Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F12232g8.774ON42642621870.0
TDEL0B033508.774ON42643412581e-172
CAGL0A03828g8.774ON47647012121e-164
NDAI0E006308.774ON49049011921e-161
NCAS0B007808.774ON47246711791e-159
KAFR0D014908.774ON44344511671e-157
YOR301W (RAX1)8.774ON43542511181e-150
Smik_15.4828.774ON42542511001e-148
Skud_15.4688.774ON42342510961e-147
Kpol_1010.138.774ON49949611011e-147
SAKL0B05456g8.774ON43244310711e-143
TPHA0G012108.774ON49449510621e-141
KNAG0G031008.774ON4634659931e-131
Kwal_34.159438.774ON4324299741e-128
KLTH0H15070g8.774ON4384349701e-128
Suva_8.3528.774ON4673889501e-124
KLLA0F24904g8.774ON4244349231e-121
AFR532W8.774ON4224448671e-112
Ecym_14768.774ON4534718211e-105
TBLA0D008408.774ON5774417112e-87
Kwal_56.239396.191ON67168810.24
KLTH0F14718g3.487ON30086750.96
CAGL0E05060g2.316ON109995751.3
Skud_10.1201.272ON873109741.5
Ecym_61564.173ON192243722.6
SAKL0H17072g8.260ON299767714.1
NDAI0E037207.36ON58281704.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F12232g
         (426 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F12232g Chr6 (994273..995553) [1281 bp, 426 aa] {ON} simila...   847   0.0  
TDEL0B03350 Chr2 complement(599587..600867) [1281 bp, 426 aa] {O...   489   e-172
CAGL0A03828g Chr1 (390687..392117) [1431 bp, 476 aa] {ON} simila...   471   e-164
NDAI0E00630 Chr5 complement(128590..130062) [1473 bp, 490 aa] {O...   463   e-161
NCAS0B00780 Chr2 (119384..120802) [1419 bp, 472 aa] {ON} Anc_8.7...   458   e-159
KAFR0D01490 Chr4 (297425..298756) [1332 bp, 443 aa] {ON} Anc_8.7...   454   e-157
YOR301W Chr15 (880965..882272) [1308 bp, 435 aa] {ON}  RAX1Prote...   435   e-150
Smik_15.482 Chr15 (830795..832072) [1278 bp, 425 aa] {ON} YOR301...   428   e-148
Skud_15.468 Chr15 (820871..822142) [1272 bp, 423 aa] {ON} YOR301...   426   e-147
Kpol_1010.13 s1010 complement(27385..28884) [1500 bp, 499 aa] {O...   428   e-147
SAKL0B05456g Chr2 (470064..471362) [1299 bp, 432 aa] {ON} simila...   417   e-143
TPHA0G01210 Chr7 complement(246099..247583) [1485 bp, 494 aa] {O...   413   e-141
KNAG0G03100 Chr7 (673022..674413) [1392 bp, 463 aa] {ON} Anc_8.7...   387   e-131
Kwal_34.15943 s34 complement(128372..129670) [1299 bp, 432 aa] {...   379   e-128
KLTH0H15070g Chr8 (1304724..1306040) [1317 bp, 438 aa] {ON} simi...   378   e-128
Suva_8.352 Chr8 (621701..623104) [1404 bp, 467 aa] {ON} YOR301W ...   370   e-124
KLLA0F24904g Chr6 complement(2319858..2321132) [1275 bp, 424 aa]...   360   e-121
AFR532W Chr6 (1391215..1392483) [1269 bp, 422 aa] {ON} Syntenic ...   338   e-112
Ecym_1476 Chr1 (980938..982299) [1362 bp, 453 aa] {ON} similar t...   320   e-105
TBLA0D00840 Chr4 (221070..222803) [1734 bp, 577 aa] {ON} Anc_8.7...   278   2e-87
Kwal_56.23939 s56 (788304..790319) [2016 bp, 671 aa] {ON} YGL083...    36   0.24 
KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} simil...    33   0.96 
CAGL0E05060g Chr5 complement(493370..496669) [3300 bp, 1099 aa] ...    33   1.3  
Skud_10.120 Chr10 complement(219864..222485) [2622 bp, 873 aa] {...    33   1.5  
Ecym_6156 Chr6 complement(286295..292063) [5769 bp, 1922 aa] {ON...    32   2.6  
SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} sim...    32   4.1  
NDAI0E03720 Chr5 complement(803907..805655) [1749 bp, 582 aa] {O...    32   4.5  

>ZYRO0F12232g Chr6 (994273..995553) [1281 bp, 426 aa] {ON} similar
           to uniprot|Q08760 Saccharomyces cerevisiae YOR301W RAX1
           Protein involved in bud site selection during bipolar
           budding localization requires Rax2p
          Length = 426

