITDIDRIADELDAFSGDGT 1027

Query: 993  IQNQQQHXXXXXXXXXXXXXXGATGSRTDTASEFSQKSFGSGAGSFLEALSQKYGAGQNT 1052
                                    G          QK    G+ SFLE+LS+KYG  QNT
Sbjct: 1028 SSYSSSSLSDSEKNYYESNAVPTIG---------PQKGLIDGS-SFLESLSEKYGTAQNT 1077

Query: 1053 T-ISNSPFPGVDRKSSNHRTSFANRMK-KSNATPYFDELTRKVA 1094
               S SP    +R +S    SF NR K K ++  + +EL++KV 
Sbjct: 1078 EGTSLSPLSPQNRIASLGEKSFMNRFKRKPSSMQFLEELSQKVG 1121

 Score =  103 bits (257), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 57/71 (80%)

Query: 160 VLSQGSLTNLGRFMRPDGKVRLDMPQDYHEVESLFEDIMYKRNIMQTLPPEKQQELRNYD 219
           V SQGS  NL ++M  +G++ LDMP D HE+ESLFE++MYKRNI+Q L P+KQ+++ NYD
Sbjct: 164 VFSQGSYANLSKYMDSNGRLNLDMPTDTHEIESLFEELMYKRNILQALSPDKQRDIMNYD 223

Query: 220 IDKKWLIVRQD 230
             KKW+IV+QD
Sbjct: 224 TKKKWMIVKQD 234

>TBLA0A05440 Chr1 complement(1337261..1343773) [6513 bp, 2170 aa] {ON}
            Anc_1.82 YNL271C
          Length = 2170

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/646 (57%), Positives = 469/646 (72%), Gaps = 23/646 (3%)

Query: 1237 QKKMYRSDMSNYLEETPTFRDNYPQPHKKLKQLHWEKLDATEDSIWSSGVAEKFAGDLYE 1296
            +K MYR+D +     +P F + YP+  KKLKQLHWEKLD T++SIW +G AE+FA DL+E
Sbjct: 1417 EKSMYRTDSAPDFSTSPNFFEKYPRSQKKLKQLHWEKLDDTDNSIWVNGKAEEFADDLFE 1476

Query: 1297 KGVLAGLEKAFAAREIKNLATKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKI 1356
            KGVL  LE AFAAREIK+LA+KKKED  KIT+LS D SQQFGINLHM+S+++V+ L+ KI
Sbjct: 1477 KGVLKRLESAFAAREIKSLASKKKEDSTKITYLSRDISQQFGINLHMFSNLTVDQLIEKI 1536

Query: 1357 LKCDRDFMQTPSVIEFLSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQ 1416
            ++CDR  + TPSVI+FLSK EI EVSVNLAR+++PYSTDW+G+K ++DAKPPEKDPN+LQ
Sbjct: 1537 IRCDRSILNTPSVIDFLSKQEIVEVSVNLARSYAPYSTDWEGVKDVKDAKPPEKDPNELQ 1596

Query: 1417 RADQIYLQLIFNLQAYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNI 1476
            RADQIYLQL+ NLQ+YWGSRM A+KV+TSY+K++ EL+ KLR+VD AVG+I KSENL N+
Sbjct: 1597 RADQIYLQLMVNLQSYWGSRMIALKVVTSYEKDFDELIRKLRRVDLAVGSIQKSENLKNV 1656

Query: 1477 FNVILAVGNFMNDTAKRAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRGNYPSFNDFL 1536
            FNVILAVGNFMND +K+AQGFKL+TLQRLTFIKD+ N+MTFLNYVE IIR NYP FNDFL
Sbjct: 1657 FNVILAVGNFMNDASKQAQGFKLATLQRLTFIKDSTNNMTFLNYVESIIRQNYPEFNDFL 1716

Query: 1537 KELEPVLNVTKISIDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVL 1596
             EL+PVL+V K+SI+QLV DC E+ Q + NV RS+EIG LSDSSKFHP D+VLIKVLPVL
Sbjct: 1717 NELQPVLDVVKVSIEQLVRDCKEFSQGIINVGRSVEIGKLSDSSKFHPQDKVLIKVLPVL 1776

Query: 1597 PEARKKCDLLDDEVRLSIMEFENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQNL 1656
            PEA KK DLL DEV+LSIMEFENLMQ +GED+                + EYK+AQ QNL
Sbjct: 1777 PEATKKADLLSDEVKLSIMEFENLMQVFGEDSKDKFAKNSFFKKFADFINEYKRAQEQNL 1836

Query: 1657 KVEEEERVYERHKKMVEEQQRR-EQTPSKNRDYVVNXXXXXXXXXXXXXXXXXXKLLDQL 1715
            KVEEEER+YE HKK +EEQQ+R E +  K+     +                  KLL+QL
Sbjct: 1837 KVEEEERIYENHKKRIEEQQKRLEDSKKKSHSDDTSNTDGTEEEEDEDRRDVMDKLLEQL 1896

Query: 1716 KNAGPTTSDPSSARKRALMRRKLQADKDAAAHLISDLDSNEDSIVYSPNASQ---DQSAN 1772
            KN GP  +DP+SARKRA++R+KLQ +K+ A+ ++ + ++ EDSIVYSP  S+    + +N
Sbjct: 1897 KNVGPVKTDPTSARKRAMVRKKLQNEKETASQILKEFETGEDSIVYSPTDSKITPKKVSN 1956

Query: 1773 AEEASPTVHKGSNKNNKPVLSDLESPIKASRNA---------DRXXXXXXXXISDKAKNL 1823
                SPT  + S+      L+D+ S    +            D         I D+AK+L
Sbjct: 1957 EYLQSPTPGEKSS------LADMTSTPNPTTITTTTDGKVTNDSSNDDLDQEIVDRAKSL 2010

Query: 1824 LMELSGNGAPTRREELLNGHKERLRARRRRTQGHGELISSNKLAFL 1869
            L EL G+  PTR+  +L   KE+LRARRR T      ++SNKL F+
Sbjct: 2011 LFELRGSQTPTRKNSVLEERKEKLRARRRNTSD----LTSNKLKFV 2052

 Score =  707 bits (1824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/858 (45%), Positives = 532/858 (62%), Gaps = 61/858 (7%)

Query: 300  TTVNTEKINRPPTYYVKKIIADDLTIDELNDLWVTLRTEQLDWVDAFLEHQGHIAMANVL 359
            + ++ ++ NR P  Y+K+I+ D L++DE+NDLWVTLRTEQL WV+ FLE QGHIAMAN L
Sbjct: 411  SALSPDRTNRLPNDYIKEILNDRLSVDEMNDLWVTLRTEQLTWVNTFLEDQGHIAMANSL 470

Query: 360  MKSLYK-TTQEVKLTEKSLEREASYFKCFRVLVMLAQGLYEFTKHAIMAETVAYALFSIR 418
            MKS+Y+  T +  L+   +++E ++FKCFRVL ML+QGL EF KH +M +T+   LFS R
Sbjct: 471  MKSIYRINTMQNSLSTYLIDKEYNFFKCFRVLSMLSQGLTEFIKHKLMTDTLVQGLFSTR 530

Query: 419  LPTRKMATEIFVCMLEKKNKSRFDVILTALDKKFMIGENLHMMQFVKNSPQQFIHLK--R 476
            L TRK+ATEIFV ML+K N    +++LT  DK F I ENL+M+  +KN P ++ +L    
Sbjct: 531  LATRKIATEIFVLMLQKINDDGLNILLTTFDKTFSINENLNMVYLLKNVPDKYHYLNSTN 590

Query: 477  DSQFKIVQAWLTGLETALQGRGKMGSLVGASEEVRAAGGENSILEYSQWTMVFINHLCMG 536
             +Q K++ +WL  +E+ L GRGKMGSLVGAS++ +  GGEN+ILEY QWTMV IN LC  
Sbjct: 591  TTQIKVLVSWLYAVESTLDGRGKMGSLVGASQDFKITGGENAILEYCQWTMVLINRLCNA 650

Query: 537  TDVVNQRVLLRTRLENAGALRIMNRFKLLDYDKITAQIEYYENGKLDDINNLLESEGRNT 596
            + ++NQRVLLRT+LEN G++RIMN+ K LDY+KIT Q+E YEN KLDD+N LLE + +++
Sbjct: 651  STIINQRVLLRTKLENIGSIRIMNKLKKLDYEKITEQLEDYENKKLDDLNTLLEQDTKSS 710

Query: 597  QVNMQDPMMMLQTMWDYCKGTENEKTFISLIKHLFLSSSKVADDRGDPSKLAKQLKLMDS 656
             V++ +P+ +L  + + CK TE E++  S+I+HL+LSSSK+ DD+ DP+KL+KQLKLMDS
Sbjct: 711  -VDLDNPISLLSHLLEVCKDTEGEQSLTSIIQHLYLSSSKLFDDKDDPTKLSKQLKLMDS 769

Query: 657  LXXXXXXXXXXXXXXXXXXIQRLYDAMQTDEVARRAILESRQLTKELEEIQAERDFLRQK 716
            L                  IQ LYD+M TD+VARRAILESR LTK+LEE+QAERDFL  +
Sbjct: 770  LMTDATLSTVDNESKMNMAIQHLYDSMVTDDVARRAILESRNLTKKLEEVQAERDFLSNR 829

Query: 717  LNSTGDGIVGRLEEELKQRDDILAKNQRVNRHLQAXXXXXXXXXXXXXXXXXXXXXXMLT 776
            L+   +G+VG+LE EL QRD ILAKNQRV + L+                       MLT
Sbjct: 830  LSEAENGLVGKLENELAQRDSILAKNQRVTQQLRTELDELKKKHLMEKHDHEVELRKMLT 889

Query: 777  ILNARPDDE------NLAKSTKVTKSVNGLDP-DRQTSIQKALQDGLQRTRKDLSVDSKR 829
            ILN+RP+ E      +++++ +    +  L+   R+  I+KALQDGLQ+T+KDLS+DSKR
Sbjct: 890  ILNSRPETELDNTMSSISRTKRNKHEIEKLELLKRKKVIEKALQDGLQKTKKDLSLDSKR 949

Query: 830  FGITVQPNKRLRMLRMKMEGIEQEARELEMTNFAE-----------------HEEKQLEE 872
            FGITVQPNKRL+ LR++ME IE EAR+LEMTNF +                 H   +   
Sbjct: 950  FGITVQPNKRLQALRLQMEDIENEARQLEMTNFTDPVRTPKKGQEKRDSHNKHPSLKPGI 1009

Query: 873  PVGTGTKKKA-----GVRKLSELRKQLSDIQKETNEVTKFNVEERVKELFNQXXXXXXXX 927
            P+    K ++       +KL+ELRK L+DIQ+ETN++++FNVEE V ELFN         
Sbjct: 1010 PIAKKNKDRSEEMAKKQQKLAELRKALADIQQETNDISRFNVEEHVNELFNAKKIQAMER 1069

Query: 928  XXXXXTTYKGFGIDFNANALLESKGGDIHWNDDE---IDGQDLQGAQEKMDEMDRIA--- 981
                 T Y+ FG+DFN    LE         D +    +  D     +KMDE+D+ +   
Sbjct: 1070 LKELETMYQNFGVDFNMEEFLEKNNTSTKELDPDSPAYETLDPNLFIDKMDELDKFSMKL 1129

Query: 982  --------NELTAMKMKVEIQNQQQ------HXXXXXXXXXXXXXXGATGSRTDTASEFS 1027
                    N ++A +  +   N  Q                       + +  D +S FS
Sbjct: 1130 DQLTSDLNNTMSAKQNSLSTTNSNQISTPSSTSSSDFESDEENENTALSNNVNDNSSTFS 1189

Query: 1028 QKSFGSGAGSFLEALSQKYGAGQNTT---ISNSPFPGVDRKSSNHRTSFANRMKKSNATP 1084
             +S  SG  SFLE+LSQKYG GQN +    SN+P    +    N    F +RMKK +ATP
Sbjct: 1190 HQSTTSGGSSFLESLSQKYGTGQNASGPMSSNTP----NVSHYNPERKFMSRMKKQHATP 1245

Query: 1085 -YFDELTRKVAKAPSLND 1101
             Y  EL +KV+   SL++
Sbjct: 1246 NYIRELNQKVSVTHSLSE 1263

 Score =  109 bits (273), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 48/71 (67%), Positives = 60/71 (84%)

Query: 160 VLSQGSLTNLGRFMRPDGKVRLDMPQDYHEVESLFEDIMYKRNIMQTLPPEKQQELRNYD 219
           +LSQGSL NL +FM PDGKV L+MP +  EVE+L+EDIMYKRNI+Q LP +KQ+EL +YD
Sbjct: 186 ILSQGSLHNLMKFMTPDGKVNLEMPNNPAEVEALYEDIMYKRNILQNLPADKQRELMSYD 245

Query: 220 IDKKWLIVRQD 230
           + KKWLIV+QD
Sbjct: 246 VSKKWLIVKQD 256

>KNAG0F00470 Chr6 complement(66506..72592) [6087 bp, 2028 aa] {ON} 
          Length = 2028

 Score =  731 bits (1888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/838 (46%), Positives = 539/838 (64%), Gaps = 51/838 (6%)

Query: 300  TTVNTEKINRPPTYYVKKIIADDLTIDELNDLWVTLRTEQLDWVDAFLEHQGHIAMANVL 359
            +T+ ++K NR P +YVKKIIAD L+ DELNDLWVTLRTEQLDWVDAFL++QGHIAMANVL
Sbjct: 407  STLASDKTNRLPIHYVKKIIADQLSQDELNDLWVTLRTEQLDWVDAFLDNQGHIAMANVL 466

Query: 360  MKSLYKTTQEVKLTEKSLEREASYFKCFRVLVMLAQGLYEFTKHAIMAETVAYALFSIRL 419
            MKSLYKT+  V L+   L++E SYFKCF+VL MLAQGL EFT H ++ +T+A  LFS RL
Sbjct: 467  MKSLYKTSPNVSLSGPLLDKEQSYFKCFKVLSMLAQGLREFTDHRLITDTIARGLFSSRL 526

Query: 420  PTRKMATEIFVCMLEKKNKSRFDVILTALDKKFMIGENLHMMQFVKNSPQQFIHLKRDSQ 479
            PTRKMATEIFVCMLE KN++RFD ++T+LD+ F IG N HM+  ++  P  FIHL   S 
Sbjct: 527  PTRKMATEIFVCMLETKNQTRFDAVITSLDQNFQIGSNAHMVNNLQKMPDYFIHLNLQST 586

Query: 480  FKIVQAWLTGLETALQGRGKMGSLVGASEEVRAAGGENSILEYSQWTMVFINHLCMGTDV 539
             K+VQAWL  ++  L GRGKMGSLVGAS+E +   GENS+LEY QWT+VF+N  C  ++ 
Sbjct: 587  LKVVQAWLFAIDQTLDGRGKMGSLVGASDEFKRIDGENSVLEYCQWTLVFVNKFCQSSNN 646

Query: 540  VNQRVLLRTRLENAGALRIMNRFKLLDYDKITAQIEYYENGKLDDINNLLESEGRNTQVN 599
            +NQR+LLRT+LENAG LRIMN+ KLLDY+KI  QIE+YE GKLDD N+LLES+ ++  ++
Sbjct: 647  LNQRMLLRTKLENAGFLRIMNKMKLLDYEKIRDQIEFYEAGKLDDFNSLLESQNKHANID 706

Query: 600  MQDPMMMLQTMWDYCKGTENEKTFISLIKHLFLSSSKVADDRGDPSKLAKQLKLMDSLXX 659
            MQ+P+ +LQ +WD C+GT++E   +SL++HLFLSS+++  +  DP++LAKQLKL+DSL  
Sbjct: 707  MQNPLSLLQNLWDACRGTDSENLLVSLVQHLFLSSTRLIQNNKDPTQLAKQLKLIDSLVT 766

Query: 660  ---XXXXXXXXXXXXXXXXIQRLYDAMQTDEVARRAILESRQLTKELEEIQAERDFLRQK 716
                               IQRL+D+MQTDEVARRAI+ESR LTK++EE+QAE+D L  K
Sbjct: 767  NVGSSVSAVADEETTMSMTIQRLFDSMQTDEVARRAIIESRTLTKKMEELQAEKDRLGDK 826

Query: 717  LNSTGDGIVGRLEEELKQRDDILAKNQRVNRHLQAXXXXXXXXXXXXXXXXXXXXXXMLT 776
            L+    G+VG L+ ++++RD ILAKNQRVN+ L+                       MLT
Sbjct: 827  LSKAEGGLVGELQRDIRERDAILAKNQRVNKQLENELEELKRKTLMEKHEHEVELRKMLT 886

Query: 777  ILNARPDDENLAK--STKVTKSVN-----GLDPDRQTSIQKALQDGLQRTRKDLSVDSKR 829
            I+N++    NLA+  S  V KS +      L  ++Q+ IQK LQDGL RT+KD + D+K+
Sbjct: 887  IINSKA-SPNLAQNPSASVLKSHDPKNKESLLSEQQSKIQKVLQDGLTRTKKDFTNDAKK 945

Query: 830  FGITVQPNKRLRMLRMKMEGIEQEARELEMTNFAEHEEKQLEEPV--------------- 874
            FG+TVQPNKRL++LRMK+E IE EAR+LEMTNFA+ E+     PV               
Sbjct: 946  FGMTVQPNKRLQLLRMKVEDIENEARQLEMTNFADIEKN--ATPVILTKGTKKKKSKKKL 1003

Query: 875  ---GTGTKKKAGVRK-------LSELRKQLSDIQKETNEVTKFNVEERVKELFNQXXXXX 924
                   K++A  R        L++LR  L+ IQ E+N+++KFNVEE V ELF +     
Sbjct: 1004 KTAQPDKKQRANQRNENQKIEALNKLRMALTAIQSESNDISKFNVEEHVNELFTERKFKA 1063

Query: 925  XXXXXXXXTTYKGFGIDFNANALLESKGGDIHWNDDEIDGQDLQGAQEKMDEMDRIANEL 984
                    + + G   +FN + ++ S    +   DD     D + A  K+DE++R+ N+L
Sbjct: 1064 LQRLRDLESKFNGLNTNFNIDDIIASTEKALTATDDGY-SLDPRRADNKLDEIERLTNDL 1122

Query: 985  TAMKMKVEIQNQQQHXXXXXXXXXXXXXXGATGSRTDTASEFSQKSFGSGAGSFLEALSQ 1044
            + +   ++ Q Q                  +    +   S+ S+ + GS  GSFL +LSQ
Sbjct: 1123 SKLHDSMKEQEQATLQSDNSSESSDSESVESDNEGSTVQSDVSEPTVGS--GSFLASLSQ 1180

Query: 1045 KYGAGQNTTISNSPFPGVDRKSSNHRTSFANRMKKSNATP-YFDELTRKVAKAPSLND 1101
            KY  GQ     NSP   V++K      +F  R+K+S+  P Y  EL++K+ + P+ ++
Sbjct: 1181 KYETGQKQ--PNSPV-TVNQK------AFMTRLKRSSGAPLYLQELSKKIPQRPAFDE 1229

 Score =  711 bits (1835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/625 (59%), Positives = 462/625 (73%), Gaps = 20/625 (3%)

Query: 1257 DNYPQPHKKLKQLHWEKLDATEDSIWSSGVAEKFAGDLYEKGVLAGLEKAFAAREIKNLA 1316
            + YP+P KKLKQLHWEKLD+T +SIWS+  AEKFA DLYEKGVL+ LEKAFAARE+K+L+
Sbjct: 1374 EKYPRPQKKLKQLHWEKLDSTNNSIWSASKAEKFADDLYEKGVLSNLEKAFAAREVKSLS 1433

Query: 1317 TKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQTPSVIEFLSKS 1376
            +KK +D  KITFL+ D SQQFGINLHM+ ++SV +LV KILKCDR+ + +PSVIEFLSK 
Sbjct: 1434 SKKGDD-SKITFLTRDVSQQFGINLHMFGNLSVEELVTKILKCDREVLNSPSVIEFLSKQ 1492

Query: 1377 EITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQLIFNLQAYWGSR 1436
            E+ EVSVNLARN+SPYSTDW+G+K +EDAK PEKDPN+LQRADQ+Y+ L+ NLQ YW SR
Sbjct: 1493 EVVEVSVNLARNYSPYSTDWEGVKRIEDAKAPEKDPNELQRADQLYMSLMVNLQPYWSSR 1552

Query: 1437 MRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGNFMNDTAKRAQG 1496
            MRA+KVIT+Y++EY EL+ KLRKVDKAVG++ +SENL N+ NVILAVGN+MNDT+K+AQG
Sbjct: 1553 MRALKVITTYEREYAELLEKLRKVDKAVGSLQQSENLKNVLNVILAVGNYMNDTSKQAQG 1612

Query: 1497 FKLSTLQRLTFIKDTNNSMTFLNYVEKIIRGNYPSFNDFLKELEPVLNVTKISIDQLVND 1556
            FKL+TLQRLTFIKDT NSMTFLNYVEKI+R NYP+FNDFL EL+PVL+V KISIDQLV+D
Sbjct: 1613 FKLATLQRLTFIKDTTNSMTFLNYVEKIVRKNYPTFNDFLNELQPVLDVVKISIDQLVSD 1672

Query: 1557 CNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDLLDDEVRLSIME 1616
            C E+  +V NVERSIEIGNLSDSSKFHP DRVL+KVLPVLPEARKK DLL DEV+L+++E
Sbjct: 1673 CQEFSGSVVNVERSIEIGNLSDSSKFHPSDRVLVKVLPVLPEARKKADLLTDEVKLTMLE 1732

Query: 1617 FENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQNLKVEEEERVYERHKKMVEEQQ 1676
            F NLMQ YGED+                +QEYKKAQ QN+  EEEE+ YERHKK+VEEQQ
Sbjct: 1733 FNNLMQTYGEDSADKFAKNSFFKKFADFIQEYKKAQVQNVAAEEEEQQYERHKKIVEEQQ 1792

Query: 1677 R-----REQTPSKNRDYVVNXXXXXXXXXXXXXXXXXXKLLDQLKNAGPTTSDPSSARKR 1731
            R     R++  S + D                      KLL+QLKNAG   +DPSSARKR
Sbjct: 1793 RQGEEARKRLESASPDATNGEDTTAVDDETKDRRAIMDKLLEQLKNAGTVKADPSSARKR 1852

Query: 1732 ALMRRKLQADKDAAAHLISDLDSNEDSIVYSPNASQDQSANAEEASPTVHKGSNKNNKPV 1791
            AL RRKL  DKDAA+ L+ D+D+++DS+VYSP+  +    +    SPT   G        
Sbjct: 1853 ALARRKLLGDKDAASALLHDIDTDDDSLVYSPDTKRQSVGHLIGGSPT--PGDKLLGSTP 1910

Query: 1792 LSDLESPIKASRNADRXXXXXXXXISDKAKNLLMEL-SGNGAPTRREELLNGHKERLRAR 1850
              +L SP     + D         ++D+AK LLMEL  G  +P ++   L+  +ER+R+R
Sbjct: 1911 TKELSSPTAGQDDED---------VTDRAKALLMELRGGQSSPMKKNAFLDEQRERIRSR 1961

Query: 1851 RRRTQ--GHGELISSNKLAFLDDET 1873
            RRR +  G   L   NKL+F + ET
Sbjct: 1962 RRRNELAGTEPLRGGNKLSFFEAET 1986

 Score = 99.8 bits (247), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 48/73 (65%), Positives = 58/73 (79%), Gaps = 2/73 (2%)

Query: 160 VLSQGSLTNL-GRFMRP-DGKVRLDMPQDYHEVESLFEDIMYKRNIMQTLPPEKQQELRN 217
           + SQGSL+ L  RF+ P DGK+RL+MP D  EVE L+EDIMYKRNI+Q LP +KQ EL N
Sbjct: 229 IASQGSLSTLYNRFISPEDGKLRLEMPDDPAEVELLYEDIMYKRNILQNLPTDKQLELMN 288

Query: 218 YDIDKKWLIVRQD 230
           YD+ KKWLIV+QD
Sbjct: 289 YDVKKKWLIVKQD 301

>Kwal_33.13392 s33 complement(199821..205727) [5907 bp, 1968 aa] {ON}
            YNL271C (BNI1) - contains formin homology domains;
            homologous to BNR1 (BNI1 related protein) [contig 118]
            FULL
          Length = 1968

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/640 (55%), Positives = 455/640 (71%), Gaps = 26/640 (4%)

Query: 1246 SNYLEETPTFRDNYPQPHKKLKQLHWEKLDATEDSIWSSGVAEKFAGDLYEKGVLAGLEK 1305
            S  L ++P+  + YP+P KKLKQLHWEK+D  EDSIW +  AE+FA DLYEKG+L+ LEK
Sbjct: 1305 SPMLPQSPSLFERYPRPTKKLKQLHWEKIDDAEDSIWKNAKAEQFADDLYEKGILSRLEK 1364

Query: 1306 AFAAREIKNLATKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQ 1365
            AFAAREIK+L ++KK+D  K+TFLS D SQQFGINLHMYS +SV ++V KILKCD+DF+ 
Sbjct: 1365 AFAAREIKSLTSRKKKDSDKLTFLSRDVSQQFGINLHMYSSLSVEEVVTKILKCDKDFLT 1424

Query: 1366 TPSVIEFLSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQL 1425
            TPSVIEFLSK EI EVS NLARNF+PY+TDW+GI +++DAKPPEKDP++LQRAD++YL+L
Sbjct: 1425 TPSVIEFLSKQEIVEVSNNLARNFAPYTTDWEGITNVKDAKPPEKDPSELQRADRLYLEL 1484

Query: 1426 IFNLQAYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGN 1485
              NLQ YW SRMRA+KVITSY+KEY +L+ KLR +DKA  AI +SENL N+ +VILAVGN
Sbjct: 1485 FVNLQGYWSSRMRALKVITSYEKEYSDLIHKLRMIDKATCAIQQSENLRNVLDVILAVGN 1544

Query: 1486 FMNDTAKRAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRGNYPSFNDFLKELEPVLNV 1545
            FMND++K+AQGF+L+TLQRLTFIKD  NSMTFLNYVEKI+R  YP FN FLKELEPV+  
Sbjct: 1545 FMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIVRETYPEFNVFLKELEPVVAA 1604

Query: 1546 TKISIDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDL 1605
             KISI+Q+  DC E+ Q+V NVERS++IGNLSDSSKFHPLDR L+KVLPVLPEARKK DL
Sbjct: 1605 VKISIEQVSQDCKEFSQSVINVERSVDIGNLSDSSKFHPLDRTLLKVLPVLPEARKKGDL 1664

Query: 1606 LDDEVRLSIMEFENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQNLKVEEEERVY 1665
            L DE++L+++EF+NLM+ +GED                 +QEYKKAQ  N+K+EEEE+ Y
Sbjct: 1665 LMDEMKLTLLEFDNLMKMFGEDAMDKFSRNSFFKKFADFLQEYKKAQTYNMKLEEEEKAY 1724

Query: 1666 ERHKKMVEEQQRREQTPSKNRDYVVNXXXXXXXXXXXXXXXXXXKLLDQLKNAGPTTSDP 1725
            ER KKMVEEQQRR +  ++  + V                    +LL++LKNAGP  SDP
Sbjct: 1725 ERRKKMVEEQQRRARESNEQENSV--DGNADDNTAASGDRDVMDRLLEKLKNAGPGKSDP 1782

Query: 1726 SSARKRALMRRKLQADKDAAAHLISDLDSNE---DSIVYSPNASQDQSANAEEASPT--V 1780
            SSARKRA+ RRKL     + + ++ + +  +    S+VYSP   Q   +N+ + SPT  V
Sbjct: 1783 SSARKRAIARRKLLQGSSSNSTILDNFEIEKPEGKSLVYSP--EQVTLSNSVDHSPTPDV 1840

Query: 1781 HKGSNKNNKPVLSDLESPIKASRNADRXXXXXXXXISDKAKNLLMELSGNGAPTRREELL 1840
             K   ++         S ++ S ++D         ++D+A+NLL+EL G  +P+RR    
Sbjct: 1841 RKREGQSTA-------SEVQTSESSD---------LTDRARNLLIELRGPESPSRRASSK 1884

Query: 1841 NGHKERLRARRRRTQGHGELISSNKLAFLDDETPPVTPTD 1880
            +    +LRA RR+  G G   S N L F+  E   +  +D
Sbjct: 1885 DQRISKLRA-RRKNDGSGNSGSDNHLNFVGQEGAALPDSD 1923

 Score =  595 bits (1533), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 373/1051 (35%), Positives = 566/1051 (53%), Gaps = 116/1051 (11%)

Query: 105  SKYTYPKRTSS-SITGGNPSLPSSSATPIPAPVTPGQLSRXXXXXXXXXXXXXXXXVLSQ 163
            +KY+Y +R S  S  GG             AP T  +LSR                + SQ
Sbjct: 107  TKYSYSRRASQWSSNGGT------------APST--KLSRQQTNQSISSAS-----IFSQ 147

Query: 164  GSLTNLGRFMRPDGKVRLDMPQDYHEVESLFEDIMYKRNIMQTLPPEKQQELRNYDIDKK 223
            GS +NL +F+ PDG +RL+ P+D  E+E LFE+++YKRN+ Q+LPP  Q+EL NYD++KK
Sbjct: 148  GSFSNLSKFVGPDGSIRLEKPRDPREIEELFEEVLYKRNVYQSLPPSAQKELNNYDLEKK 207

Query: 224  WLIVRQDXXXXXXXXXXXXXXXXX-XXXXXXXXLSLTNTISSHDYSDATSIRHM-----K 277
            WL+VRQD                          L    + S+  ++  +SI        +
Sbjct: 208  WLMVRQDLQSEVKKFMNNKSVSKSPAAASTGISLIAPESPSTGHFASNSSINESLAGSSR 267

Query: 278  TXXXXXXXXXXXXXXXXXXXXXTTVNTEKINRPPTYYVKKIIADDLTIDELNDLWVTLRT 337
            +                     TT++ +  +  P YYV+KII ++++   LNDLWV+LRT
Sbjct: 268  SRAQNPGTSDQFYGSNNGTSSTTTLSQDPSHLSPDYYVRKIICNNISAKRLNDLWVSLRT 327

Query: 338  EQLDWVDAFLEHQGHIAMANVLMKSLYKTTQEVKLTEKSLEREASYFKCFRVLVMLAQGL 397
            EQLDWV  FLE QG +A+ANV++K+ Y+ + +  L ++ L++E +YFKC +  + L +G 
Sbjct: 328  EQLDWVVGFLEAQGQVAIANVILKTCYRESPDNLLGDEVLDKEFAYFKCLKTSLNLKEGA 387

Query: 398  YEFTKHAIMAETVAY-------ALFSIRLPTRKMATEIFVCMLEKKNKSRFDVILTALDK 450
             E    A+++ +           L S+R+ TR++A+E+ V + +      F  ++ ALD+
Sbjct: 388  DE----AVLSNSAKIIISAIIEGLLSLRVATRRIASELLVSLSQWALPHGFTHVMNALDQ 443

Query: 451  KFMIGENLHMM---------QFVKNSPQQFIHLKR--DSQFKIVQAWLTGLETALQGRGK 499
            +    +N+H+          + +KNS +  +      D   +  + W+  +E  L GRGK
Sbjct: 444  ESRFCDNVHLQARLLSQTSNKEIKNSLRSSLLADNNGDRIMRKFEQWMLVVEYTLDGRGK 503

Query: 500  MGSLVGASEEVRAAGGENSILEYSQWTMVFINHLCMGTDVVNQRVLLRTRLENAGALRIM 559
            MGSLVGASE+ R +GGEN+I+EY+  T++ +NHLC     V QR +LR RL+NAG  RI+
Sbjct: 504  MGSLVGASEDFRTSGGENAIMEYAYLTLLLVNHLCQTPVDVKQRTILRARLKNAGLPRIL 563

Query: 560  NRFKLLDYDKITAQIEYYENGKLDDINNLLESEGRNTQ-VNMQDPMMMLQTMWDYCKGTE 618
            N+ K L+Y+K+  Q+  +E+   DD + L  S+G N + +NMQDP+ M Q +WD CKGTE
Sbjct: 564  NKMKRLNYEKVDEQLAIFEDSTTDDFDTLY-SQGPNGELINMQDPVSMTQNLWDLCKGTE 622

Query: 619  NEKTFISLIKHLFLSSSKVAD-DRGDPSKLAKQLKLMDSLXXXXXXXXXXXXXXXXXXIQ 677
             E+  +SL+++L +S+ ++    + DP++  KQLKL+D+L                  IQ
Sbjct: 623  AEEHLMSLLQNLLISTGELGGTSKEDPAQRTKQLKLIDALVSNVSMASVDLQSSFNSAIQ 682

Query: 678  RLYDAMQTDEVARRAILESRQLTKELEEIQAERDFLRQKLNSTGDGIVGRLEEELKQRDD 737
            RLYDAMQTDE+ARRAILE+R   K  EEI+AER+ L++KL++   G+VG+L+EELKQRD 
Sbjct: 683  RLYDAMQTDEIARRAILENRDWVKRYEEIKAERNNLKEKLSNAEGGLVGQLQEELKQRDH 742

Query: 738  ILAKNQRVNRHLQAXXXXXXXXXXXXXXXXXXXXXXMLTILNARPDDENLAKSTKVTKSV 797
            IL K+QRV   LQ                        LT LN++  D  L +     K  
Sbjct: 743  ILEKSQRVTAQLQHELDESKKKLILAKHQHEVELRKTLTALNSKGGDIQLTEDGGQPKP- 801

Query: 798  NGLDPDRQTSIQKALQDGLQRTRKDLSVDSKRFGITVQPNKRLRMLRMKMEGIEQEAREL 857
              L P+R  +IQ+ALQ  L++T K+++V+S R G++++PNKRLR+LR +ME IE +AREL
Sbjct: 802  --LKPERMLAIQRALQIKLEKTSKEITVESSRLGVSLEPNKRLRLLRSRMEEIENQAREL 859

Query: 858  EMTNFAEHEE---KQLE----------EPVGTGTKKKAGVRKLSELRKQLSDIQKETNEV 904
            EMTNF+E+ E   K++E            V  GT + + + KL +LR++L+ +Q E+N++
Sbjct: 860  EMTNFSEYREDADKEIEMAHEGTHMYPSDVDVGTTQDSNL-KLEQLRRKLASLQNESNDI 918

Query: 905  TKFNVEERVKELFNQXXXXXXXXXXXXXTTYKGFGIDFN---ANALLESKGGDIHWNDDE 961
            +KFNVE R  E+F+                Y GFGI+++   + +L + +G D+    ++
Sbjct: 919  SKFNVEGRFHEMFSDQKIQALDRLKKLENDYSGFGINYDPAESPSLKQEQGQDV----NK 974

Query: 962  IDGQDLQGAQEKMD----EMDRIANELTAMKMKVEIQNQQQHXXXXXXXXXXXXXXGATG 1017
                D +G    +D    E DR    + +      ++ +  H                T 
Sbjct: 975  SRTLDPKGPNNSVDESQLETDRANASIDSSPASESLEEEDVHL---------------TK 1019

Query: 1018 SRTDTASEFSQKSFGSGAGSFLEALSQKYGAGQ-NTTISNS------PFPGVDRKSSNHR 1070
            S T+              GSFLE LSQKYG GQ N +  NS       +PG    S  HR
Sbjct: 1020 STTEEI-----------GGSFLERLSQKYGKGQANLSNRNSVVGRENSYPG----SGYHR 1064

Query: 1071 TSFANRMKKSNATPYFDELTRKVAKAPSLND 1101
             SF NR+KKS+  PY +EL+ K   A   N+
Sbjct: 1065 KSFMNRVKKSDNVPYLEELSGKFGTATHENE 1095

>AFR669W Chr6 (1662202..1667958) [5757 bp, 1918 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YNL271C (BNI1)
          Length = 1918

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/609 (55%), Positives = 423/609 (69%), Gaps = 37/609 (6%)

Query: 1236 GQKKMYRSDMSNYLEETPTFRDNYPQPHKKLKQLHWEKLDATEDSIWSSGVAEKFAGDLY 1295
            G+ K Y    S  L ++P+  + YP+P KKLKQLHWEK+D  ++SIW +  AEKFA DLY
Sbjct: 1347 GRSKTYGGSPSPLLPQSPSLFERYPRPKKKLKQLHWEKIDDPDNSIWENARAEKFADDLY 1406

Query: 1296 EKGVLAGLEKAFAAREIKNLATKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIK 1355
            EKGVL+ LEKAFAAREIK+   +KK++  KITFLS D SQQFGINLHMYS + V+ +V K
Sbjct: 1407 EKGVLSELEKAFAAREIKSFKGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSK 1466

Query: 1356 ILKCDRDFMQTPSVIEFLSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDL 1415
            ILKCD+DF+ T S IEFLSK EI EVS N+AR+F+PY+TDW+G+ S+EDAK PEKDP++L
Sbjct: 1467 ILKCDKDFLSTQSAIEFLSKPEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSEL 1526

Query: 1416 QRADQIYLQLIFNLQAYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSN 1475
            QR+DQ++L LI NLQ+YW SRMR +K+IT+Y+K+Y +L+ KLR +DKAVGAI KSENL N
Sbjct: 1527 QRSDQLFLNLIVNLQSYWSSRMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRN 1586

Query: 1476 IFNVILAVGNFMNDTAKRAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRGNYPSFNDF 1535
            +F+VILAVGN+MNDT+K+AQGFKLSTLQRLTFIKD  NSMTFLNYVE+I+  NYPSFN F
Sbjct: 1587 VFDVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFNSF 1646

Query: 1536 LKELEPVLNVTKISIDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPV 1595
            L+ELEPVL V KISI+QL NDCNE+C  VTNVERS+EIGNLSDSSKFHP DRVL KVLP+
Sbjct: 1647 LQELEPVLQVVKISIEQLANDCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPI 1706

Query: 1596 LPEARKKCDLLDDEVRLSIMEFENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQN 1655
            LPEARKK +LL DEV+LS+MEFENLM+ +GED                 + EYK+AQ  N
Sbjct: 1707 LPEARKKANLLADEVQLSLMEFENLMRMFGEDADDKFAKNSFFKKFADFILEYKRAQEFN 1766

Query: 1656 LKVEEEERVYERHKKMVEEQQRREQTPSKNRDYVVNXXXXXXXXXXXXXXXXXXKLLDQL 1715
             K++EEER YER K M++EQQRR +   +  +                      KLL++L
Sbjct: 1767 RKIDEEERAYERRKLMIQEQQRRAKLVQEGDETTC--ARLSAISASGDDRDVMDKLLEKL 1824

Query: 1716 KNAGPTTSDPSSARKRALMRRKLQADKDAAAHLISDLDSNEDSIVYSPNASQDQSANAEE 1775
            KNAGP+  DPSSARKRAL R+KL   ++ +  ++  LD  +D    +P+   D    A  
Sbjct: 1825 KNAGPSKGDPSSARKRALARKKLMGGREGSI-ILEGLDV-DDLQSAAPDVQPDTPLRAAS 1882

Query: 1776 ASPTVHKGSNKNNKPVLSDLESPIKASRNADRXXXXXXXXISDKAKNLLMELSGNGAPTR 1835
            ASP                   P  A+               D+A++LL+EL     P  
Sbjct: 1883 ASPP------------------PDPAA---------------DRARHLLLELRNGEHPES 1909

Query: 1836 REELLNGHK 1844
            R+ +L+ HK
Sbjct: 1910 RKSMLDEHK 1918

 Score =  518 bits (1335), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 363/1051 (34%), Positives = 536/1051 (50%), Gaps = 120/1051 (11%)

Query: 162  SQGSLTNLGRFMRPDGKVRLDMPQDYHEVESLFEDIMYKRNIMQTLPPEKQQELRNYDID 221
            S  SL+ L +    DG + L+ P+D  E+E L+++++ KRNI Q++     +EL +Y ID
Sbjct: 166  SYTSLSLLHKATDIDGTLTLEKPEDPQEIEELYQELLQKRNIPQSVSVHGHRELMSYGID 225

Query: 222  KKWLIVRQDXXXXXXXXXXXXXXXXXXXXXXXXXLSLTNTISSHDYSDATSIRHMKTXXX 281
            KKWL+V+QD                         L+ +   S    S   SI        
Sbjct: 226  KKWLMVKQDLQTEYKKMKNSMPPSSTVESIASSALAKSPGGSISSGSITRSISQ------ 279

Query: 282  XXXXXXXXXXXXXXXXXXTTVNTEKINRPPTYYVKKIIADDLTIDELNDLWVTLRTEQLD 341
                                V  E  +  P +YV+KII+D +T  ELNDLW++LRTE +D
Sbjct: 280  -------------NSAKPMAVAYEPAHLSPDHYVRKIISDRVTAQELNDLWISLRTESID 326

Query: 342  WVDAFLEHQGHIAMANVLMKSLYKTTQEVKLTEKSLEREASYFKCFRVLVMLAQGLYEFT 401
            WV  F++ QG +A+AN L+K + + + ++     +LE+E +Y+KC RVL  L +G+ E  
Sbjct: 327  WVIGFIDAQGQVAIANRLLKFVQRESLDILHDYDALEKENAYYKCLRVLTNLREGMQEAL 386