 Score =  847 bits (2187), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/426 (96%), Positives = 410/426 (96%)

Query: 1   MEGDFTPIENQRLPTLYEVLLRQTSPPVDLWSFYTFLSQFPYAIDFLDFWIDLMAHVRLC 60
           MEGDFTPIENQRLPTLYEVLLRQTSPPVDLWSFYTFLSQFPYAIDFLDFWIDLMAHVRLC
Sbjct: 1   MEGDFTPIENQRLPTLYEVLLRQTSPPVDLWSFYTFLSQFPYAIDFLDFWIDLMAHVRLC 60

Query: 61  RDYVRGVKESIEARNSELIADDAHSDESNVLLDALLTEGYLDFKNARRVSQFLRGNVEES 120
           RDYVRGVKESIEARNSELIADDAHSDESNVLLDALLTEGYLDFKNARRVSQFLRGNVEES
Sbjct: 61  RDYVRGVKESIEARNSELIADDAHSDESNVLLDALLTEGYLDFKNARRVSQFLRGNVEES 120

Query: 121 MRISRLLDTFKQDHRLSTQSDREADEFLAAMVDDMLKQKIHKDKQPKMTRKQLINNASQI 180
           MRISRLLDTFKQDHRLSTQSDREADEFLAAMVDDMLKQKIHKDKQPKMTRKQLINNASQI
Sbjct: 121 MRISRLLDTFKQDHRLSTQSDREADEFLAAMVDDMLKQKIHKDKQPKMTRKQLINNASQI 180

Query: 181 CRQYLLSPQESPRYLINVPDEIRMKALHAVQSERRFDPELFEDLRNLSYDFLEMDCFPKF 240
           CRQYLLSPQESPRYLINVPDEIRMKALHAVQSERRFDPELFEDLRNLSYDFLEMDCFPKF
Sbjct: 181 CRQYLLSPQESPRYLINVPDEIRMKALHAVQSERRFDPELFEDLRNLSYDFLEMDCFPKF 240

Query: 241 LNRVALHNLHDQLSDWRFQTTAAIGKSKGDIRGQRSASPLSTYSGLGRIALGLCWLGIGF 300
           LNRVALHNLHDQLSDWRFQTTAAIGKSKGDIRGQRSASPLSTYSGLGRIALGLCWLGIGF
Sbjct: 241 LNRVALHNLHDQLSDWRFQTTAAIGKSKGDIRGQRSASPLSTYSGLGRIALGLCWLGIGF 300

Query: 301 WIGYVLIFLHYSRAIRVTTIVPFGIGCYFSVCGIYQVDILYSWFGVTQRLMYEKKLPSDR 360
           WIGYVLIFLHYSRAIRVTTIVPFGIGCYFSVCGIYQVDILYSWFGVTQRLMYEKKLPSDR
Sbjct: 301 WIGYVLIFLHYSRAIRVTTIVPFGIGCYFSVCGIYQVDILYSWFGVTQRLMYEKKLPSDR 360

Query: 361 EEDVPKSRTRVPTIFALLGGRSRLMPVHHPFIKKLLLRRGMWCXXXXXXXXXXXXXXXXC 420
           EEDVPKSRTRVPTIFALLGGRSRLMPVHHPFIKKLLLRRGMWC                C
Sbjct: 361 EEDVPKSRTRVPTIFALLGGRSRLMPVHHPFIKKLLLRRGMWCFLLVVVSTAVLTVLFSC 420

Query: 421 VPGKRI 426
           VPGKRI
Sbjct: 421 VPGKRI 426

>TDEL0B03350 Chr2 complement(599587..600867) [1281 bp, 426 aa] {ON}
           Anc_8.774 YOR301W
          Length = 426

 Score =  489 bits (1258), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 237/434 (54%), Positives = 306/434 (70%), Gaps = 20/434 (4%)

Query: 1   MEGDFTPIENQRLPTLYEVLLRQTSPPVDLWSFYTFLSQFPYAIDFLDFWIDLMAHVRLC 60
           ME D+  I+ +RLPTLYEVL++ T  PVD W FYT+LSQFPYAID+LDFWIDLMAH+RLC
Sbjct: 5   MEQDYEQIQRERLPTLYEVLIQVTKAPVDSWEFYTYLSQFPYAIDYLDFWIDLMAHIRLC 64

Query: 61  RDYVRGVKESIE--------ARNSELIADDAHSDESNVLLDALLTEGYLDFKNARRVSQF 112
           +DYV+GV+ES+E         R+   I DD  S  S+VLLDALL EGYLDF+N +RVSQF
Sbjct: 65  KDYVKGVRESVEFNETIASRNRDEVNIEDDNESVSSSVLLDALLNEGYLDFQNTKRVSQF 124