Query: 402  KHAIMAETVAYALFSIRLPTRKMATEIFVCMLEKKNKSRFDV-------ILTALDKKFMI 454
            K  ++  +V   L S RL TR++ATE  + ML        D        +L ALD++   
Sbjct: 387  KSKLVISSVVEGLLSSRLSTRRVATETLLYMLSDDELKTADTGQDAIFPLLVALDQESKF 446

Query: 455  GENLHMMQFVKNSPQQFIHLKRDSQFKIV----QAWLTGLETALQGRGKMGSLVGASEEV 510
              N+H+   +  + ++       + F +V    + WL  +E  L GRG+MGSLVGAS++ 
Sbjct: 447  AANIHLRGRLHETNKRKSLPTGRADFHVVAKRLEQWLYVIEYTLDGRGRMGSLVGASDDY 506

Query: 511  RAAGGENSILEYSQWTMVFINHLCMGTDVVNQRVLLRTRLENAGALRIMNRFKLLDYDKI 570
            +  GGEN++LEY  ++M+ +N LC     V QR LLR+RL++ G  RI+ + +LL Y  +
Sbjct: 507  K--GGENTVLEYLLYSMILLNLLCSNHPDVQQRNLLRSRLKSYGLARIIKKMELLKYPAL 564

Query: 571  TAQIEYYENGKLDDINNLLESEGRNTQVNMQDPMMMLQTMWDYCKGTENEKTFISLIKHL 630
              ++  +E+  LDD N L+ S   ++ V+M+DP  + Q  W   +GTE E   +SL++HL
Sbjct: 565  ENEVRKFEDATLDDYNLLMTSTTVDSAVDMKDPAALWQDFWTQHRGTEAEGHLLSLLQHL 624

Query: 631  FLSSSKVADDRGDPSKLAKQLKLMDSLXXXXXXXXXXXXXXXXXXIQRLYDAMQTDEVAR 690
            FL S   A+ R DP++  KQLKL+D+L                  IQRLYDAMQTDEVAR
Sbjct: 625  FLWSRAFAEYR-DPAESIKQLKLLDALVTNVTFSSIDTESGFNGAIQRLYDAMQTDEVAR 683

Query: 691  RAILESRQLTKELEEIQAERDFLRQKLNSTGDGIVGRLEEELKQRDDILAKNQRVNRHLQ 750
            RAILESR+LTK+ EEI+AERD L  KL+   +G+VG+L+ E++Q + IL K+ RV   L+
Sbjct: 684  RAILESRELTKKYEEIKAERDNLASKLSQAQNGLVGQLQSEVEQLERILEKSNRVTDQLK 743

Query: 751  AXXXXXXXXXXXXXXXXXXXXXXMLTILNARPDDENLAKSTKVTKSVNGLDPDRQTSIQK 810
                                   MLTILN++P  EN       T + + L P+++ +IQK
Sbjct: 744  GELHALKKKHLLEKHEHEVELRKMLTILNSKPHGENGGSPEVNTSTPSPLKPEKKMAIQK 803

Query: 811  ALQDGLQRTRKDLSVDSKRFGITVQPNKRLRMLRMKMEGIEQEARELEMTNFAEHEEKQ- 869
            ALQD L++T KDL+ DSKR      PN+RL+MLR KM+ IE+EAR LEMTNFA+ +++  
Sbjct: 804  ALQDRLRQTEKDLTRDSKRLNTVPAPNRRLKMLRSKMDIIEKEARLLEMTNFADFKKEPE 863

Query: 870  -------LEEPVGTGTKKKAGVRKLSELRKQLSDIQKETNEVTKFNVEERVKELFNQXXX 922
                   L  P    + +   V++L+ LRK+L+ IQ+E+NEV+KFNVEERV ELF +   
Sbjct: 864  EENEPKLLSPPKIQRSLRGEQVKELAALRKRLAIIQQESNEVSKFNVEERVNELFYEKKN 923

Query: 923  XXXXXXXXXXTTYKGFGIDFNANALLES---KGGDIHWNDDEIDGQ-----DLQGAQEKM 974
                        YKGFGIDFN +  L S     G +  +   ID +     D      K+
Sbjct: 924  KALDRLRDLENKYKGFGIDFNEDPELMSLRLANGSVDLDGPTIDLESSAPLDPAHLDAKI 983

Query: 975  DEMDRIANELTAMKMKVEIQNQQQHXXXXXXXXXXXXXXGATGSRTDTAS----EFSQKS 1030
            +EM +I + L  +K  +++ +                  G   S ++ +       S+ S
Sbjct: 984  EEMTKILDRLNKLKKDIDMSSVGTSTSNESASISTEELAGNNSSHSEISCTSPHSLSKPS 1043

Query: 1031 FGSGAG-------------------------------------SFLEALSQKYGAGQNT- 1052
              S  G                                     SFLE LSQKYG G  + 
Sbjct: 1044 ISSTTGGSDAETAADAADDISDNDDETSSSMIVTGAEAIISNASFLETLSQKYGTGSQSG 1103

Query: 1053 --TISNSP----FPGVDRKSS-------NHRTSFANRMKKS---NATPYFDELTRKVAKA 1096
              ++S+S        V R++S       NHR SF NRMK++    ++ + +ELT+KV+ A
Sbjct: 1104 AASVSSSEHMRGVVNVKRRTSQNSINSGNHRKSFVNRMKRTITPTSSNFLEELTQKVSPA 1163

Query: 1097 PSLNDPSSPGSNEPGDDDTLPATSPTVPQSI 1127
             S +  SS G             S T PQSI
Sbjct: 1164 RSQSARSSRG-------------SATTPQSI 1181

>SAKL0C02618g Chr3 complement(240920..246886) [5967 bp, 1988 aa] {ON}
            some similarities with uniprot|P41832 Saccharomyces
            cerevisiae YNL271C BNI1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1988

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/657 (54%), Positives = 460/657 (70%), Gaps = 28/657 (4%)

Query: 1238 KKMYRSDM-SNYLEETPTFRDNYPQPHKKLKQLHWEKLDATEDSIWSSGVAEKFAGDLYE 1296
            K MYR+   S  L ++P+  + YP+P KKLKQLHWEK++ T +SIW    AEK+A DLYE
Sbjct: 1288 KAMYRAATPSPLLPQSPSLFERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYE 1347

Query: 1297 KGVLAGLEKAFAAREIKNLATKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKI 1356
            +GVLA LEKAFAAREIK LA ++KEDL K+TFLS D SQQFGINLHMY+ +SV ++V KI
Sbjct: 1348 RGVLAQLEKAFAAREIKLLANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKI 1407

Query: 1357 LKCDRDFMQTPSVIEFLSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQ 1416
            L+CD+DF+ + SVI+FL K EI EVS NLARNF+PYST+W+G+ S+++AK PEKDP +LQ
Sbjct: 1408 LRCDKDFLGSASVIDFLLKPEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQ 1467

Query: 1417 RADQIYLQLIFNLQAYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNI 1476
            RADQ+YL+++ NLQ YW SRMRA+KVIT+Y+KEY +L+TKLR +DKAV +I  S+NL ++
Sbjct: 1468 RADQLYLEMMVNLQGYWASRMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSV 1527

Query: 1477 FNVILAVGNFMNDTAKRAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRGNYPSFNDFL 1536
            F VILAVGN+MND++K+A GFKL+TLQRLTFIKD  NSMTFLNYVEKIIR NY  FN FL
Sbjct: 1528 FEVILAVGNYMNDSSKQAHGFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSFL 1587

Query: 1537 KELEPVLNVTKISIDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVL 1596
            +ELEPVL+V KIS++QL  DC E+ Q + NVERSIE+GNLSDSSKFHP DRVL+KVLPVL
Sbjct: 1588 QELEPVLDVVKISVEQLAADCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVL 1647

Query: 1597 PEARKKCDLLDDEVRLSIMEFENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQNL 1656
            PEARK+ DLL DEV+L++MEF+ LMQ +GED                 +QEYKKAQ  N+
Sbjct: 1648 PEARKRSDLLSDEVKLTLMEFDGLMQMFGEDASDKFAKNSFFKKFADFIQEYKKAQAHNI 1707

Query: 1657 KVEEEERVYERHKKMVEEQQRREQTPSKNRDYVVNXXXXXXXXXXXXXXXXXXKLLDQLK 1716
            K+EEEER YER KKMVEEQ +R +  ++                         KLL++LK
Sbjct: 1708 KMEEEERAYERRKKMVEEQHKRARLEAEKGGVDDGSEAEGVTAVSRGERDVMDKLLEKLK 1767

Query: 1717 NAGPTTSDPSSARKRALMRRKLQADKDAAAHLISDLDSNE-----DSIVYSPNAS--QDQ 1769
            NAGP  SDPSSARKRAL R+KL   K ++A+++ + + +E      S+VYSP  +     
Sbjct: 1768 NAGPGKSDPSSARKRALARKKLLDGKRSSANILDNFEVDEAAPVNQSLVYSPETTLKAAN 1827

Query: 1770 SANAEEASPTVHK-----GSNKNNKPVLSDLESPIKASRNADRXXXXXXXXISDKAKNLL 1824
            +A+AE  +P   +     GS     P+   LESP K +             ++D+A+NLL
Sbjct: 1828 AAHAESPTPKASRQGSVAGSGATATPL---LESPSKQA-------SAGPEDVADRARNLL 1877

Query: 1825 MELSGNGAPTRREELLNGHKERLRARRRRTQGHGELISSNKLAFLDDETPPVTPTDS 1881
             EL G  +  +R+ LL  H+E++RARRRR        S NKL F+   +    PTDS
Sbjct: 1878 KELRGPES-EKRKPLLEDHREKMRARRRRVNEGAS--SENKLVFVGGASE--APTDS 1929

 Score =  593 bits (1528), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 338/840 (40%), Positives = 492/840 (58%), Gaps = 58/840 (6%)

Query: 300  TTVNTEKINRPPTYYVKKIIADDLTIDELNDLWVTLRTEQLDWVDAFLEHQGHIAMANVL 359
             T++ + ++  P YYV+KII+D ++  +L DLWV+LRTEQLDWV  FL+ QG +A+ANVL
Sbjct: 290  ATLSQDPLHLSPDYYVRKIISDKISTKQLKDLWVSLRTEQLDWVVGFLDAQGQVAIANVL 349

Query: 360  MKSLYKTTQEVKLTEKSLEREASYFKCFRVLVMLAQGLYEFTKHAIMAETVAYALFSIRL 419
            ++  +K + +  L +++L++E ++FKC + L+ L +G  E  +  ++   +   L S+R+
Sbjct: 350  LRFFHKESPDALLNDEALDKEFAFFKCLKTLLNLKEGANEAVRTKLVVSAITDGLLSLRI 409

Query: 420  PTRKMATEIFVCMLEKKNKSRFDVILTALDKKFMIGENLHMMQFVKNSPQQ--------F 471
             TR++A+E+ V + +       + ++  LD++  +  N+H+   + ++ ++         
Sbjct: 410  STRRIASEMLVFITQWDIPYGLNQVIGELDQESHVSSNVHLQARLLSANKRDSLLAQDHE 469

Query: 472  IHLKRDSQFKIVQAWLTGLETALQGRGKMGSLVGASEEVRAAGGENSILEYSQWTMVFIN 531
            + L RD   K  + WL  +E  L GRGKMGSLVGASE+ ++AGGEN+ILEY   T++ +N
Sbjct: 470  LDLTRDHASKKFEQWLFVVEYTLDGRGKMGSLVGASEDFKSAGGENAILEYGYLTLLLVN 529

Query: 532  HLCMGTDVVNQRVLLRTRLENAGALRIMNRFKLLDYDKITAQIEYYENGKLDDINNLLES 591
             LC     VNQR LLR+R ++ G  RIM + +LL+YDKI  Q+  +E+   DD N ++ S
Sbjct: 530  QLCNTPADVNQRTLLRSRFKSCGLSRIMQKLELLNYDKIDEQLRIFEDRTADDYNTIMAS 589

Query: 592  EGRNTQVNMQDPMMMLQTMWDYCKGTENEKTFISLIKHLFLSSSKVADDRGDPSKLAKQL 651
            +  N  V+M++P+ +LQ +W+  KGT  EK  +SL++HLF++SSKV D+  DP++ +KQL
Sbjct: 590  KSINHNVDMENPLSLLQNLWESYKGTGAEKYLVSLVQHLFIASSKVQDEGDDPTEASKQL 649

Query: 652  KLMDSLXXXXXXXXXXXXXXXXXXIQRLYDAMQTDEVARRAILESRQLTKELEEIQAERD 711
            KL+DSL                  IQRLYD+MQTDEVARRAI+E+R+LT++ EE++AERD
Sbjct: 650  KLIDSLVSNVTMSSIDTESSFNGAIQRLYDSMQTDEVARRAIMEARELTRKFEEVKAERD 709

Query: 712  FLRQKLNSTGDGIVGRLEEELKQRDDILAKNQRVNRHLQAXXXXXXXXXXXXXXXXXXXX 771
            +L +KL+    G+VG+L+ EL QRD IL KNQRV   LQA                    
Sbjct: 710  YLGEKLSKAEGGLVGQLQNELSQRDRILEKNQRVTEQLQADLEELKKKHLLEKHEHEVEL 769

Query: 772  XXMLTILNARPDDENLAK----STKVTKSVNGLDPDRQTSIQKALQDGLQRTRKDLSVDS 827
              +LTILN+RP   +  +     T  + +   L  DR+ +IQKALQD LQ+T+KDL+ +S
Sbjct: 770  RKLLTILNSRPQGSSAVQEEEAGTASSSAPGVLHADRKLAIQKALQDRLQQTKKDLTKES 829

Query: 828  KR----FGITVQPNKRLRMLRMKMEGIEQEARELEMTNFAEHEEKQLEE----------- 872
            KR     G T++PN+RL++LR +ME IE EARELEMTNFA+ + + +EE           
Sbjct: 830  KRLGTTLGTTLEPNRRLKLLRSRMEDIENEARELEMTNFADIQRQTVEEQTVVPALPPPA 889

Query: 873  -------PVGTGTKKKAGVRKLSELRKQLSDIQKETNEVTKFNVEERVKELFNQXXXXXX 925
                   P      K+  VRKL ELR++L+ +QKE+N+V+KFNVEER+ ELFN       
Sbjct: 890  VPVLDRAPKAKKQVKEDQVRKLRELRQRLASVQKESNDVSKFNVEERINELFNDKKLSAL 949

Query: 926  XXXXXXXTTYKGFGIDFNANALLESKGGDI-HWNDDEIDGQ-----DLQGAQEKMDEMDR 979
                   T YKGFGIDF A+  L +   D    N    DGQ     D +    K++EM +
Sbjct: 950  DRLKELETKYKGFGIDFQADPELSAMLSDAPPENHHAKDGQAHPSLDPKHLSRKIEEMSK 1009

Query: 980  IANELTAMKMKVEIQNQQQHXXXXXXXXXXXXXXGATGSRTDTASEFSQKSFGSGAGSFL 1039
            I +ELTA K   EI+N                   A           S  S  +  GSFL
Sbjct: 1010 IVDELTAFKK--EIENGPPSSSSSSSDEELEQDDRA-----------SIHSGNASTGSFL 1056

Query: 1040 EALSQKYGAGQNTTISNSPFPGVDRKSS-----NHRTSFANRMKKSNATPYFDELTRKVA 1094
            E LSQKYG GQN   + S    V R+S+      HR SF  R+KKS+A P+  ELT+KVA
Sbjct: 1057 ETLSQKYGTGQNAGPTASSRAMVGRESNYPGRGYHRRSFMERVKKSDAAPFLSELTQKVA 1116

 Score = 98.2 bits (243), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 41/71 (57%), Positives = 55/71 (77%)

Query: 160 VLSQGSLTNLGRFMRPDGKVRLDMPQDYHEVESLFEDIMYKRNIMQTLPPEKQQELRNYD 219
           + SQGS+TNL +FM  DGKV+LD P +  E+E LF ++M+KRN  Q+LP   Q+EL NYD
Sbjct: 142 IFSQGSMTNLTKFMGADGKVKLDRPSNPQEIEDLFAELMHKRNFFQSLPAAGQKELMNYD 201

Query: 220 IDKKWLIVRQD 230
           +DKKWL+V+QD
Sbjct: 202 LDKKWLLVKQD 212

>KLTH0F02376g Chr6 complement(196194..202124) [5931 bp, 1976 aa] {ON}
            some similarities with uniprot|P41832 Saccharomyces
            cerevisiae YNL271C BNI1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1976

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/631 (54%), Positives = 440/631 (69%), Gaps = 26/631 (4%)

Query: 1246 SNYLEETPTFRDNYPQPHKKLKQLHWEKLDATEDSIWSSGVAEKFAGDLYEKGVLAGLEK 1305
            S  L ++P+  D YP+P KKLKQLHWEK+D  EDSIW    AEKFA DLYEKGVL+ LEK
Sbjct: 1322 SPMLPQSPSLFDRYPRPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEKGVLSRLEK 1381

Query: 1306 AFAAREIKNLATKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQ 1365
            AFAAREIK+LA++KK+D  K++FLS D SQQFGINLHMYS +SV ++V KIL+CDRDF+ 
Sbjct: 1382 AFAAREIKSLASRKKKDSDKLSFLSRDVSQQFGINLHMYSSLSVEEVVSKILRCDRDFLS 1441

Query: 1366 TPSVIEFLSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQL 1425
            TPSVI+FLSK EI EVS NLARNF+PY+ DW+G+ S+E+AKPPEKDP +LQRAD++YL+L
Sbjct: 1442 TPSVIDFLSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADRLYLEL 1501

Query: 1426 IFNLQAYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGN 1485
              NLQ YW SRMRA+KVIT+Y+K+Y +LV KL  +DKA  +I +SENL N+ +VILAVGN
Sbjct: 1502 FVNLQTYWSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVILAVGN 1561

Query: 1486 FMNDTAKRAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRGNYPSFNDFLKELEPVLNV 1545
            FMND++K+AQGF+L+TLQRLTFIKD  NSMTFLNYVEKIIR  YP FNDFLKELEPV+  
Sbjct: 1562 FMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIIRETYPEFNDFLKELEPVVAA 1621

Query: 1546 TKISIDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDL 1605
             KISI+Q+  DC E+ Q+V NVERS++IGNLSD +KFHP DRVL+KVLP LPEARKK DL
Sbjct: 1622 VKISIEQVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARKKGDL 1681

Query: 1606 LDDEVRLSIMEFENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQNLKVEEEERVY 1665
            L DE++L+++EF+NLM+ +GED                 + EYKKAQ  NLK+EEEER Y
Sbjct: 1682 LMDEMKLTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNLKLEEEERAY 1741

Query: 1666 ERHKKMVEEQQRR-EQTPSKNRDYVVNXXXXXXXXXXXXXXXXXXKLLDQLKNAGPTTSD 1724
            ER KK+VE+Q +R  ++ SKN+    +                  +LL++LKNAGP  SD
Sbjct: 1742 ERRKKLVEDQLKRTRESESKNKG-TTDAGGDSVRNEVNEDRDVMDRLLEKLKNAGPAKSD 1800

Query: 1725 PSSARKRALMRRKLQADKDAAAHLISDL---DSNEDSIVYSP-NASQDQSANAEEASPTV 1780
            PSSARKRA+ R++L     + + ++ +    DS+  S+VYSP N S +   N  + SPT 
Sbjct: 1801 PSSARKRAVARKRLLQGSSSNSTILDNFDIEDSDGKSLVYSPDNNSSEVQLNEADTSPTP 1860

Query: 1781 HKGSNKNN--KPVLSDLESPIKASRNADRXXXXXXXXISDKAKNLLMELSGNGAPTRREE 1838
             +    +N   P   D  S                  ++D+A+NLL+EL G  +P  +  
Sbjct: 1861 ERRVRDSNATSPASHDTGS----------------SDLTDRARNLLIELRGPESPGVKMS 1904

Query: 1839 LLNGHKERLRARRRRTQGHGELISSNKLAFL 1869
              +    +LRARR+         S N+L F+
Sbjct: 1905 AQHQRLSKLRARRKNDSSSSG--SENRLNFV 1933

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/1052 (34%), Positives = 568/1052 (53%), Gaps = 88/1052 (8%)

Query: 96   RTPSQQSTGS--KYTYPKRTSSSITGGNPSLPSSSATPIPAPVTPGQLSRXXXXXXXXXX 153
            R+ S  S GS  KY+Y +R +S  +  N            + V+  +LSR          
Sbjct: 97   RSASNASVGSPTKYSYSRR-ASQWSNNN------------SAVSGSKLSRQQTNQSMSSA 143

Query: 154  XXXXXXVLSQGSLTNLGRFMRPDGKVRLDMPQDYHEVESLFEDIMYKRNIMQTLPPEKQQ 213
                  + SQGS +NL +F+ PDG VRL+ P+D  E+E LFE+++YKRN+ Q+LP   Q+
Sbjct: 144  S-----IFSQGSFSNLSKFVGPDGAVRLERPRDPKEIEELFEEVLYKRNVYQSLPASAQR 198

Query: 214  ELRNYDIDKKWLIVRQDXXXXXXXXXXXXXXXXXXXXXXXXXLSLTNTISSHDYSDATS- 272
            EL NYD++KKWL+VRQD                          ++ ++ S+ +++ +TS 
Sbjct: 199  ELNNYDLEKKWLMVRQDLQSEVKKFMNSKNASKSSTVVGGSSSAVPDSPSASNFTSSTSP 258

Query: 273  ------IRHMKTXXXXXXXXXXXXXXXXXXXXXTTVNTEKINRPPTYYVKKIIADDLTID 326
                  +   K                      TT++ +  +  P YYV+KII +D++  
Sbjct: 259  NGSFTGLSRPKISTSSVNTSEQFYSSNLGTSSTTTLSQDPSHLSPDYYVRKIICNDISAK 318

Query: 327  ELNDLWVTLRTEQLDWVDAFLEHQGHIAMANVLMKSLYKTTQEVKLTEKSLEREASYFKC 386
             LNDLWV+LRTEQLDWV  FLE QG +A+ANV++K+ Y+ + +  L ++ L++E +YFKC
Sbjct: 319  RLNDLWVSLRTEQLDWVQGFLEAQGQVAIANVILKTCYRESPDNLLGDEVLDKEFAYFKC 378

Query: 387  FRVLVMLAQGLYEFT---KHAIMAETVAYALFSIRLPTRKMATEIFVCMLEKKNKSRFDV 443
             +  + L +G  E        I+   +   L S+R+ TR++A+E+ + + +      F+ 
Sbjct: 379  LKTSLNLREGADEAVMSNSARIIVSAIVEGLLSLRVATRRVASELLISLSQWSLPHGFNH 438

Query: 444  ILTALDKKFMIGENLHMM-----QFVKNSPQQFIHLK------RDSQFKIVQAWLTGLET 492
            ++ ALD++    +N+H+      Q     P++   +        D   +  + W+  +E 
Sbjct: 439  VMDALDQESRFCDNVHLQARLITQSASKDPKKGSSIAPTPDGDGDRVMRKFEQWMLVVEY 498

Query: 493  ALQGRGKMGSLVGASEEVRAAGGENSILEYSQWTMVFINHLCMGTDVVNQRVLLRTRLEN 552
             L GRGKMGSLVGASE+ R +GGEN+I+EY+  T++ INHLC     V QR +LR RL+N
Sbjct: 499  TLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLINHLCQTPVDVKQRTVLRARLKN 558

Query: 553  AGALRIMNRFKLLDYDKITAQIEYYENGKLDDINNLLESEGRNTQVNMQDPMMMLQTMWD 612
            AG  RI+N+ KLL+Y+K+  Q+  +++   DD + L   E     V+M+DP+ M Q +W+
Sbjct: 559  AGLPRILNKMKLLNYEKVDEQLARFDDSTTDDFDALYSQESTGEGVDMKDPVSMTQNLWN 618

Query: 613  YCKGTENEKTFISLIKHLFLSSSKVAD-DRGDPSKLAKQLKLMDSLXXXXXXXXXXXXXX 671
             CKGT+ E+   SL+++L +S+ ++   ++ DP++  KQLKL+D+L              
Sbjct: 619  LCKGTDAEQHLTSLLQNLLISTGELGSKNKDDPTQRTKQLKLIDALVSNVSMASVDMQSS 678

Query: 672  XXXXIQRLYDAMQTDEVARRAILESRQLTKELEEIQAERDFLRQKLNSTGDGIVGRLEEE 731
                IQRLYDAMQTDE+ARRAILE+R   K  EEI+A+RD L++KL++   G+VG+L++E
Sbjct: 679  FNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKADRDNLKEKLSNAEGGLVGQLQDE 738

Query: 732  LKQRDDILAKNQRVNRHLQAXXXXXXXXXXXXXXXXXXXXXXMLTILNARPDDENLAKST 791
            ++QRD IL K+QRVN  LQ                        LT +N+  +  +  +  
Sbjct: 739  VRQRDHILEKSQRVNAQLQHELDESKKKLILAKHEHEVELRKTLTAMNSNFEGSHNMRDE 798

Query: 792  KVTKSVNGLDPDRQTSIQKALQDGLQRTRKDLSVDSKRFGITVQPNKRLRMLRMKMEGIE 851
            K +++   L P+R+ +IQKALQ  L++T K+++V+SKR G++++PNKRL++LR +ME IE
Sbjct: 799  KGSENPRPLRPERKLAIQKALQAKLEKTSKEINVESKRLGLSLEPNKRLKLLRSRMEDIE 858

Query: 852  QEARELEMTNFAEHEEKQLEEP-VGTGTKKKA-----------GVRKLSELRKQLSDIQK 899
             +ARELEMTNF+++++  ++EP V      KA              KL ELRK+L+ +Q+
Sbjct: 859  NQARELEMTNFSDYQKDDIKEPEVSNEDDHKAVSESEEKAQQISALKLEELRKKLASLQQ 918

Query: 900  ETNEVTKFNVEERVKELFNQXXXXXXXXXXXXXTTYKGFGIDFNANALLESKGGDIHWND 959
            E+N+++KFNVE R  E+F+              T YKGFGI+F+ ++ L           
Sbjct: 919  ESNDISKFNVEGRFHEMFSGQKSLALDRLKKLETDYKGFGINFDPDSPL----------- 967

Query: 960  DEIDGQDLQGAQEKMDEMDRIANELTAMKMKVEIQNQQQHXXXXXXXXXXXXXXGATGSR 1019
                GQ L G     D+  R  +   A+ +  E+ N                    T  R
Sbjct: 968  ----GQALAGKSVSSDDKARTLDPKEALNIVEEVSN----ILSGLDSSKAAEKSNETPLR 1019

Query: 1020 TDTASEFSQKSFGSGAG------------SFLEALSQKYGAGQNTTISNSPFPGVDRK-- 1065
            T T+S+ S+       G            SFLE+LSQKYG  QN+  +   F G +    
Sbjct: 1020 TATSSDSSEDEMDDKNGDKIAADSTLPTSSFLESLSQKYGGAQNSLSNRHSFAGGEINYP 1079

Query: 1066 -SSNHRTSFANRMKKSNATPYFDELTRKVAKA 1096
             S  HR SF NR+K++ A PY  EL+ K+  +
Sbjct: 1080 GSGYHRKSFMNRVKRTGAVPYLGELSGKIGSS 1111

>Ecym_1086 Chr1 complement(173244..179519) [6276 bp, 2091 aa] {ON}
            similar to Ashbya gossypii AFR669W
          Length = 2091

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/641 (54%), Positives = 447/641 (69%), Gaps = 27/641 (4%)

Query: 1236 GQKKMYR-SDMSNYLEETPTFRDNYPQPHKKLKQLHWEKLDATEDSIWSSGVAEKFAGDL 1294
            G+ K Y+ S  S  L ++P+  + YP+P K+LKQLHWEK+D  ++SIW +  AEKFA DL
Sbjct: 1379 GRTKKYKGSSPSPLLPQSPSLFEKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFADDL 1438

Query: 1295 YEKGVLAGLEKAFAAREIKNLATKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVI 1354
            YE+GVL  LEKAFAAREIK+L ++KK D  K+TFLS D SQQFGINLHMYS ++V+ +V 
Sbjct: 1439 YERGVLTELEKAFAAREIKSLISRKK-DENKVTFLSRDISQQFGINLHMYSSLTVDQIVT 1497

Query: 1355 KILKCDRDFMQTPSVIEFLSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPND 1414
            KILKCD+DF+ T S IEFLSK EI EVS+N+AR F+PY+TDW+G+ S+E+AK PEKDPN+
Sbjct: 1498 KILKCDKDFLNTQSAIEFLSKHEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNE 1557

Query: 1415 LQRADQIYLQLIFNLQAYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLS 1474
            LQRADQ+YL LI NLQ+YW SRMRA+K+IT+Y+K+Y +L+ KLR +DKAVGAI KSENL 
Sbjct: 1558 LQRADQLYLDLIVNLQSYWNSRMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLR 1617

Query: 1475 NIFNVILAVGNFMNDTAKRAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRGNYPSFND 1534
            N+F+VILAVGN+MND++K+AQGFKLSTLQRLTFIKD  NSMTFLNYVEKI+R NYP F+ 
Sbjct: 1618 NVFDVILAVGNYMNDSSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFDV 1677

Query: 1535 FLKELEPVLNVTKISIDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLP 1594
            FL+ELEPVL V KISI+QL NDC E+C  VTNVERS+EIGNLSDSSKFHP DRVL KVLP
Sbjct: 1678 FLQELEPVLQVVKISIEQLANDCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLP 1737

Query: 1595 VLPEARKKCDLLDDEVRLSIMEFENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQ 1654
            VLPEARK+ +LL DEV+LS+MEFE+LM+ +GED+                + EYK+AQ  
Sbjct: 1738 VLPEARKRANLLADEVQLSLMEFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEF 1797

Query: 1655 NLKVEEEERVYERHKKMVEEQQRREQTPSKNRDYVVNXXXXXXXXXXXXXXX------XX 1708
            N K+EEEER YER K M+EEQQ+R +   KN     +                       
Sbjct: 1798 NKKMEEEERAYERRKIMIEEQQKRAR---KNIQIDTSFSRRGSSLSTSSISASGDDRDVM 1854

Query: 1709 XKLLDQLKNAGPTTSDPSSARKRALMRRKLQADKDAAAHLISDLDSNEDSIVYSPNASQD 1768
             +LL++LKNAGP+ +DPSSARKRAL R+KL   K + + ++  LD  E + + S      
Sbjct: 1855 DRLLEKLKNAGPSKADPSSARKRALARKKLMDGKKSGSIILDGLDVEELANIQSDGLDDQ 1914

Query: 1769 QSAN-AEEASPTVHKGSNKNNKPVLSDLE---SPIKASRNADRXXXXXXX---------- 1814
              +N A   SPT   G+  + + +  D +   +PI A + +                   
Sbjct: 1915 SDSNPAILGSPTSTVGATADVEGLNPDHDLPSAPISAEKGSVSSALSHSSESPSKKILDE 1974

Query: 1815 -XISDKAKNLLMELSGNGAPTR-REELLNGHKERLRARRRR 1853
              ++ +A+NLL EL  +   T  R+ LL+ HKE++R RR +
Sbjct: 1975 DAVTHRARNLLQELRSSDDHTEDRKSLLDEHKEKVRQRRNK 2015

 Score =  499 bits (1286), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 317/865 (36%), Positives = 478/865 (55%), Gaps = 60/865 (6%)

Query: 166  LTNLGRFMRPDGKVRLDMPQDYHEVESLFEDIMYKRNIMQTLPPEKQQELRNYDIDKKWL 225
            +T L +    DG + L+ P+   E+E L+++++ KRNI+ ++     +EL  YD+DKKWL
Sbjct: 165  VTLLQKITDSDGNLSLEKPKYPQEIEELYQELLQKRNILNSVSVHSHRELMGYDLDKKWL 224

Query: 226  IVRQDXXXXXXXXXXXXXXXXXXXXXXXXXLSLTNTISSHDYSDATSIR-HMKTXXXX-X 283
            +V+QD                           + N +     +D  S   H+K+      
Sbjct: 225  MVKQDLQAELKR--------------------MKNNVPQSTVADPLSNSVHLKSPRGSFS 264

Query: 284  XXXXXXXXXXXXXXXXTTVNTEKINRPPTYYVKKIIADDLTIDELNDLWVTLRTEQLDWV 343
                              V+ +  +  P +YV+KII+D +T  ELNDLWV+LRTE +DWV
Sbjct: 265  SSNMSARSISQNSAKQLAVSYDPSHLSPDHYVRKIISDRITAYELNDLWVSLRTESIDWV 324

Query: 344  DAFLEHQGHIAMANVLMKSLYKTTQEVKLTEKSLEREASYFKCFRVLVMLAQGLYEFTKH 403
              F++ QG +A+AN L+K   + + E  L    LE+E +Y+KC RVL  L +G+      
Sbjct: 325  IGFIDAQGQVAIANRLIKFAQRESLESLLDSDLLEKETAYYKCLRVLTNLREGMQAALSS 384

Query: 404  AIMAETVAYALFSIRLPTRKMATEIFVCMLE----KKNKSRFDVI---LTALDKKFMIGE 456
             ++   V   L SIRL TR++ATE  + ML     K   + FD I   L ALD++     
Sbjct: 385  KLVISAVVEGLLSIRLTTRRIATETLLYMLTDDELKTADTDFDAIFPVLHALDQESKYSS 444

Query: 457  NLHMMQFVK--NSPQQFIHLKRDSQF--KIVQAWLTGLETALQGRGKMGSLVGASEEVRA 512
            ++H+   +   N  +     + D     K ++ WL  LE  L GRG+MGSLVGASE+ + 
Sbjct: 445  SIHLRGRLHETNKRRSLPTGRADLHVIAKKIEQWLYVLEYTLDGRGRMGSLVGASEDYK- 503

Query: 513  AGGENSILEYSQWTMVFINHLCMGTDVVNQRVLLRTRLENAGALRIMNRFKLLDYDKITA 572
              GEN++LEY  ++M+ IN LC     ++QR LLR+RL++ G  R++ + +LL Y  +  
Sbjct: 504  -NGENTVLEYLLYSMILINLLCSSHPDLHQRNLLRSRLKSYGLSRVIKKMELLKYPALEN 562

Query: 573  QIEYYENGKLDDINNLLESEGRNTQVNMQDPMMMLQTMWDYCKGTENEKTFISLIKHLFL 632
            ++  +E+  LDD N+L+ S   ++ V+M+DP  +    W   KGTE+E   +SL++HLFL
Sbjct: 563  EVSKFEDRTLDDYNSLMASSTVDSSVDMKDPESLWNNFWTRHKGTESEAHLLSLMQHLFL 622

Query: 633  SSSKVADDRGDPSKLAKQLKLMDSLXXXXXXXXXXXXXXXXXXIQRLYDAMQTDEVARRA 692
             SSK   +  DP++ +KQLKL+D+L                  IQRLYDAMQTDEVARRA
Sbjct: 623  WSSKAFSESTDPAEGSKQLKLLDALVSNVTFSSIDTESGFNGAIQRLYDAMQTDEVARRA 682

Query: 693  ILESRQLTKELEEIQAERDFLRQKLNSTGDGIVGRLEEELKQRDDILAKNQRVNRHLQAX 752
            ILESR+LTK+ EE++AERD L+ KL    DG+VG+L+ E++Q   IL K+ RV   L+A 
Sbjct: 683  ILESRELTKKCEEMKAERDHLQTKLAQAQDGLVGQLQGEVQQLQRILEKSNRVTDQLKAD 742

Query: 753  XXXXXXXXXXXXXXXXXXXXXMLTILNARPDD---ENLAKSTKVTKSVNGLDPDRQTSIQ 809
                                 MLTILN++P+D   + ++      K+ + L P+++ +IQ
Sbjct: 743  LHDLKKKHLLEKHEHEVELRKMLTILNSKPNDASNDAVSPDGINNKTPSPLKPEKKMAIQ 802

Query: 810  KALQDGLQRTRKDLSVDSKRFGITVQPNKRLRMLRMKMEGIEQEARELEMTNFAE-HEEK 868
            KALQD L++T KDL+ DS+RFG    PN+RL+MLR KM+ IE+EA  LEMTNFAE  +E 
Sbjct: 803  KALQDRLRQTEKDLTRDSRRFGTVPAPNRRLKMLRSKMDDIEKEALMLEMTNFAEFKKET 862

Query: 869  QLEE-------PVGTGTKKKAGVRKLSELRKQLSDIQKETNEVTKFNVEERVKELFNQXX 921
            ++E+       P      +   V++L+ LR++L+ IQ+E+NE++KFNVEERV ELF +  
Sbjct: 863  KVEDLPRLQSPPKIERNVRSEKVKELAALRQRLAVIQQESNEISKFNVEERVNELFYEKK 922

Query: 922  XXXXXXXXXXXTTYKGFGIDFNANA--LLESK---GGDIHWND-------DEIDGQDLQG 969
                         Y+ FGIDFN  +  L+E+     GD    +       + +D   L  
Sbjct: 923  TKALDRLRDLEEKYRSFGIDFNMESELLIETDREGDGDASVGEASNSTAPNSLDSCVLDP 982

Query: 970  AQ--EKMDEMDRIANELTAMKMKVE 992
            A+   K++EM +I  EL  +K +V+
Sbjct: 983  ARLDAKIEEMTKILEELNRLKCQVD 1007

 Score = 50.4 bits (119), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 55/121 (45%), Gaps = 26/121 (21%)

Query: 1022 TASEFSQKSFGSGAGSFLEALSQKYGAGQNTT---------ISNSPFPGVD---RKSSNH 1069
             A E S     +   SFLE+LSQKYG G N            S+S F   D   R S  H
Sbjct: 1095 VAMERSDSILTTSNTSFLESLSQKYGTGTNLQPAEDGAKRLSSSSAFRAGDSSQRNSGYH 1154

Query: 1070 RTSFANRMKKSNATP----YFDELTRKVAKAPSLNDPSSPGSNEPGDDDTLPATSPTVPQ 1125
            R SF NRMKK N+TP    + DE+++K+        P S  +          ATS + PQ
Sbjct: 1155 RKSFVNRMKK-NSTPKSSSFVDEVSQKMTPVHVAQSPDSLQNT---------ATSSSTPQ 1204

Query: 1126 S 1126
            S
Sbjct: 1205 S 1205

>KLLA0C02321g Chr3 complement(196533..202061) [5529 bp, 1842 aa] {ON}
            similar to uniprot|P41832 Saccharomyces cerevisiae
            YNL271C BNI1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1842

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/584 (56%), Positives = 421/584 (72%), Gaps = 28/584 (4%)

Query: 1246 SNYLEETPTFRDNYPQPHKKLKQLHWEKLDATEDSIWSSGVAEKFAGDLYEKGVLAGLEK 1305
            S  L ++P+  + YP+P KKLKQLHWEK+D   DSIW +  AEK A DL+E+GVL+ LEK
Sbjct: 1216 SPLLPQSPSLFERYPRPKKKLKQLHWEKIDNAGDSIWKNAQAEKVADDLFERGVLSQLEK 1275

Query: 1306 AFAAREIKNLATKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQ 1365
            AFAARE K+L  K KE  +KITFLS D SQQFGINLHM+S++ V D+V K++KCDR+F+ 
Sbjct: 1276 AFAARETKSLKGKSKEANEKITFLSRDVSQQFGINLHMFSNLDVKDVVGKVMKCDREFLS 1335

Query: 1366 TPSVIEFLSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQL 1425
            TPSVIEFLSK  I EV+ NLAR F+PYSTDW+G+ S++DAKPPEKDPN+LQRADQ+Y++ 
Sbjct: 1336 TPSVIEFLSKPTIIEVTNNLARYFNPYSTDWEGVTSVDDAKPPEKDPNELQRADQLYVEF 1395

Query: 1426 IFNLQAYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGN 1485
            + NLQ YWGSRMRAI +IT+Y+K+Y +LVTKLRK+D+AV  I +SE+L ++F+VILAVGN
Sbjct: 1396 MINLQPYWGSRMRAITMITTYEKDYSDLVTKLRKIDRAVQCIEQSESLRHVFDVILAVGN 1455

Query: 1486 FMNDTAKRAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRGNYPSFNDFLKELEPVLNV 1545
            +MND++K+AQGFKLSTLQRLTFIKD  NSMTFLNYVEKIIR NYP ++ F++ELEP+ +V
Sbjct: 1456 YMNDSSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVEKIIRENYPEYSHFVEELEPIFSV 1515

Query: 1546 TKISIDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDL 1605
            TKISI+QLV DC E+ Q+V NVERSIEIGNLSD SKFHPLDRVL KV+PVLPEARKK DL
Sbjct: 1516 TKISIEQLVTDCKEFSQSVINVERSIEIGNLSDPSKFHPLDRVLNKVVPVLPEARKKADL 1575

Query: 1606 LDDEVRLSIMEFENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQNLKVEEEERVY 1665
            L DE++LS++EFENLM+K+GED                 + E+KKA+  N+K+EEEER Y
Sbjct: 1576 LSDEIKLSLLEFENLMKKFGEDANDKFSKNSFFQKFADFITEFKKAKTHNVKLEEEERAY 1635

Query: 1666 ERHKKMVEEQQRREQTPSKNRDYVVNXXXXXXXXXXXXXXXXXXKLLDQLKNAGPTTSDP 1725
            ER KKM+E+QQR++Q      D                      KLLD+LKNA P+  DP
Sbjct: 1636 ERRKKMIEDQQRKQQ----EADSKATAKNLSTSQEPSDDRDDIEKLLDKLKNAAPSKGDP 1691