Query: 113 LRGNVEESMRISRLLDTFKQDHRLSTQSDREADEFLAAMVDDMLKQKIHKDKQPKMTRKQ 172
           L+G+  +S R+SRL+D +K+   ++   +      LA MVD+ML+++  K KQPK+TRKQ
Sbjct: 125 LQGDTNDSPRVSRLVDGWKRQSGIADGQNHP----LALMVDEMLRKETRKLKQPKITRKQ 180

Query: 173 LINNASQICRQYLLSPQESPRYLINVPDEIRMKALHAVQSERRFDPELFEDLRNLSYDFL 232
           L+NNA QIC  YLL   E  +YLINVP+ ++ + L+ VQ E+R DP +FE L+ ++Y FL
Sbjct: 181 LVNNALQICNIYLLKSAEDNKYLINVPERVKNQVLYDVQQEQRHDPAVFEPLKTVAYQFL 240

Query: 233 EMDCFPKFLNRVALHNLHDQLSDWRFQTTAAIGKSKGDIRGQRSASPLSTYSGLGRIALG 292
           E+DCFPKFL+ VALHN+HDQ+S+WR+Q+          +R  RS SP S Y+ L R+ +G
Sbjct: 241 EIDCFPKFLSTVALHNIHDQISNWRYQSPG--------LRRHRSKSPFSNYTVLSRVLIG 292

Query: 293 LCWLGIGFWIGYVLIFLHYSRAIRVTTIVPFGIGCYFSVCGIYQVDILYSWFGVTQRLMY 352
           L WLGIGFWIGY LIFLHYSRAIRV TIVPF +G Y  VCG+YQVDILY++FG+TQ LMY
Sbjct: 293 LIWLGIGFWIGYTLIFLHYSRAIRVVTIVPFALGSYSIVCGLYQVDILYAFFGLTQALMY 352

Query: 353 EKKLPSDREEDVPKSRTRVPTIFALLGGRSRLMPVHHPFIKKLLLRRGMWCXXXXXXXXX 412
           ++K  S  +       + +PTIF LLGGRSRL+ + H FIKKLL +R +WC         
Sbjct: 353 QEKDGSQTDRKHSHDYSEIPTIFKLLGGRSRLIKIQHDFIKKLLWKRALWCGFLTTLATA 412

Query: 413 XXXXXXXCVPGKRI 426
                  CVPG R+
Sbjct: 413 ILTVIFSCVPGYRL 426

>CAGL0A03828g Chr1 (390687..392117) [1431 bp, 476 aa] {ON} similar
           to uniprot|Q08760 Saccharomyces cerevisiae YOR301w RAX1
          Length = 476

 Score =  471 bits (1212), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 232/470 (49%), Positives = 311/470 (66%), Gaps = 47/470 (10%)

Query: 4   DFTPIENQRLPTLYEVLLRQTSPPVDLWSFYTFLSQFPYAIDFLDFWIDLMAHVRLCRDY 63
           DF  I++QRLPTLYEV + +T PPVDLWSFYT+LSQFPYAI++LDFWIDLMAH+RLC+DY
Sbjct: 7   DFDQIQHQRLPTLYEVFILKTEPPVDLWSFYTYLSQFPYAINYLDFWIDLMAHIRLCKDY 66

Query: 64  VRGVKESI-------EARN--------SELIADDAHSDESNVLLDALLTEGYLDFKNARR 108
           V  V++S+       E RN          +  D+  S  +++L++ LL+EGYLDF+N  +
Sbjct: 67  VSTVRQSVVQGSALEEFRNLDERSNVNRHMNNDEDASVTTSILMNTLLSEGYLDFENPEK 126

Query: 109 VSQFLRGNVEESMRISRLLDTFK----------QDHRLSTQ-----SDREADEFLAAMVD 153
           VSQFL+GN   S  ++R++  +K            H  STQ     S +E+ + ++A+VD
Sbjct: 127 VSQFLQGNTHTSPMVTRMIQDWKLHNERNSVAATSHLQSTQAGIDISRKESMQSVSAIVD 186

Query: 154 DMLKQKIHKDKQPKMTRKQLINNASQICRQYLLSPQESPRYLINVPDEIRMKALHAVQSE 213
           + LK++    ++  +T KQL NNA QIC  YL+S Q SPRYL N+PD+++ + +H  ++ 
Sbjct: 187 EFLKRQSQLGEKGNITTKQLYNNAQQICNTYLMSQQHSPRYLANIPDDLKNQVIHNFKAN 246