Query: 1726 SSARKRALMRRKLQADKDAAAHLISDLDSNEDSIVYSPNASQDQSANAEEASPTVHKGSN 1785
            SS RKRAL R+KL  D  + A +  ++ +  DS +    A  +Q+    E SPT  K ++
Sbjct: 1692 SSTRKRALARKKL-LDGKSGASIFDNITA--DSTI---EAFVEQNRTLTE-SPTAKKSAS 1744

Query: 1786 KNNKPVLSDLESPIKASRNADRXXXXXXXXISDKAKNLLMELSG 1829
                  L + ES   + ++            +D+A+NLL+EL G
Sbjct: 1745 ------LPETESLSSSKQDP-----------ADRARNLLLELRG 1771

 Score =  507 bits (1306), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 320/849 (37%), Positives = 466/849 (54%), Gaps = 74/849 (8%)

Query: 310  PPTYYVKKIIADDLTIDELNDLWVTLRTEQLDWVDAFLEHQGHIAMANVLMKSLYKTT-- 367
            PP YYV++II+  +   ELNDLWV+LRTE LDWV +FLE QG +A+AN+++ S+++ T  
Sbjct: 267  PPEYYVRQIISKKIKNKELNDLWVSLRTEPLDWVISFLEAQGQVAIANLIITSMHQDTTD 326

Query: 368  -QEVKLTEKSLEREASYFKCFRVLVMLAQGLYEFTKHAIMAETVAYALFSIRLPTRKMAT 426
             Q      + LERE + FKC RVL+ + + L E     ++   +   L S ++PTR++AT
Sbjct: 327  NQNAVTDPQFLERETALFKCLRVLLNIRECLEEAVNSTLVTNALVEGLLSTKIPTRRLAT 386

Query: 427  EIFVCMLEKKN--KSR------FDVILTALDKKFMIGENLHM-MQFVKN-------SPQQ 470
            E  + ++ K    KSR      F +++ +L+ +  + +N+HM  +F  N       +PQ 
Sbjct: 387  ETLIYLVTKDEDFKSRTAGLDCFSLVMESLNHETSLVQNIHMKAKFSTNDSTDPESNPQL 446

Query: 471  FIHLKRDSQFKIVQAWLTGLETALQGRGKMGSLVGASEEVRAAGGENSILEYSQWTMVFI 530
            +         KI+Q WL  +E  L GRGKMGSLVGAS+E R   GENSI EY   ++V I
Sbjct: 447  Y------QVCKILQQWLYVVEQTLDGRGKMGSLVGASDEYRNNTGENSIYEYLVDSIVLI 500

Query: 531  NHLCMGTDVVNQRVLLRTRLENAGALRIMNRFKLLDYDKITAQIEYYENGKLDDINNLLE 590
            + LC+  + V +R ++RT+L++ G  RI+ + +LLDY  ++  +  +E+  +DD N+L++
Sbjct: 501  DQLCLNNEDVKKRHMMRTQLKSFGLNRILQKMQLLDYPPLSTMLLQFEDAAIDDYNSLID 560

Query: 591  SEGRNTQVNMQDPMMMLQTMWDYCKGTENEKTFISLIKHLFLSSSKVADDRGDPSKLAKQ 650
            S+     V+M DP+ +LQ +    KGTE E   +S++++LFLSS+K A +  DP K  +Q
Sbjct: 561  SQKFTENVDMDDPVSILQKLTSSFKGTEAESYLLSMLQNLFLSSNKNAQESDDPGKNVQQ 620

Query: 651  LKLMDSLXXXXXXXXXXXXXXXXXXIQRLYDAMQTDEVARRAILESRQLTKELEEIQAER 710
            LKL+DSL                  IQRLYD+MQTDE+ARRAILESR+LTK+LEE++AER
Sbjct: 621  LKLIDSLISNVAITTLDSESNFNVAIQRLYDSMQTDEIARRAILESRELTKKLEEVKAER 680

Query: 711  DFLRQKLNSTGDGIVGRLEEELKQRDDILAKNQRVNRHLQAXXXXXXXXXXXXXXXXXXX 770
            D+L  K++   +G+VG+L++EL +RD IL K QRV   LQ+                   
Sbjct: 681  DYLNDKISKAENGLVGQLQKELAERDLILDKTQRVTEQLQSELEELKKRHLLEKHEHEIE 740

Query: 771  XXXMLTILNARPDDENLAKSTKVTKSVNGLDPDRQTSIQKALQDGLQRTRKDLSVDSKRF 830
               MLTI+N++  D+ L   + V      L+P+R+T+IQ  LQ  LQ+T +DL  +S+R 
Sbjct: 741  LRKMLTIVNSKTSDD-LESGSTVQNDPKPLNPERKTAIQNVLQRSLQKTEQDLLNESRRL 799

Query: 831  GITVQPNKRLRMLRMKMEGIEQEARELEMTNFAEHEEKQ---LEEPVGTGTKKKAGVRKL 887
            G  V    RL++LR KME IE +ARELEMTNFA+ + KQ    +E V     K     KL
Sbjct: 800  GTAVGSKSRLKLLRSKMEDIENQARELEMTNFADVKPKQNQKFKEQV-----KGQQATKL 854

Query: 888  SELRKQLSDIQKETNEVTKFNVEERVKELFNQXXXXXXXXXXXXXTTYKGFGIDFNANAL 947
            +ELRK+L+ IQ E+N++TKFN+E RV ELF                 Y GF IDF  +  
Sbjct: 855  AELRKKLAIIQNESNDITKFNIEARVNELFQDKKLAALDRLKDLENKYNGFHIDFADDPE 914

Query: 948  LE------SKGGDIHWNDDEIDGQDLQGAQEKMDEMDRIANELTAMKMKVEIQNQQQHXX 1001
            L+      S GG            D    Q K++EM+ I +EL A+K   E++N+ +   
Sbjct: 915  LKELLTQSSNGG---------PSLDPTIVQRKVEEMNSIIDELNALKE--EMKNRPKTGS 963

Query: 1002 XXXXXXXXXXXXGATGSRTDTASEFSQKSFGSGAGSFLEALSQKYGAGQNTTISN----- 1056
                         ++   +  +         S   SFLE+LSQKY  GQ T  S      
Sbjct: 964  SSSSSSSLSSASSSSEDGSSQSQASHGSDIVSNGSSFLESLSQKYSTGQQTATSTNGGRV 1023

Query: 1057 ---SPFPGVDRKSSNHRTSFANRMKKSNAT---------PYFDELTRKVAKAPSLND-PS 1103
               + +PG    S  HR SF NR+K +            P+  EL  KV     ++D P 
Sbjct: 1024 GRETRYPG----SGYHRKSFLNRLKNTTVNPTATSEHLPPFLTELKSKVKMTDDIDDVPV 1079

Query: 1104 SPG-SNEPG 1111
              G S  PG
Sbjct: 1080 GIGISVSPG 1088

 Score = 66.2 bits (160), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 44/62 (70%)

Query: 169 LGRFMRPDGKVRLDMPQDYHEVESLFEDIMYKRNIMQTLPPEKQQELRNYDIDKKWLIVR 228
           L RF+  DG ++LD P++  E+  LF D++ KRN+  ++  + Q+++ NY I+KKWL+V+
Sbjct: 149 LNRFLTNDGTLKLDRPENPEEINGLFMDLLIKRNVFDSVSSQDQKDMLNYPIEKKWLMVK 208

Query: 229 QD 230
           QD
Sbjct: 209 QD 210

>NCAS0G00120 Chr7 (7566..11510) [3945 bp, 1314 aa] {ON} Anc_5.717
          Length = 1314

 Score =  303 bits (777), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 158/421 (37%), Positives = 255/421 (60%), Gaps = 12/421 (2%)

Query: 1264 KKLKQLHWEKLDATEDSIWSSGVA-EKFAGDLYEKGVLAGLEKAFAAREIKNLATKKK-- 1320
            KK+KQ+HWEK++  E++ W +    E+   +L   G+   +E  F  + +  +  KKK  
Sbjct: 818  KKIKQIHWEKIEDIENTFWDNEQEREETVTELRHMGIFKQIEDIFKMKNVSVIMKKKKVV 877

Query: 1321 -EDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQTPSVIEFLSKSEIT 1379
                + I+FLS D +QQFGINLH++  +S ++LV K+L+CD D ++  SV+EF  K E+T
Sbjct: 878  SSSTELISFLSRDLAQQFGINLHIFVQLSEDELVSKVLRCDDDILENVSVLEFFCKEEMT 937

Query: 1380 EVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQLIFNLQAYWGSRMRA 1439
             ++ +L R+ +PYSTD+   +S+     P K+P++LQRAD+I+L+L FNL++YW  R + 
Sbjct: 938  HINPSLVRHLTPYSTDYMNPESV-----PTKNPDELQRADKIFLKLSFNLRSYWNERSQC 992

Query: 1440 IKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGNFMNDTAKRAQGFKL 1499
            + ++ +Y+K+Y +L+ KL+K+D A+  I  SE   N+  +I+ +GNFMN   +   G +L
Sbjct: 993  LLLLCTYEKDYYDLLYKLQKIDDALQRIYHSERFKNLLYIIVEIGNFMN--TRPVSGIRL 1050

Query: 1500 STLQRLTFIKDTN-NSMTFLNYVEKIIRGNYPSFNDFLKELEPVLNVTKISIDQLVNDCN 1558
            S L +L FIK  N N+++FL+Y+E++IR +Y     F+ +L  V  + KIS+DQ+   C 
Sbjct: 1051 SALNKLAFIKSNNDNNVSFLHYIERVIRIHYADVYGFIDDLHKVEELGKISMDQVALQCE 1110

Query: 1559 EYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDLLDDEVRLSIMEFE 1618
            E+C  +  +  +I  G LSD  K HP D++L KV   +  AR K +LL D  +LS  +FE
Sbjct: 1111 EFCSKIDKMVFNITKGKLSDPLKLHPDDQILKKVKYKINRARTKGELLGDHFKLSNNDFE 1170

Query: 1619 NLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQNLKVEEEERVYERHKKMVEEQQRR 1678
             +M+ YGED                    +KK   +N++ EE ERVY + KK++E   R+
Sbjct: 1171 KVMRYYGEDPTDVESKSVFFQTFVEFSTLFKKCAKENMEREEAERVYAQRKKIMEASTRK 1230

Query: 1679 E 1679
            +
Sbjct: 1231 D 1231

 Score = 37.4 bits (85), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 100/234 (42%), Gaps = 23/234 (9%)

Query: 519 ILEYSQWTMVFINHLCMGTDVVNQRVLLRTRLENAGALRIMNRFKLLDYDKITAQIEYYE 578
           I +Y    +  IN +  G      +  +   L+ +    ++   + +D + I  Q++ ++
Sbjct: 339 ISDYFSSMLFLINSIVQGFQSFTTKKNILAELKRSEVYTLLYLLEDIDCNVIQEQVKLFK 398

Query: 579 NGKLDDINNLLESEGRNTQVNMQDPM-MMLQTMWDYCKGTENEKTFISLIKHLFLSSSKV 637
               D   N+LE   R + V++  P   +LQ + +    T+ E    SL+  +  S +K 
Sbjct: 399 ----DTEENILEVTSRESGVHIDSPYGSILQQLTNLTSNTQLEPQINSLLDLILKSVNKK 454

Query: 638 ADDRGDPSKLAKQLK--LMDSLXXXXXXXXXXXXXXXXXXIQRLYDAMQTDEVARRAILE 695
                + SKL + ++  L  SL                  +  L D++Q+DE+A+RA+L 
Sbjct: 455 T--YSESSKLLQFMESFLQYSLDNSNHNHYEHPETLFQESVNNLMDSLQSDEIAKRAML- 511

Query: 696 SRQLTKELEEIQAERDFLRQKLN-----STGDGIVGRLEEELKQRDDILAKNQR 744
                 EL+E Q++ + L  +L       T D     + ++LKQ  D+L    R
Sbjct: 512 ------ELDEKQSQMNILSNQLTKLRNEKTMDK--SDILDQLKQVTDLLESKDR 557

>SAKL0E15224g Chr5 complement(1269114..1273121) [4008 bp, 1335 aa]
            {ON} some similarities with uniprot|P40450 Saccharomyces
            cerevisiae YIL159W BNR1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1335

 Score =  298 bits (764), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 152/418 (36%), Positives = 267/418 (63%), Gaps = 13/418 (3%)

Query: 1265 KLKQLHWEKLDATEDSIWSSGVAEKFAGD-LYEKGVLAGLEKAFAAREI---KNLATKKK 1320
            KL+Q+HW+ ++   ++ WS     K     L E GV   +E+ F  ++    K    K  
Sbjct: 859  KLRQIHWDNIEDIRETFWSEEEERKEKSKELQELGVFEEIEELFRIKQPVPKKPNVAKTS 918

Query: 1321 EDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQTPSVIEFLSKSEITE 1380
            ++LKK++FLS D +QQFGINLHM+S+ +V++LV+K+L C+ + ++  SV+EF +K ++T 
Sbjct: 919  QNLKKVSFLSRDLAQQFGINLHMFSNYTVHELVLKVLHCENEVVKNQSVLEFFNKEDLTN 978

Query: 1381 VSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQLIFNLQAYWGSRMRAI 1440
            +S ++ +NF PYST+      +   + P KD ++L+RAD+I+L+L +NL++YW +RMR +
Sbjct: 979  ISQSVKKNFEPYSTN------VLTGEGPTKDVSELERADRIFLELCYNLRSYWRARMRCL 1032

Query: 1441 KVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGNFMNDTAKRAQGFKLS 1500
             ++ +Y+K+Y +++ KL+K+D A  AI  S+ L  +  +I+ +GN+MN+  ++A+G KLS
Sbjct: 1033 LILLTYEKDYYDILYKLQKIDDATRAIRNSKRLKELLFIIVEIGNYMNN--RQARGIKLS 1090

Query: 1501 TLQRLTFIK-DTNNSMTFLNYVEKIIRGNYPSFNDFLKELEPVLNVTKISIDQLVNDCNE 1559
            +L +L F+K  TNN+M+FL+Y+E+I+R  Y      + +L  + ++ K+++DQ+  DC E
Sbjct: 1091 SLGKLAFVKASTNNNMSFLHYIERILRTKYMDLYGVIDDLSKISHLGKLTVDQVELDCRE 1150

Query: 1560 YCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDLLDDEVRLSIMEFEN 1619
            + + + N+ERS + G+LS +  FHP D ++ K    +P A++K  LL D+ +L++ + E 
Sbjct: 1151 FNERIDNMERSFKTGDLSKTQNFHPEDLIVSKTKHKIPIAKRKRSLLMDQCKLTMHDLEK 1210

Query: 1620 LMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQNLKVEEEERVYERHKKMVEEQQR 1677
            LM   GE+                 V  +KKA  +N++ EE ER+YE+ KK++E ++R
Sbjct: 1211 LMTYCGEEPKDHNAKNTFFQNFIDFVSLFKKAARENIEKEEVERIYEQRKKLLEIKER 1268

 Score = 39.7 bits (91), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 48/74 (64%), Gaps = 4/74 (5%)

Query: 676 IQRLYDAMQTDEVARRAILESRQLTKELEEIQAERDFLRQKLNSTGDGIVGRLE---EEL 732
           + ++ D++Q+DE+ARRA+ E   L + ++++ AE + L+++   T   ++ +LE   E L
Sbjct: 472 LNQMMDSLQSDEIARRAMKELNSLQETVDQLTAEVESLKEERKVTKGEVIMQLEEARESL 531

Query: 733 KQRDDILAK-NQRV 745
           + +D+ L + N+R+
Sbjct: 532 RDKDETLKQLNERI 545

>Ecym_4004 Chr4 (8927..13291) [4365 bp, 1454 aa] {ON} similar to
            Ashbya gossypii AFR301C - AGL364C
          Length = 1454

 Score =  288 bits (736), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 146/424 (34%), Positives = 254/424 (59%), Gaps = 25/424 (5%)

Query: 1262 PHKKLKQLHWEKLDATEDSIW---SSGVAEKFAGDLYEKGVLAGLEKAF--------AAR 1310
            P  KLKQ+HW+K+D  ++++W   S  V++  + +L   G+   +++ F         A 
Sbjct: 958  PKLKLKQIHWDKIDDIKETVWCDQSQRVSK--STELASFGIFQEIDELFQLNPTSPAIAN 1015

Query: 1311 EIKNLATKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQTPSVI 1370
               NL   K     K++ LS + +Q+FGINLH++SH +V +L  K+L CD + ++  SVI
Sbjct: 1016 ATANLLKAKS---TKVSLLSRELAQEFGINLHIFSHYTVEELTSKVLNCDNEVLKNQSVI 1072

Query: 1371 EFLSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQLIFNLQ 1430
            EF  K EI  +  ++ + F+PYS ++         + P++DPN+L RAD+IYL+L +NL+
Sbjct: 1073 EFFCKEEINNIPKSVQQLFAPYSANYI------TGEQPDRDPNELDRADRIYLELFYNLR 1126

Query: 1431 AYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGNFMNDT 1490
            +YWG+R + + VI ++DK+Y +++ KL ++D A  A+  S  L  +F +I+ +GN+MN  
Sbjct: 1127 SYWGARSKYLLVILTFDKDYFDILHKLERIDDATKALQNSAKLKELFFIIVEIGNYMNQ- 1185

Query: 1491 AKRAQGFKLSTLQRLTFIK-DTNNSMTFLNYVEKIIRGNYPSFNDFLKELEPVLNVTKIS 1549
             +   G +LS+L +L F K  T+N+M+F++ +E+I+R  YPS +DF++ L+ +L V  I 
Sbjct: 1186 -RPVAGIQLSSLNKLAFTKTSTDNNMSFIHVIERIVRRKYPSIHDFVEGLDKILEVQNII 1244

Query: 1550 IDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDLLDDE 1609
            +  +  + +E+C  + ++ER   IG LSD S+FHP D+ ++K    +  A+KK DLL D+
Sbjct: 1245 VQHVQQEAHEFCDRIAHLERLTTIGILSDPSRFHPEDKFMLKTESKILLAKKKADLLKDQ 1304

Query: 1610 VRLSIMEFENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQNLKVEEEERVYERHK 1669
              L++ +FE LM  +GE+                 +  ++KA  +N + EE  R+YE+ +
Sbjct: 1305 CTLTMSDFEKLMVYWGENPNNTNSKNSFFKKFIDFITLFRKAGKENSEREEMTRIYEKRR 1364

Query: 1670 KMVE 1673
            + +E
Sbjct: 1365 RALE 1368

 Score = 34.7 bits (78), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 57/289 (19%), Positives = 123/289 (42%), Gaps = 46/289 (15%)

Query: 486 WLTGLETALQGRGKMGSLVGASEEVRAAGGENSILEYSQWTMVFINHLCMGTDVVNQRVL 545
           WL  +ET ++   +    V ++++      +  +++Y   TM  IN L  G      +  
Sbjct: 289 WLEAVETTIKDETQWHDDVPSNQK-----PQQLMIDYCVSTMFLINSLIQGIPTYRGKSR 343

Query: 546 LRTRLENAGALRIMNRFKLLDYDKITAQIEYYENGKLDDINNLLESEGR-NTQVNMQDPM 604
           L   L++AG  RI +R        +++  ++     LD+I+     EG  N++  +  P 
Sbjct: 344 LIRLLKDAGIHRIFHRI-------VSSGEKFDSEILLDEISKYQSREGEINSKFVIDTPT 396

Query: 605 MM-------LQTMWDYCKGTENEKTFISLIKHLFLSSSKVADDRGDPSKLAKQLKLMDSL 657
            +       ++T+    +GT  E ++++L+    L S +        ++  K L+L  S+
Sbjct: 397 HLNVSFKSQIKTIVTLTQGTSLE-SYMTLV----LDSIRQIVTSRTSAEATKLLQLFQSI 451

Query: 658 XXXXXXXXXX-----XXXXXXXXIQRLYDAMQTDEVARRAILESRQLTKELEEI------ 706
                                  + +L D +Q+ +V +RA+ E  ++  ++EE+      
Sbjct: 452 FKYLIEHSYEDEELGTEIALQASLNKLMDDLQSKQVNQRAVQELEEMKVKMEEMKRVIAK 511

Query: 707 -----QAERDFLRQKLNSTGDGIVGRLE-----EELKQRDDILAKNQRV 745
                +  +  + ++LN+T   +  +L+     EE  +  +IL KN+R+
Sbjct: 512 LEHQKEIAKSVIAKELNATKAALSIKLDYITELEERLESVEILRKNERM 560

>AFR301C Chr6 complement(981209..986176) [4968 bp, 1655 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL159W
            (BNR1)
          Length = 1655

 Score =  287 bits (735), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 152/437 (34%), Positives = 257/437 (58%), Gaps = 28/437 (6%)

Query: 1253 PTFRDNYPQPHK---KLKQLHWEKLDATEDSIWS---SGVAEKFAGDLYEKGVLAGLEKA 1306
            PT     P P     KLKQ+HW+K++  ++++W      V++  + +L   G+   +E+ 
Sbjct: 1150 PTMLTQQPSPPSTRIKLKQIHWDKIENIKETVWCDEQQRVSK--SSELESLGIFKEIEEL 1207

Query: 1307 FAAREIK----NLATKKKEDLK----KITFLSHDFSQQFGINLHMYSHMSVNDLVIKILK 1358
            F   EIK    NLA      LK    +I+ LS + +Q+FGINLH++S  +V +LV K+L 
Sbjct: 1208 F---EIKPASTNLANATASLLKAKSSRISLLSRELAQEFGINLHVFSLYTVEELVDKVLS 1264

Query: 1359 CDRDFMQTPSVIEFLSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRA 1418
            CD + M+   V+EF  K E   V  ++ R F PY T++         + PEKDP +L+RA
Sbjct: 1265 CDSEVMKNQGVLEFFCKEEANNVPQSIQRLFGPYETNY------LTGERPEKDPAELERA 1318

Query: 1419 DQIYLQLIFNLQAYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFN 1478
            D+IYL+L +NL++YW +R   + VI++++++Y +++ KL+++D A  AI  S  L  +F 
Sbjct: 1319 DRIYLELFYNLRSYWAARSNYLLVISTFERDYFDILYKLQRIDDATKAIQSSNKLKELFF 1378

Query: 1479 VILAVGNFMNDTAKRAQGFKLSTLQRLTFIKDT-NNSMTFLNYVEKIIRGNYPSFNDFLK 1537
            +I+ +GN+MN   K  QG +LS+L +L F K   +N+++F++ +E+I+R  YPS +DF++
Sbjct: 1379 IIVEIGNYMNQ--KPVQGIQLSSLNKLAFTKTIKDNNLSFIHVLERIVRTRYPSVHDFVE 1436

Query: 1538 ELEPVLNVTKISIDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLP 1597
             +  +  V  I +  +  + +E+C  + N++RS+  G LSD SKFHP DR L +    L 
Sbjct: 1437 GINSITGVANIIVQHVQQEAHEFCDRIANLDRSLASGKLSDPSKFHPKDRFLQRTDTKLA 1496

Query: 1598 EARKKCDLLDDEVRLSIMEFENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQNLK 1657
            +A+KK  LL D+  L+I +FE LM  +GE+                 +  ++KA  +N +
Sbjct: 1497 QAKKKARLLRDQCSLTISDFEKLMLYWGENPANPNSKNTFFQKFIDFILLFRKAAKENTE 1556

Query: 1658 VEEEERVYERHKKMVEE 1674
             EE +R YE+ ++++E+
Sbjct: 1557 REELDRTYEKRRRLLEQ 1573

>TDEL0F05560 Chr6 complement(1037567..1041445) [3879 bp, 1292 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1292

 Score =  280 bits (717), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 144/422 (34%), Positives = 247/422 (58%), Gaps = 13/422 (3%)

Query: 1261 QPHKKLKQLHWEKLDATEDSIWS-SGVAEKFAGDLYEKGVLAGLEKAFAAREIKNLATKK 1319
            +P + LKQ+HWEKL+  E+++W+     ++   +L   G+ + +E++F  +E     TK 
Sbjct: 798  KPKEALKQIHWEKLNDIEETLWADQNQKDETMKELKRGGIFSQIEESFKVKERTIKQTKN 857

Query: 1320 KEDLKKI---TFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQTPSVIEFLSKS 1376
            K+  +K    +FL  D +QQFGINLHM+S  S    V+K+L+CD + +Q  + +EF ++ 
Sbjct: 858  KDKREKTPTKSFLPRDVAQQFGINLHMFSQYSPEQFVLKVLQCDNEIIQNSTALEFFTRE 917

Query: 1377 EITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQLIFNLQAYWGSR 1436
            ++  V+ +L R F PYSTD+      ED   P KDP +L R D+I+L+L +NLQ YW  R
Sbjct: 918  DLVNVTQSLRRAFDPYSTDYLS----EDG--PSKDPAELDRPDRIFLELCYNLQYYWYER 971

Query: 1437 MRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGNFMNDTAKRAQG 1496
               +  +T+Y+++Y + + +L+K+D  +  +       +I  +I+ +GN+MN   + A+G
Sbjct: 972  SFCLFTLTTYERDYYDFIYRLQKIDDVIQKLRHGTRFKSILYIIVEIGNYMN--KRPAEG 1029

Query: 1497 FKLSTLQRLTFIKDT-NNSMTFLNYVEKIIRGNYPSFNDFLKELEPVLNVTKISIDQLVN 1555
             KLS+L +L F+K + + + +FL+++E+IIR  YP    F  +L  V ++ KIS+D L  
Sbjct: 1030 IKLSSLNKLAFVKSSVDKNTSFLHFLERIIRVKYPDLYGFTDDLSKVEDIGKISLDHLEQ 1089

Query: 1556 DCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDLLDDEVRLSIM 1615
            +CNE+   +  V  +++ G LSD S+ HP D ++ K+   +  A+ K DLL D+ +L  +
Sbjct: 1090 ECNEFRSKIDEVVHTLKEGKLSDHSRLHPKDLIVEKITYKIRRAKVKSDLLQDQFKLINI 1149

Query: 1616 EFENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQNLKVEEEERVYERHKKMVEEQ 1675
            + + LM  +GED                    +KK   +N++ E+ +RVYE+ K M+E +
Sbjct: 1150 DLKKLMSHFGEDFNDSEAKNSFFQHFIEFSVNFKKCAKENIEREDSQRVYEQRKNMLESR 1209

Query: 1676 QR 1677
            QR
Sbjct: 1210 QR 1211

>ZYRO0B16654g Chr2 complement(1351398..1355672) [4275 bp, 1424 aa]
            {ON} some similarities with uniprot|P40450 Saccharomyces
            cerevisiae YIL159W BNR1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1424

 Score =  280 bits (715), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 146/421 (34%), Positives = 245/421 (58%), Gaps = 18/421 (4%)

Query: 1261 QPHKKLKQLHWEKLDATEDSIWSSGVA-EKFAGDLYEKGVLAGLEKAF-----AAREIKN 1314
            +P + LKQ+HWEK+D  E ++W      E+   +L   G+   ++  F       +++KN
Sbjct: 848  KPKQSLKQIHWEKIDDVEKTVWEDNEQREETVKELEISGIFEKVQTTFQLKNSTVKKVKN 907

Query: 1315 -LATKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQTPSVIEFL 1373
              +TKK   LK  +FLS D +QQFGINLHMYS   V + V+K+L+CD D +Q  SV+EF 
Sbjct: 908  DNSTKKTTQLK--SFLSRDLAQQFGINLHMYSQYPVEEFVLKVLRCDNDILQNVSVLEFF 965

Query: 1374 SKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQLIFNLQAYW 1433
            +  E+T +  +L+R+F+PYS D+      ++ K P  DPN+L+R D+I+L+L +NL++YW
Sbjct: 966  NNEELTNIPASLSRSFAPYSADF------QENKSPTVDPNELERPDRIFLELCYNLRSYW 1019

Query: 1434 GSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGNFMNDTAKR 1493
              R + + +  +Y+++Y +LV KL+ +D A+  I  +  L  +  +I+ +GN+MN   K 
Sbjct: 1020 RERSKCLLIFATYERDYYDLVYKLQNIDDAIQKIKNAFRLKQLLYIIMEIGNYMN--KKN 1077

Query: 1494 AQGFKLSTLQRLTFIKDT-NNSMTFLNYVEKIIRGNYPSFNDFLKELEPVLNVTKISIDQ 1552
              G +L++L +L+F+K + +N+++FL+++EK++R  YP    F  +L     +  IS D 
Sbjct: 1078 VSGIRLNSLSKLSFVKSSVDNNLSFLHFIEKVVRVKYPDIYHFTDDLNKAEALGYISFDH 1137

Query: 1553 LVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDLLDDEVRL 1612
            + ++C EYC  V +V R    G LS  S  HP D ++ KV   +  A+ K  LL D+ +L
Sbjct: 1138 IQSECEEYCSKVNSVVRMTTEGILSQQSNLHPKDEIMRKVKYKINRAKTKSQLLWDQYKL 1197

Query: 1613 SIMEFENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQNLKVEEEERVYERHKKMV 1672
               + + LM+ +GE+                    +KK   +N++ EE  RVYE+ KK++
Sbjct: 1198 ISADLDKLMKYFGENPMDKEAKNSFFANFGEFSVVFKKCAKENIEKEEAYRVYEQRKKLL 1257

Query: 1673 E 1673
            +
Sbjct: 1258 D 1258

>Kpol_416.10 s416 (35789..38224,38226..40265) [4476 bp, 1491 aa] {ON}
            (35789..38224,38226..40265) [4476 nt, 1492 aa]
          Length = 1491

 Score =  278 bits (711), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 144/427 (33%), Positives = 253/427 (59%), Gaps = 17/427 (3%)

Query: 1260 PQPHKKLKQLHWEKLDATEDSIWSSGVAEK-FAGDLYEKGVLAGLEKAFAAREI-----K 1313
            PQ  K LKQ+HW+K++  +++IW   +  +    +L    +   +E +F  +E+     K
Sbjct: 995  PQHVKNLKQIHWDKVENIDNTIWKYNLENREILKELEYGSIFNQVEDSFKIKEVVIKKSK 1054

Query: 1314 NLATKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQTPSVIEFL 1373
                K+K +LK  +FLS D +QQFGINLHMYS+ +  + +  +L C  + ++  SV+EF 
Sbjct: 1055 TEKNKEKSNLK--SFLSRDLAQQFGINLHMYSNYTEKEFLDLVLSCSDEVIKNISVLEFF 1112

Query: 1374 SKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQLIFNLQAYW 1433
             K ++  +  +++RN++PYS D+         + P KD ++L+RAD+++L+L +NL+ YW
Sbjct: 1113 CKEDLINIPGSISRNYAPYSRDYLS------GEEPVKDSSELERADKLFLELCYNLRYYW 1166

Query: 1434 GSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGNFMNDTAKR 1493
              R + + ++ +Y+++Y +LV KL+K+D A+  +L S+   +   ++L +GN+MN   K 
Sbjct: 1167 ADRSQCLLLLYTYERDYYDLVFKLQKIDDAIQRLLNSQRFRDFLYIVLEIGNYMN--KKT 1224

Query: 1494 AQGFKLSTLQRLTFIKDT-NNSMTFLNYVEKIIRGNYPSFNDFLKELEPVLNVTKISIDQ 1552
             +G K+S+L +L FIK + NN+++FL+++EK+IR  YP    F+ +L  V ++ K++++ 
Sbjct: 1225 VEGVKISSLSKLAFIKSSSNNNISFLHFIEKLIRTRYPEVYGFIDDLTKVEDLGKVTLEH 1284

Query: 1553 LVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDLLDDEVRL 1612
            +  +C+E+C  V +V  S+  G LS S K HP D +L KV   +  A+ K +LL D+  L
Sbjct: 1285 IGTECDEFCAKVNSVVYSVTNGKLSKSEKLHPNDSILKKVKYKVSRAKTKSELLKDQYNL 1344

Query: 1613 SIMEFENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQNLKVEEEERVYERHKKMV 1672
            +  +   L+  YGED                 +  +KK   +N++ EE ERVYE+ K M+
Sbjct: 1345 TKHDVTKLLVYYGEDPKDKDSNDSFFSNILEFLSVFKKCAKENIEREESERVYEQRKNML 1404

Query: 1673 EEQQRRE 1679
            E Q ++E
Sbjct: 1405 ESQSKKE 1411

 Score = 33.5 bits (75), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 28/41 (68%)

Query: 676 IQRLYDAMQTDEVARRAILESRQLTKELEEIQAERDFLRQK 716
           I  L D +Q+DE+ARRA+ E + L + ++ +Q+E   L+++
Sbjct: 511 INELMDRLQSDEIARRAMNEMKSLEQIIDNLQSEISSLKEE 551

>Ecym_5679 Chr5 (1380448..1384368) [3921 bp, 1306 aa] {ON} similar to
            Ashbya gossypii AGL364C
          Length = 1306

 Score =  276 bits (705), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 150/417 (35%), Positives = 248/417 (59%), Gaps = 16/417 (3%)

Query: 1265 KLKQLHWEKLDATEDSIWSSGVAE-KFAGDLYEKGVLAGLEKAF----AAREIKN-LATK 1318
            KLKQ+HW+K+D    ++WS        + +L   GV   +E+ F    AA ++ N + T 
Sbjct: 815  KLKQIHWDKIDDISKTVWSDDKERVSVSSELANFGVFKEIEELFKIVPAAPKVGNTMFTA 874

Query: 1319 KKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQTPSVIEFLSKSEI 1378
            +     K+T LS+D +QQFGINL+++S+ SV +LV K+L CD + M+  SVIEF SK +I
Sbjct: 875  QNTRNGKVTLLSNDLAQQFGINLYIFSNYSVEELVEKVLLCDTEVMKNQSVIEFFSKDDI 934

Query: 1379 TEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQLIFNLQAYWGSRMR 1438
              +  ++ R F+PY T++           PEKD   L RAD+IYL+L +NL++YW  R +
Sbjct: 935  NHIPQSIQRMFAPYETNY------LTGDKPEKDSRSLDRADRIYLELFYNLRSYWAPRAK 988

Query: 1439 AIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGNFMNDTAKRAQGFK 1498
             +  + +Y+K+Y +++ KL+++D    AI  S+ L  +  +I+ VGN+MN+  K+A G +
Sbjct: 989  YLLALLTYEKDYYDILYKLQRIDDGTTAIKTSKRLKPLLFIIIEVGNYMNN--KQALGIQ 1046

Query: 1499 LSTLQRLTFIKDT-NNSMTFLNYVEKIIRGNYPSFNDFLKELEPVLNVTKISIDQLVNDC 1557
            LS+L +L F K + +N+++F++ +E I+R NYP  + F+ +LE +L+V+ I +  +  + 
Sbjct: 1047 LSSLNKLAFTKTSKDNNLSFIHVIESIVRLNYPDLHGFVNDLEKILDVSNIIVQHVQQEA 1106

Query: 1558 NEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDLLDDEVRLSIMEF 1617
             E+ + ++ +ERS+ +G LSDSSKFHP D+ LI     +  A KK DLL  +  L++ EF
Sbjct: 1107 QEFYEKISTLERSLRVGVLSDSSKFHPKDKFLINTESNISHAMKKADLLKQQCTLTMGEF 1166

Query: 1618 ENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQNLKVEEEERVYERHKKMVEE 1674
            + LM  +GED                    +KKA  +N++  E  RV E  + ++E+
Sbjct: 1167 DKLMVFWGEDPNNVFSKNTFFQKFLDFALLFKKANKENIE-REVRRVCESRRYLLEK 1222

>KNAG0L02250 Chr12 complement(399706..403809) [4104 bp, 1367 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1367

 Score =  274 bits (701), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 147/432 (34%), Positives = 252/432 (58%), Gaps = 28/432 (6%)

Query: 1261 QPHKKLKQLHWEKLDATEDSIW-SSGVAEKFAGDLYEKGVLAGLEKAFAAREI-----KN 1314
            +P KKLKQ+HW+K++  ED+IW +  +       L   GVL  +E  F  +E      K+
Sbjct: 867  KPVKKLKQIHWDKVEDIEDTIWHNEEIRRDTLKHLQHDGVLKEIESTFKIKEAGPIAKKS 926

Query: 1315 LATKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQTPSVIEFLS 1374
             AT+     K ++FLS D +Q FGINLHM+S++SV++ V K+L CD D ++   V+EF +
Sbjct: 927  CATEGSASKKSVSFLSRDLAQAFGINLHMFSNLSVDEFVKKVLGCDNDIIKNVPVLEFFN 986

Query: 1375 KSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPND---------LQRADQIYLQL 1425
            + E+  +S +  R ++PY   +           PE D ++         L+R D+I+L+L
Sbjct: 987  REELGAISSSTLRKYAPYCVQY----------FPEPDASNHTTFEPLPPLERGDEIFLKL 1036

Query: 1426 IFNLQAYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGN 1485
             + L+ YW  R   + V+ +Y+K+Y ++V KL+K++ A+  + +S  L N   +I+ +GN
Sbjct: 1037 CYVLRDYWSVRSHCLLVVCTYEKDYYDIVYKLQKLEDAMRRLKESTALQNFLYIIIEIGN 1096

Query: 1486 FMNDTAKRAQGFKLSTLQRLTFIKDTNN-SMTFLNYVEKIIRGNYPSFNDFLKELEPVLN 1544
            +MN   K A G K+S+L +L FIK ++N +++FL+Y+E++IR  YP    F+ +L+ V +
Sbjct: 1097 YMN--TKAASGVKISSLNKLVFIKSSDNKNLSFLHYIERLIRTKYPDIYRFVHDLKTVED 1154

Query: 1545 VTKISIDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCD 1604
            + K+++DQL  +C+EY   +  +  +++ G LSD +K +P D VL K+      A  K  
Sbjct: 1155 LGKLTLDQLELECSEYIGKIRKMGHAVKKGPLSDPAKLYPGDMVLKKIRFKAQRANSKAQ 1214

Query: 1605 LLDDEVRLSIMEFENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQNLKVEEEERV 1664
            LL+ +++LS  +   LM+ YGED                 +Q +KK   +N++ EE +RV
Sbjct: 1215 LLESQMKLSSNDMNQLMKYYGEDPKDATTKNHFFTSFAEFLQLFKKCSRENIEREEMDRV 1274

Query: 1665 YERHKKMVEEQQ 1676
            YE+ +K++E++Q
Sbjct: 1275 YEQRRKLLEDKQ 1286

>CAGL0H06765g Chr8 complement(672619..676503) [3885 bp, 1294 aa] {ON}
            similar to uniprot|P40450 Saccharomyces cerevisiae
            YIL159w BNR1
          Length = 1294

 Score =  272 bits (696), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 144/426 (33%), Positives = 256/426 (60%), Gaps = 19/426 (4%)

Query: 1260 PQPHKKLKQLHWEKLDATEDSIWS--SGVAEKFAGDLYEKGVLAGLEKAFA----AREIK 1313
            P+   +LKQ+HWEK+D    ++W   SG+       L ++GV + +EK F      ++ K
Sbjct: 816  PKSTIRLKQIHWEKVDDVGGTLWEDVSGIP---LDHLKDEGVFSQIEKYFKILEPVKKTK 872

Query: 1314 NLATKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQTPSVIEFL 1373
             LA  + +   KI+FL+ D +QQFGINLHMYS +SV + V K+LKC+ D +Q  SV+ F 
Sbjct: 873  VLAENENKP-TKISFLTRDIAQQFGINLHMYSQLSVEEFVTKVLKCEDDLIQNVSVLGFF 931

Query: 1374 SKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQLIFNLQAYW 1433
            +K ++T++   L R F+PYST++     L D   PEKDP +L+RAD IYL+L +NL++YW
Sbjct: 932  TKEDLTQIPSGLERKFAPYSTNY-----LTD-DSPEKDPRELERADHIYLELFYNLRSYW 985

Query: 1434 GSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGNFMNDTAKR 1493
             +R   + V+T+Y+++Y +L+ KL K+D+A+  +  S  +  +  +I  +GN+MN  +  
Sbjct: 986  SARSHCLLVLTTYERDYFDLMYKLEKIDEAIQRLYDSTRIKKLLLIIREIGNYMNKGS-- 1043

Query: 1494 AQGFKLSTLQRLTFIKDTN-NSMTFLNYVEKIIRGNYPSFNDFLKELEPVLNVTKISIDQ 1552
              G KL++L +L+F+K ++  +++FL++VE+++R ++P    F +++  V ++ K++++ 
Sbjct: 1044 VTGIKLNSLPKLSFVKSSSEKNISFLHFVERVVRESFPDVYTFTEDIAKVEDLGKVTLEH 1103

Query: 1553 LVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDLLDDEVRL 1612
            +  +C E+ + V +V  S+  G LSD +K HP D +  K+   +  A+ K +LL ++  L
Sbjct: 1104 VELECEEFAEKVGSVVYSLTQGKLSDPTKLHPKDAIFTKMRYKINRAKSKSELLINQHEL 1163

Query: 1613 SIMEFENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQNLKVEEEERVYERHKKMV 1672
            +      LM+ YGE+                    +KK   +N++ EE  R+YE+ K ++
Sbjct: 1164 TKRSLNRLMKYYGEEPMDKESKNNFFNYFVEFAMVFKKCAKENIEREEVTRLYEQRKHLL 1223

Query: 1673 EEQQRR 1678
            E++ ++
Sbjct: 1224 EQRNKK 1229

>AGL364C Chr7 complement(16861..20643) [3783 bp, 1260 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL159W
            (BNR1)
          Length = 1260

 Score =  272 bits (695), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 155/453 (34%), Positives = 262/453 (57%), Gaps = 27/453 (5%)

Query: 1249 LEETPTFRDNYPQP------HKKLKQLHWEKLDATEDSIWSSGVAEKFAGD--LYEKGVL 1300
            L  T +FR +   P        KLKQ+HW+K+D  ++++W+    E+ +    L   GV 
Sbjct: 749  LSATGSFRCSLQGPVSPTSQRVKLKQIHWDKIDNIKETVWNEH-NERISTSTKLETFGVF 807

Query: 1301 AGLEKAFAA------REIKNLATKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVI 1354
              +E  F            N  T+   +  KI  LS+D +Q FGINLH++SH S  +L+ 
Sbjct: 808  KEIEDLFKVVPATPKTASSNSPTQTTRN-GKIRLLSNDLAQLFGINLHIFSHYSTEELID 866

Query: 1355 KILKCDRDFMQTPSVIEFLSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPND 1414
             +L C  + +Q   VIEF SK +I  +  +  R F+PY T++         K P+KDP  
Sbjct: 867  MVLLCHAEILQNQRVIEFFSKDDINHIPQSTQRMFAPYETNY------LTGKTPDKDPAV 920

Query: 1415 LQRADQIYLQLIFNLQAYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLS 1474
            L+RAD+IYL+L +NL++YW +R + + V+ +Y+++Y +++ KL+++D A  AI  S+ L 
Sbjct: 921  LERADRIYLELFYNLRSYWAARSKYLLVLLTYERDYYDILYKLQRIDDATKAIRSSKKLK 980

Query: 1475 NIFNVILAVGNFMNDTAKRAQGFKLSTLQRLTFIKDT-NNSMTFLNYVEKIIRGNYPSFN 1533
             +F +I+ +GN+MN+  K+A G +LS++ +L F K + +N+++F++ +E+IIR  YP  +
Sbjct: 981  QLFFIIIEIGNYMNN--KQALGIQLSSINKLAFTKTSKDNNLSFIHVIERIIRTRYPELH 1038

Query: 1534 DFLKELEPVLNVTKISIDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVL 1593
            +F ++LE V ++  I +  +  +  E+ + ++N+ERS+ +G LSDSS+FHP D+ L K  
Sbjct: 1039 NFAEDLEKVQDMANIIVQHVQQEAQEFRERISNLERSLTVGALSDSSRFHPKDQFLSKTA 1098

Query: 1594 PVLPEARKKCDLLDDEVRLSIMEFENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQN 1653
              +  ARKK +LL D+  L++ +FE L+  +GEDT                V  +KKA  
Sbjct: 1099 SSIQHARKKAELLIDQSTLTMGDFEKLVSYWGEDTKDIQSRNTFFQKFLDFVALFKKASK 1158

Query: 1654 QNLKVEEEERVYERHKKMVEEQQRREQTPSKNR 1686
            +N++ EE  R   + K+++E     E+T S  R
Sbjct: 1159 ENIEREEIRR--SQVKRVIERVPSPEKTKSVAR 1189

>Kwal_55.19620 s55 (52863..57032) [4170 bp, 1389 aa] {ON} YIL159W
            (BNR1) - involved in actin filament organization [contig
            159] FULL
          Length = 1389

 Score =  272 bits (695), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 150/431 (34%), Positives = 252/431 (58%), Gaps = 19/431 (4%)

Query: 1261 QPHKKLKQLHWEKLDATEDSIWSSGVA-EKFAGDLYEKGVLAGLEKAF----AAREIKNL 1315
            Q  ++LKQ+HW+K++  +++IW+        A  L E G+L  +   F    +A    N 
Sbjct: 916  QDSQRLKQIHWDKIEDVKETIWNEEEGRHNVALHLEESGILDEISDLFKITPSAPTKANT 975

Query: 1316 ATKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQTPSVIEFLSK 1375
                +E    +  L  D +QQFGINLHM+S++SV D V+K+L CDR  +   SV+EF ++
Sbjct: 976  GRLNEEG--PLAILPRDLAQQFGINLHMFSNLSVEDFVLKVLHCDRQIITNQSVLEFFAR 1033

Query: 1376 SEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQLIFNLQAYWGS 1435
             ++  +  +L+  F PYS+D+         K P KD + L+RAD+I+L L +NL++YW  
Sbjct: 1034 DDLVNIPHSLSLKFEPYSSDF------RLGKGPLKDSSKLERADRIFLALCYNLRSYWRQ 1087

Query: 1436 RMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGNFMNDTAKRAQ 1495
            R   +  + +Y+K+Y +++ KL++VD A+  I  S  L +   +I+ +GN+MN   K+A 
Sbjct: 1088 RSICLLTLLTYEKDYFDIMYKLQRVDDAITMIKSSHKLKDALMMIVEIGNYMN--RKQAP 1145

Query: 1496 GFKLSTLQRLTFIKDTNN-SMTFLNYVEKIIRGNYPSFNDFLKELEPVLNVTKISIDQLV 1554
            G KLS+LQ+L F+K + + +++FL+ VE+ +R    +   F+ EL  VL++  + + Q+ 
Sbjct: 1146 GIKLSSLQKLAFVKSSKDKNVSFLHVVERFLRVKCKATYGFVDELSKVLDLGNLVVGQVE 1205

Query: 1555 NDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDLLDDEVRLSI 1614
             D  EY + +  V++S++ G LSDS  FHP DR+LIKV P +  A +K  LL ++ +L++
Sbjct: 1206 QDFQEYLKRIDAVKQSLDCGRLSDSESFHPEDRLLIKVGPKMAGAARKATLLQNQFKLTM 1265

Query: 1615 MEFENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQNLKVEEEERVYERHKKMVEE 1674
               ENLM+ YGED                 + ++KKA  +N++ EE ER+Y   K+++  
Sbjct: 1266 RALENLMRLYGEDHKSVDCRNDFFHHFIQFIIQFKKAAKENIENEEVERIYNHRKELL-- 1323

Query: 1675 QQRREQTPSKN 1685
             Q++ +  SKN
Sbjct: 1324 -QQKTKASSKN 1333

 Score = 36.6 bits (83), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 38/68 (55%), Gaps = 4/68 (5%)

Query: 676 IQRLYDAMQTDEVARRAILESRQLTKELEEIQAERDFLRQKLNSTGDGIVGRLEEELKQR 735
           +  L D +Q+DE+A+RA+ E     KE+E +++E   LR+    T  G++     EL+Q 
Sbjct: 500 LNHLVDGLQSDEIAKRAMSELELAQKEIENLESEIRALRKDKEITKGGVLS----ELRQT 555

Query: 736 DDILAKNQ 743
              LA+ +
Sbjct: 556 QQALAEKE 563

>NDAI0F00160 Chr6 (21351..25400) [4050 bp, 1349 aa] {ON} Anc_5.717
          Length = 1349

 Score =  270 bits (691), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 141/428 (32%), Positives = 248/428 (57%), Gaps = 12/428 (2%)

Query: 1258 NYPQPHKKLKQLHWEKLDATEDSIWSSGVAEK-FAGDLYEKGVLAGLEKAFAAREI---K 1313
            N  Q  KKLKQ+HW+K++  ++++W      +    +L   G+   ++  F+ +++    
Sbjct: 851  NNQQSKKKLKQIHWDKIENVKNTLWDHADGRQDTILELEHAGIFEKVQGMFSVQDLVVKP 910

Query: 1314 NLATKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQTPSVIEFL 1373
              A   +E  K ++FLS DFSQQ  INLH+++ ++  +++ K+L CD D +Q  SV+EF 
Sbjct: 911  KRAVNVRESNKLLSFLSRDFSQQLAINLHIFAQLTEKEVLQKVLACDNDTIQNVSVLEFF 970

Query: 1374 SKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQLIFNLQAYW 1433
             K E+  +     R+F+PYS D+     L  ++ P K+P++L+RAD+++L L FNL+ YW
Sbjct: 971  CKDEMVNIGSARIRHFTPYSADY-----LNASEQPAKNPDELERADKLFLYLPFNLRRYW 1025

Query: 1434 GSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGNFMNDTAKR 1493
              R + + VI++Y++EY +++  L+K+D A+  I  SE       +I+ +GN+MN   K 
Sbjct: 1026 AERSQCLLVISTYEREYYDMLYNLQKIDDALQNIRHSEKFKTFLYIIIELGNYMN--TKA 1083

Query: 1494 AQGFKLSTLQRLTFIKDTNN-SMTFLNYVEKIIRGNYPSFNDFLKELEPVLNVTKISIDQ 1552
             +G +L++L +L FIK  +N + +FL++VEK++R +YP    F+ +L  V ++ KI+IDQ
Sbjct: 1084 VEGIRLNSLTKLAFIKSNDNKNFSFLHFVEKMLRIHYPDVYGFINDLNKVEDLGKITIDQ 1143

Query: 1553 LVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDLLDDEVRL 1612
            +   C EYC  +  +  S+  G LSD ++ HP D++L KV   +  A+ K +LL  + +L
Sbjct: 1144 VQLQCEEYCTKIERIAHSVTKGKLSDPTQLHPDDQILRKVKYKVTRAKTKSELLQAQFKL 1203

Query: 1613 SIMEFENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQNLKVEEEERVYERHKKMV 1672
            +  +F   M  YGED                    ++K   +N++ EE +R YE+ KK+ 
Sbjct: 1204 TNNDFRKSMLYYGEDPDDTDNKINFFNQFVEFSSLFRKCARENIEKEEADRAYEQRKKIA 1263

Query: 1673 EEQQRREQ 1680
            E + ++ +
Sbjct: 1264 ELRNKKNE 1271

 Score = 37.7 bits (86), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 44/74 (59%), Gaps = 4/74 (5%)

Query: 676 IQRLYDAMQTDEVARRAILESRQLTKELEEIQAERDFLRQKLNSTGDGIVGRLEEELKQR 735
           + +L D++ ++E+ +RA+ E ++L K ++ +  E D LR+ +N+   G V    EELKQ 
Sbjct: 499 VTKLMDSLHSNEITKRAMSELKELEKTVQSLNEEIDRLRE-INNMDKGDVL---EELKQA 554

Query: 736 DDILAKNQRVNRHL 749
           ++++    R N  L
Sbjct: 555 NELIESRDRENEEL 568

>KLLA0F10912g Chr6 (1003827..1007678) [3852 bp, 1283 aa] {ON} some
            similarities with uniprot|P40450 Saccharomyces cerevisiae
            YIL159W BNR1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1283

 Score =  268 bits (686), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 139/430 (32%), Positives = 253/430 (58%), Gaps = 18/430 (4%)

Query: 1260 PQPH-KKLKQLHWEKLDATEDSIWSSGVAEK-FAGDLYEKGVLAGLEKAFAAREIK---- 1313
            P+P  K LKQ+HW+K++   D++W+          DL EKGV   +   F  + ++    
Sbjct: 796  PKPEVKPLKQIHWDKIEDISDTLWNEPTTRSDLKEDLNEKGVFNEIVNLFEQKAVRMKKK 855

Query: 1314 -NLATKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQTPSVIEF 1372
             N+   KK +  K++ LS D +QQFGINLHM+S  SV DL+IK+L+CD D ++  SV+EF
Sbjct: 856  SNVTASKKNE--KVSLLSRDLAQQFGINLHMFSSYSVEDLLIKVLRCDDDIIKNHSVLEF 913

Query: 1373 LSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQLIFNLQAY 1432
             +K +   +  ++ R+F PY++DW      +  K P++D + L+RAD+IYL++ +N++ Y
Sbjct: 914  FNKDDFETIPQSIIRSFEPYASDW------KTGKAPKEDVSKLERADRIYLEMFYNMRYY 967

Query: 1433 WGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGNFMNDTAK 1492
            W  R  ++ +  +Y+K+Y +++ +L+K+D     I  S  L   F +++ +GNFMN+  K
Sbjct: 968  WKIRSSSLLIALTYEKDYYDILYQLQKIDDGTSMIKNSNRLKQFFYIVVEIGNFMNN--K 1025

Query: 1493 RAQGFKLSTLQRLTFIK-DTNNSMTFLNYVEKIIRGNYPSFNDFLKELEPVLNVTKISID 1551
            + QG KLS+L +L+ +K +++ +++FL+ +E+IIR  YP   DF ++L  + ++ KI+I+
Sbjct: 1026 KTQGIKLSSLNKLSMVKTNSDKNLSFLHVIERIIREKYPDIYDFTRDLNRLSDLGKINIE 1085

Query: 1552 QLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDLLDDEVR 1611
             + ++ +EY + +  ++ S E G LS + K HP D+   K+   LP A +K +LL ++ +
Sbjct: 1086 SIESEIHEYYEKIMRMKESFERGKLSHTEKHHPDDKFRKKISAKLPSAVRKAELLHNQCK 1145

Query: 1612 LSIMEFENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQNLKVEEEERVYERHKKM 1671
            L++ +F + M+  GED                 +  + K   +N + E   RV+E+ +++
Sbjct: 1146 LTMNDFNSTMKYCGEDPTNSEAKNTFFRNFSEFLTLFNKISQENKEREAMNRVHEQRQQL 1205

Query: 1672 VEEQQRREQT 1681
            +++     Q 
Sbjct: 1206 LQKASTETQV 1215

>KLTH0E00704g Chr5 (70073..74242) [4170 bp, 1389 aa] {ON} some
            similarities with uniprot|P40450 Saccharomyces cerevisiae
            YIL159W BNR1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1389

 Score =  266 bits (680), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 147/419 (35%), Positives = 249/419 (59%), Gaps = 16/419 (3%)

Query: 1265 KLKQLHWEKLDATEDSIWSS-GVAEKFAGDLYEKGVLAGLEKAFAAREIKNLATKKKEDL 1323
            KLKQ+HW+KL+   ++IWS  G  +  A  L   G L  + + F  R  ++L  K K + 
Sbjct: 920  KLKQIHWDKLEDVSETIWSQEGERQDAARHLESSGFLDEIAELF--RVNQSLPIKAKSET 977

Query: 1324 K----KITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQTPSVIEFLSKSEIT 1379
                 K++ L  D +QQFGINLHM+S++SV++ V K+L CDRD +   SV+EF ++ +++
Sbjct: 978  SSGKDKVSILPRDLAQQFGINLHMFSNLSVDEFVNKVLHCDRDVVNNQSVLEFFAREDLS 1037

Query: 1380 EVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQLIFNLQAYWGSRMRA 1439
             +  ++A    PY+TD       +  + P  D   L+RAD+I+L+L +NL++YW  R   
Sbjct: 1038 IIPRSIASKLEPYATDH------QPNEAPLLDREKLERADRIFLELCYNLRSYWRPRSLC 1091

Query: 1440 IKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGNFMNDTAKRAQGFKL 1499
            +  +++Y+K+Y +L+ KL++VD A+  I  S  L +   +I+ +GN+MN   K+A G +L
Sbjct: 1092 LLTLSTYEKDYFDLIYKLQRVDDAINIIKNSAKLKDTLMMIIEIGNYMN--RKQAGGIRL 1149

Query: 1500 STLQRLTFIKDTNN-SMTFLNYVEKIIRGNYPSFNDFLKELEPVLNVTKISIDQLVNDCN 1558
            S+LQ+LTF+K + + +M+ L+ VE+ +R    S   F+++L  VL++  + + Q+  D +
Sbjct: 1150 SSLQKLTFVKSSKDKNMSLLHAVERFLRVKCRSAYGFVEDLSRVLDLGNLMVGQIEQDFH 1209

Query: 1559 EYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDLLDDEVRLSIMEFE 1618
            EY Q ++ V++S+E G LS    FHP DR+LIKV P +  A +K  LL ++  L++   E
Sbjct: 1210 EYTQRISGVKQSLEQGRLSKPENFHPEDRLLIKVGPKIAGATRKASLLRNQFVLTMRALE 1269

Query: 1619 NLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQNLKVEEEERVYERHKKMVEEQQR 1677
            NLM+ YGED                 V ++KK   +N + E  ER+Y + K++++ + +
Sbjct: 1270 NLMKLYGEDPSNIDSKNEFFQHFINFVSQFKKVAKENEEKEAVERIYIQRKELLQNRSK 1328

>Smik_9.9 Chr9 (19563..23687) [4125 bp, 1374 aa] {ON} YIL159W (REAL)
          Length = 1374

 Score =  261 bits (668), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 141/433 (32%), Positives = 245/433 (56%), Gaps = 33/433 (7%)

Query: 1260 PQP-HKKLKQLHWEKLDATEDSIWSSGVA--EKFAGDLYEKGVLAGLEKAFAAREIKNLA 1316
            P P  K+LKQ+HW+K++  +D++W  G+   E   G L   G+ + +E  F  +    +A
Sbjct: 870  PVPTEKRLKQIHWDKVEDIKDTLWEDGLQRQETIRG-LQTDGIFSQIEDIFKMKSPTKIA 928

Query: 1317 TK---------------KKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDR 1361
             K                  +LKKI+FLS D +QQFGINLHM+S +S  + V+K+LKCD 
Sbjct: 929  NKTSAISSTVLSSNNGKSSNELKKISFLSRDLAQQFGINLHMFSQLSDMEFVMKVLKCDN 988

Query: 1362 DFMQTPSVIEFLSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQI 1421
            D +Q  ++++F  K E+  +  +L   + PYS   +G           K  +DLQRAD+I
Sbjct: 989  DIVQNVNILKFFCKEELVNIPKSLLNKYEPYSRGENG-----------KAASDLQRADRI 1037

Query: 1422 YLQLIFNLQAYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVIL 1481
            +L+L  NL+ YW  R +++  +++Y+++Y +L+ KL+ +D  +  + +S+   N+  +I 
Sbjct: 1038 FLELCINLRFYWNVRSKSLLTLSTYERDYYDLIFKLQNIDDGISHLNRSDKFKNLMFIIT 1097

Query: 1482 AVGNFMNDTAKRAQGFKLSTLQRLTFIK-DTNNSMTFLNYVEKIIRGNYPSFNDFLKELE 1540
             +GN MN   +  +G KL +L +L F++  T+ +M+FL+++EKIIR  YP    F+ +L+
Sbjct: 1098 EIGNHMN--KRIVKGIKLKSLTKLVFVRSSTDQTMSFLHFIEKIIRIKYPDIYGFVDDLK 1155

Query: 1541 PVLNVTKISIDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEAR 1600
             V ++ KIS++ +  +C+E+   + N+    + G LS+     P D+++ KV   +  AR
Sbjct: 1156 KVEDLGKISLEHIEIECHEFHNKIENLVTQFQTGKLSNEENLDPRDQIVKKVKFKINRAR 1215

Query: 1601 KKCDLLDDEVRLSIMEFENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQNLKVEE 1660
             K +LL D+ +L++++   LM+ YGED                 +  +KK   +N++ EE
Sbjct: 1216 IKSELLMDQCKLTLIDLNKLMRYYGEDPNDKESKNEFFQPFIEFLTMFKKCAKENIEKEE 1275

Query: 1661 EERVYERHKKMVE 1673
             ERVYE+ K ++E
Sbjct: 1276 MERVYEQRKNLLE 1288

 Score = 38.9 bits (89), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 34/55 (61%), Gaps = 3/55 (5%)

Query: 676 IQRLYDAMQTDEVARRAILESRQLTKELEEIQAERDFLRQKLNSTGDGIVGRLEE 730
           + +L D++Q+DE+ARRA+ E   L K++  +  + D +    N + D ++ +L+E
Sbjct: 512 VNKLLDSLQSDEIARRAVTEIDDLNKKISHLNEKLDLVE---NCSKDHLIKKLDE 563

>TPHA0E00120 Chr5 (4818..9746) [4929 bp, 1642 aa] {ON} Anc_5.717
            YIL159W
          Length = 1642

 Score =  261 bits (666), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 140/438 (31%), Positives = 249/438 (56%), Gaps = 18/438 (4%)

Query: 1258 NYPQPHKKLKQLHWEKLDATEDSIWSSGVAEK-FAGDLYEKGVLAGLEKAFAAREI---K 1313
            N  +  KKLKQ+HW +++   ++IW     ++    +L   GV   ++ +F  +++   K
Sbjct: 1135 NIQKEDKKLKQIHWIRVNEVAETIWKDNDRDRGIFMELECVGVFDRVKSSFKLKDVIKKK 1194

Query: 1314 NL---ATKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQTPSVI 1370
            N     TK K+ LK  +FLS D +QQFGINLH+++   V++L+ K+L+CD D  +  +++
Sbjct: 1195 NTDEAKTKDKQQLK--SFLSRDLAQQFGINLHLFASCEVSELLEKVLRCDNDINKNITIL 1252

Query: 1371 EFLSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQLIFNLQ 1430
            EF +K E T +S ++ARN++PY  D+      +      KD ++L+RAD+I+L+L +NL+
Sbjct: 1253 EFFNKEEFTHISGSVARNYAPYGVDY------QTNNEATKDASELERADRIFLELFYNLR 1306

Query: 1431 AYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGNFMNDT 1490
            AYW  R + + ++ +Y+K+Y +L+ KL+++D AV  ++ S        ++L +GNFMN  
Sbjct: 1307 AYWAERSQCLLLLHTYEKDYFDLMFKLQRIDDAVQKLMNSTRFKKFLYIVLEIGNFMN-- 1364

Query: 1491 AKRAQGFKLSTLQRLTFIKDT-NNSMTFLNYVEKIIRGNYPSFNDFLKELEPVLNVTKIS 1549
             K A+G  +S+L +L FIK + NN+++FL+++EK IR  +P    F+ +L  V  +  +S
Sbjct: 1365 KKPAEGILISSLTKLVFIKSSENNNLSFLHFIEKTIRTQFPEVYGFIDDLSKVAELGNVS 1424

Query: 1550 IDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDLLDDE 1609
            +D +  +C E+C  V     ++  G LS     HP D++L KV   + +A+ K + L D+
Sbjct: 1425 LDHITMECKEFCTHVNTTVYAVTKGKLSHPEDLHPRDQILKKVKYKISKAKTKSNFLRDQ 1484

Query: 1610 VRLSIMEFENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQNLKVEEEERVYERHK 1669
              L+      +++ YGED                    +KK   +N+  EE ER+YE+ K
Sbjct: 1485 QILTNHSIVKVLKYYGEDPNDRDSKDDFFKNIAEFATLFKKCAKENIYNEEAERLYEQRK 1544

Query: 1670 KMVEEQQRREQTPSKNRD 1687
             M++ + ++  +   + D
Sbjct: 1545 YMLDNKLQKNNSSGDDSD 1562

>Skud_9.8 Chr9 (18913..23037) [4125 bp, 1374 aa] {ON} YIL159W (REAL)
          Length = 1374

 Score =  257 bits (656), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 135/431 (31%), Positives = 242/431 (56%), Gaps = 30/431 (6%)

Query: 1260 PQPHKKLKQLHWEKLDATEDSIWSSGVA-EKFAGDLYEKGVLAGLEKAFAAREIKNLATK 1318
            P P ++LKQ+HW++++  +D++W      ++   +L   GV + +E  F  R    +A+K
Sbjct: 871  PSPERRLKQIHWDRVEDVKDTLWEDAFQRQETIRELQTDGVFSQIEDIFKMRSPAKIASK 930

Query: 1319 KK---------------EDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDF 1363
                              +LKK++FLS D +QQFGINLHM+S +S  + V+K+L CD D 
Sbjct: 931  NNAGSSTALSSNNGKSLNELKKVSFLSRDLAQQFGINLHMFSQLSDMEFVMKVLNCDNDI 990

Query: 1364 MQTPSVIEFLSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYL 1423
            +Q  ++++F  K E+T +  +L   + PYS   +G           K  +DLQRAD+I+L
Sbjct: 991  IQNVNILKFFCKEELTNIPKSLLNKYEPYSQGKEG-----------KAVSDLQRADRIFL 1039

Query: 1424 QLIFNLQAYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAV 1483
            +L  NL++YW  R + +  +++Y+++Y +L+ KL+K+D  +  +  S    N+  +I  +
Sbjct: 1040 ELCINLRSYWNVRSKNLLTLSTYERDYYDLLFKLQKIDDGISHLNLSPKFKNLMFIITEI 1099

Query: 1484 GNFMNDTAKRAQGFKLSTLQRLTFIKDT-NNSMTFLNYVEKIIRGNYPSFNDFLKELEPV 1542
            GN MN   K  +G KL +L +L F++ + + +M+FL+++EKIIR  YP    F+ +L+ +
Sbjct: 1100 GNHMN--KKIVKGIKLKSLTKLAFVRSSVDQNMSFLHFIEKIIRIKYPDLYGFVDDLKKI 1157

Query: 1543 LNVTKISIDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKK 1602
             ++ KIS++ +  +C+E+   + N+    + G LS      P D+++ KV   +  A+ K
Sbjct: 1158 EDLGKISLEHIELECHEFYNRIENLVTQFQTGKLSKEENLDPRDQIVKKVKFKINRAKIK 1217

Query: 1603 CDLLDDEVRLSIMEFENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQNLKVEEEE 1662
             +LL  + +L++++   LM+ YGED                 +  +KK   +N++ EE E
Sbjct: 1218 SELLMGQCKLTLIDLNKLMKYYGEDPSDKESKNDFFQPFIEFLAMFKKCAKENIEKEEME 1277

Query: 1663 RVYERHKKMVE 1673
            RVYE+ K ++E
Sbjct: 1278 RVYEQRKSLLE 1288

>YIL159W Chr9 (41825..45952) [4128 bp, 1375 aa] {ON}  BNR1Formin,
            nucleates the formation of linear actin filaments,
            involved in cell processes such as budding and mitotic
            spindle orientation which require the formation of
            polarized actin cables, functionally redundant with BNI1
          Length = 1375

 Score =  254 bits (648), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 133/439 (30%), Positives = 250/439 (56%), Gaps = 31/439 (7%)

Query: 1253 PTFRDNYPQP-HKKLKQLHWEKLDATEDSIWSSGVA-EKFAGDLYEKGVLAGLEKAFAAR 1310
            PT  D  P P  K+LKQ+HW+K++  +D++W      ++   +L   G+ + +E  F  +
Sbjct: 864  PTTTDLKPPPTEKRLKQIHWDKVEDIKDTLWEDTFQRQETIKELQTDGIFSQIEDIFKMK 923

Query: 1311 EIKNLATKKK---------------EDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIK 1355
                +A K+                 +LKKI+FLS D +QQFGINLHM+S +S  + V+K
Sbjct: 924  SPTKIANKRNAESSIALSSNNGKSSNELKKISFLSRDLAQQFGINLHMFSQLSDMEFVMK 983

Query: 1356 ILKCDRDFMQTPSVIEFLSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDL 1415
            +L CD D +Q  ++++F  K E+  +  ++   + PYS   DG           K  +DL
Sbjct: 984  VLNCDNDIVQNVNILKFFCKEELVNIPKSMLNKYEPYSQGKDG-----------KAVSDL 1032

Query: 1416 QRADQIYLQLIFNLQAYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSN 1475
            QRAD+I+L+L  NL+ YW +R +++  +++Y+++Y +L+ KL+K+D A+  + +S    +
Sbjct: 1033 QRADRIFLELCINLRFYWNARSKSLLTLSTYERDYYDLIFKLQKIDDAISHLNRSPKFKS 1092

Query: 1476 IFNVILAVGNFMNDTAKRAQGFKLSTLQRLTFIKDT-NNSMTFLNYVEKIIRGNYPSFND 1534
            +  +I  +GN MN   +  +G KL +L +L F++ + + +++FL+++EK+IR  YP    
Sbjct: 1093 LMFIITEIGNHMN--KRIVKGIKLKSLTKLAFVRSSIDQNVSFLHFIEKVIRIKYPDIYG 1150

Query: 1535 FLKELEPVLNVTKISIDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLP 1594
            F+ +L+ + ++ KIS++ + ++C+E+ + + ++    ++G LS      P D+++ KV  
Sbjct: 1151 FVDDLKNIEDLGKISLEHVESECHEFHKKIEDLVTQFQVGKLSKEENLDPRDQIIKKVKF 1210

Query: 1595 VLPEARKKCDLLDDEVRLSIMEFENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQ 1654
             +  A+ K +LL  + +L++++   LM+ YGED                 +  +KK   +
Sbjct: 1211 KINRAKTKSELLIGQCKLTLIDLNKLMKYYGEDPKDKESKNEFFQPFIEFLAMFKKCAKE 1270

Query: 1655 NLKVEEEERVYERHKKMVE 1673
            N++ EE ERVYE+ K +++
Sbjct: 1271 NIEKEEMERVYEQRKSLLD 1289

 Score = 34.7 bits (78), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 35/59 (59%), Gaps = 11/59 (18%)

Query: 676 IQRLYDAMQTDEVARRAILESRQLTKELEEIQAERDFLRQKLNST----GDGIVGRLEE 730
           + +L D++Q+DE+ARRA+        E++++ A+   L +KLN       D ++ +L+E
Sbjct: 512 VNKLLDSLQSDEIARRAV-------TEIDDLNAKISHLNEKLNLVENHDKDHLIAKLDE 563

>TBLA0E01810 Chr5 complement(441141..445496) [4356 bp, 1451 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1451

 Score =  254 bits (648), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 140/418 (33%), Positives = 235/418 (56%), Gaps = 11/418 (2%)

Query: 1262 PHKKLKQLHWEKLDATEDSIWSSGVAE-KFAGDLYEKGVLAGLEKAFAARE--IKNLATK 1318
            P K +KQ+HWEK+  T  S+W           +L   G+ + +E  F +++  IK    K
Sbjct: 966  PTKNMKQIHWEKVSRTGASLWEDDDQRLSIIKELEHTGIFSEVEDIFYSKDAVIKRRNPK 1025

Query: 1319 KKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQTPSVIEFLSKSEI 1378
             +   K +T L  + +QQFGINLHM+S +S  DL  K+L+CD    Q  SVIEF +  ++
Sbjct: 1026 DQTQNKVLTLLPRELAQQFGINLHMFSQISPQDLFEKVLQCDISINQNLSVIEFFNNEDL 1085

Query: 1379 TEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQLIFNLQAYWGSRMR 1438
            T +  N+ R F PYS D+    S      P KD ++L R D I+L L +NL++YW  R +
Sbjct: 1086 TNIPSNICRTFEPYSIDYKTPGS-----KPTKDISELSRVDHIFLLLCYNLRSYWKERSQ 1140

Query: 1439 AIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGNFMNDTAKRAQGFK 1498
             + ++ +Y+K+Y +L+ KL ++D+A+ AI  S+ L ++  +I+A+GNFMN   K   G +
Sbjct: 1141 CLLMLLTYEKDYYDLMFKLERLDEAINAIKNSQRLKSVLYIIVAIGNFMN--KKGVDGIR 1198

Query: 1499 LSTLQRLTFIKDTNNS-MTFLNYVEKIIRGNYPSFNDFLKELEPVLNVTKISIDQLVNDC 1557
            LS+L +LT+IK  + S  +FL+++E++IR  YP    F  +L  V N+  +++D L  + 
Sbjct: 1199 LSSLNKLTYIKSNSESKASFLHFIERLIRVRYPELYYFTSDLRKVENLGNVTLDHLQLEY 1258

Query: 1558 NEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDLLDDEVRLSIMEF 1617
            ++    +  V RSI+ G LS+    HP D +L KV   +  A  K  +L D+  L+ ++ 
Sbjct: 1259 DDLSSKINTVHRSIQKGQLSNKKNLHPQDNILDKVKYKVIRAANKRTILQDKFTLTNIDL 1318

Query: 1618 ENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQNLKVEEEERVYERHKKMVEEQ 1675
            E L+  +GED                 +  ++K   +N++ EE +RVYE+ +++++ +
Sbjct: 1319 EKLLVYFGEDPDDMNNKITFFKSISEFLTLFRKCAKENIEKEEADRVYEQRRQLLDSK 1376

>KAFR0D02120 Chr4 (425677..429651) [3975 bp, 1324 aa] {ON} Anc_5.717
            YIL159W
          Length = 1324

 Score =  252 bits (643), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 135/417 (32%), Positives = 235/417 (56%), Gaps = 27/417 (6%)

Query: 1265 KLKQLHWEKLDATEDSIW-SSGVAEKFAGDLYEKGVLAGLEKAFAAREIK------NLAT 1317
            +LKQ+HWEK++  E ++W  S   E+ A +L   G+   +   F  + IK        A+
Sbjct: 852  RLKQIHWEKVEDIESTLWHDSARREETAKELKLDGIFDQVMDTFQVKNIKMKKRDTTTAS 911

Query: 1318 KKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQTPSVIEFLSKSE 1377
            KK+      T L  + +QQFGINLHM+S +  ++ V K+L+C+ D +   SV+EF +K E
Sbjct: 912  KKQNG----TLLPRNLAQQFGINLHMFSSLGTDEFVEKVLECNSDIVSNVSVLEFFNKEE 967

Query: 1378 ITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQLIFNLQAYWGSRM 1437
            +T +  +L + F+PY+   + IKS            +L+RAD+I+ +L F L +YW  R 
Sbjct: 968  LTSIPTSLIQKFTPYA---ENIKS----------KFELERADRIFFELCFQLHSYWRERS 1014

Query: 1438 RAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGNFMNDTAKRAQGF 1497
              + ++ +Y+K+Y +L+ KL+KVD  +  +L S    +   +I+ +GN+MN   K   G 
Sbjct: 1015 NCLLILNTYEKDYYDLMYKLKKVDDGIQRLLSSSKFRDFLYIIIEIGNYMN--KKTVNGI 1072

Query: 1498 KLSTLQRLTFIKDT-NNSMTFLNYVEKIIRGNYPSFNDFLKELEPVLNVTKISIDQLVND 1556
            ++ +L +L F+K + +N+++FL+++EKIIR  YP    F+ EL  + ++ K+SIDQL  D
Sbjct: 1073 RIGSLNKLVFVKSSLDNNVSFLHFIEKIIRVKYPDIYSFINELRIIQDLGKLSIDQLEYD 1132

Query: 1557 CNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDLLDDEVRLSIME 1616
              E+C  +  +   +E G LS + +  P D++L K    +  A+ K +L+  +++L   +
Sbjct: 1133 SQEFCSKINKMSNDLEKGKLSKADRIDPRDQLLKKTKYKVLRAKSKSELMRHQLKLLGHD 1192

Query: 1617 FENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQNLKVEEEERVYERHKKMVE 1673
            +  +M+ +GED                 +Q +KK   +N++ EE ERVYE+ +KM +
Sbjct: 1193 YAKIMRYFGEDASDRDSKNAFFTNIFEFIQVFKKCSKENIEKEEMERVYEQRQKMFD 1249

 Score = 41.6 bits (96), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 64/264 (24%), Positives = 111/264 (42%), Gaps = 24/264 (9%)

Query: 481 KIVQAWLTGL-ETALQGRGKMGSLVGASEEVRAAGGENSILEYSQWTMVFINHLCMGTDV 539
           K +Q WL  L E  L     +     A   ++    +  I EY    M  IN +  G  +
Sbjct: 284 KKLQLWLNDLNEIILNPDSIIKEEKSAQFYIQLLRPKQLITEYLSSCMFLINSIIEGFPL 343

Query: 540 VNQRVLLRTRLENAGALRIMNRFKLLDYDKITAQIEYY----ENGKLDDINNLLESEGRN 595
            N++  +  +L++    ++      LD   I  QI  Y    EN +L  IN   E+    
Sbjct: 344 QNEKYSVLEKLKDVELPKLFFELSALDSKVIQEQIYRYKKNDENIRLKIIN---ENPLSI 400

Query: 596 TQVNMQDPMMMLQTMWDYCKGTENEKTFISLIKHLFLSSSKVADDR--GDPSKLAKQLK- 652
             ++    +M+L    +  K T  E+   +L+  +     K+ D R   +  KL   +  
Sbjct: 401 PDISYGATLMLL---IEKSKSTPLEEPIGALLDSVL----KILDTRTYSESIKLFASVSS 453

Query: 653 ----LMDSLXXXXXXXXXXXXXX--XXXXIQRLYDAMQTDEVARRAILESRQLTKELEEI 706
               L+D L                    I+RL D +++DEVARRA+ E R+    ++++
Sbjct: 454 LLTYLVDKLDSTISSAENANSLKPVLQDSIERLIDNLESDEVARRAMKELRESETVIKDL 513

Query: 707 QAERDFLRQKLNSTGDGIVGRLEE 730
             E   L+++ NS+ + I+ +LEE
Sbjct: 514 NTEIHNLKREKNSSKEDILEQLEE 537

>Suva_9.26 Chr9 (34756..38883) [4128 bp, 1375 aa] {ON} YIL159W (REAL)
          Length = 1375

 Score =  237 bits (604), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 124/422 (29%), Positives = 236/422 (55%), Gaps = 26/422 (6%)

Query: 1265 KLKQLHWEKLDATEDSIWSSGVA-EKFAGDLYEKGVLAGLEKAFAAREIKNLATKKKEDL 1323
            +LKQ+HW+K++  +D++W      ++   +L   G+ + +E  F  ++   +A+KK  + 
Sbjct: 881  RLKQIHWDKVEEIKDTLWEDTTQRQETLKELQTDGIFSQIEDIFKMKDPVKIASKKNGNS 940

Query: 1324 -----------KKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQTPSVIEF 1372
                         ++FLS D +QQFGINLHM+S +S  + V K+L CD + +   ++++F
Sbjct: 941  STSISSNNGKSSNVSFLSRDLAQQFGINLHMFSQVSDMEFVKKVLNCDNNIIMNVNILKF 1000

Query: 1373 LSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQLIFNLQAY 1432
              K E+  +  ++   + PYS    G           K  +DLQRAD+I+L+L  NL++Y
Sbjct: 1001 FCKEELVSIPKSMLSKYEPYSQGKGG-----------KSVSDLQRADRIFLELCINLRSY 1049

Query: 1433 WGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGNFMNDTAK 1492
            W +R +++  +++Y+++Y +L+ KL+K+D  +  + +S    ++  +I  +GN MN   K
Sbjct: 1050 WNARSKSLLTLSTYERDYYDLIFKLQKIDDGILQLNRSVKFKSLMFIITEIGNHMN--KK 1107

Query: 1493 RAQGFKLSTLQRLTFIKDT-NNSMTFLNYVEKIIRGNYPSFNDFLKELEPVLNVTKISID 1551
              +G KL +L +L F++ + + +++FL+++EK+IR  YP    F+ +L+ + ++ K+S++
Sbjct: 1108 MVKGIKLKSLTKLAFVRSSADQNLSFLHFIEKVIRTKYPDIYGFVDDLKRIEDLGKVSLE 1167

Query: 1552 QLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDLLDDEVR 1611
             +  +C E+   V       + G LS+     P D+++ KV   +  A+ K DLL D+ +
Sbjct: 1168 HVELECREFQNKVEYAVTQFQTGKLSNEENLDPRDQIVKKVKFKINRAKTKSDLLVDQCK 1227

Query: 1612 LSIMEFENLMQKYGEDTGXXXXXXXXXXXXXXXVQEYKKAQNQNLKVEEEERVYERHKKM 1671
            L++++   LM+ YGED                 +  +KK   +N++ EE ERVYE+ K +
Sbjct: 1228 LTLIDLSKLMKYYGEDPNDKESKNEFFQPFIEFLAMFKKCAKENIEKEEMERVYEQRKNL 1287

Query: 1672 VE 1673
            +E
Sbjct: 1288 LE 1289

>CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa] {ON}
            weakly similar to uniprot|P07248 Saccharomyces cerevisiae
            YDR216w ADR1 zinc-finger transcription factor
          Length = 1489

 Score = 36.6 bits (83), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 65/139 (46%), Gaps = 11/139 (7%)

Query: 1426 IFNLQAYWGSRMRAIKVITSYDK----EYLELVTKLRKVDKAVGAILKSENLSNIFNVIL 1481
            IFNLQAY+   +  IK I  +++    + L + T+LRK+   V   L +E  S  F    
Sbjct: 1219 IFNLQAYYYDFLTVIKFIMDFERTPNFKLLSIFTELRKLADCVFIPLLNEFYSIEFTQYT 1278

Query: 1482 AV---GNFMNDTAKRAQGFKLSTLQRL--TFIKDTNNSMTFLNYVEKIIRGNYPSFNDFL 1536
            AV    +F N  A       L  L+++    +  + N  +FLN  +  ++  +  FN  +
Sbjct: 1279 AVIPEQSFNNKKATDDLPHILERLEKMIGNVLVYSFNDNSFLNMFDDKVQNEF-QFNP-M 1336

Query: 1537 KELEPVLNVTKISIDQLVN 1555
              L+  L   KI+  QL+N
Sbjct: 1337 SNLQHFLKSPKINDSQLIN 1355

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.129    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 180,390,819
Number of extensions: 7556661
Number of successful extensions: 30445
Number of sequences better than 10.0: 155
Number of HSP's gapped: 31156
Number of HSP's successfully gapped: 216
Length of query: 1994
Length of database: 53,481,399
Length adjustment: 125
Effective length of query: 1869
Effective length of database: 39,148,149
Effective search space: 73167890481
Effective search space used: 73167890481
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 74 (33.1 bits)