Query: 214 RRFDPELFEDLRNLSYDFLEMDCFPKFLNRVALHNLHDQLSDWRFQT-------TAAIGK 266
           RR DPE+F +L+ ++Y FLE DCFPKFL  VALHN+HD+LSDWRF         T++   
Sbjct: 247 RRHDPEVFRELKEVTYQFLETDCFPKFLKEVALHNIHDELSDWRFHPSNKNPHRTSSPSG 306

Query: 267 SKGDIRGQR-------SASPLSTYSGLGRIALGLCWLGIGFWIGYVLIFLHYSRAIRVTT 319
           SK ++ G +       S SP STY+ L R+  G  W+GIGFWIGYVLIFLHYSRAIRVTT
Sbjct: 307 SKENLNGHKQLMQNHISWSPFSTYTSLSRVLFGCMWMGIGFWIGYVLIFLHYSRAIRVTT 366

Query: 320 IVPFGIGCYFSVCGIYQVDILYSWFGVTQRLMYEKK---LPSDREEDVPKSRTRVPTIFA 376
           +VPFG+GCY+ VCGIYQVDI+YSWFG+TQRLMY  K   +   R+         VP IF 
Sbjct: 367 VVPFGLGCYYIVCGIYQVDIIYSWFGLTQRLMYSHKKGNIEEGRQVYGATYNDDVPLIFT 426

Query: 377 LLGGRSRLMPVHHPFIKKLLLRRGMWCXXXXXXXXXXXXXXXXCVPGKRI 426
           LLGG+SRL+ + HPFIKK+L +RG+WC                CVPG+R+
Sbjct: 427 LLGGKSRLIHIEHPFIKKILYKRGLWCLTLVVIFTAIFTVIFCCVPGRRL 476

>NDAI0E00630 Chr5 complement(128590..130062) [1473 bp, 490 aa] {ON}
           Anc_8.774 YOR301W
          Length = 490

 Score =  463 bits (1192), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 241/490 (49%), Positives = 319/490 (65%), Gaps = 64/490 (13%)

Query: 1   MEGDFTPIENQRLPTLYEVLLRQTSPPVDLWSFYTFLSQFPYAIDFLDFWIDLMAHVRLC 60
           ME D+  I+ +RLPTLYEVL+++T  PVDLWSFYTFLSQFPYAI++LDFWIDLMAH+RLC
Sbjct: 1   MELDYKKIQTERLPTLYEVLIQKTKFPVDLWSFYTFLSQFPYAINYLDFWIDLMAHLRLC 60

Query: 61  RDYVRGVKESI-----EARNS-----------ELIADDAHSDE----------------- 87
           +DY+ G++ESI     EARNS           E I  +  S +                 
Sbjct: 61  KDYISGIRESITYNQNEARNSRIRHHLQYTSEESIQHETQSIQHHDDPEGGDEDDDDDDN 120

Query: 88  ----SNVLLDALLTEGYLDFKNARRVSQFLRGNVEESMRISRLLDTFKQDHRLSTQSDRE 143
               ++VLL+ALL EG+LDF+N  RVSQFL+GN E S ++S+LL+ +K+    +  S+R+
Sbjct: 121 ISVTTSVLLNALLDEGHLDFENPERVSQFLQGNTEYSPKLSQLLEDWKRHSIANNDSNRK 180

Query: 144 AD---------------EFLAAMVDDMLKQKIHKDKQPKMTRKQLINNASQICRQYLLSP 188
                              L  +VDD+L+++  ++++ K+T KQL+NNA +IC  YL SP
Sbjct: 181 GSLNRNNSNVRSRETNGAALPDVVDDILRKQSQQEERAKITTKQLLNNALKICSIYLQSP 240

Query: 189 QESPRYLINVPDEIRMKALHAVQSERRFDPELFEDLRNLSYDFLEMDCFPKFLNRVALHN 248
           + S RYL N+PD+IR+KAL+ VQ+ERR DP++FE+L+++++ FLEMDCFPKFL+ VALHN
Sbjct: 241 ERSERYLTNLPDDIRLKALNLVQNERRHDPQVFEELKSIAFQFLEMDCFPKFLSTVALHN 300

Query: 249 LHDQLSDWRFQTTA------AIGKSKGDIRGQRSASPLSTYSGLGRIALGLCWLGIGFWI 302
           +HD++SDWRF + A       + KS        S SP STY+ L R   GL WLGIGFWI
Sbjct: 301 IHDEISDWRFHSNARSHNLTRVDKSLIKNHDHISKSPFSTYTLLSRTIFGLLWLGIGFWI 360

Query: 303 GYVLIFLHYSRAIRVTTIVPFGIGCYFSVCGIYQVDILYSWFGVTQRLMY---EKKLPSD 359
           GY LIFL Y R IRV TIVPF IG YF +CG+Y+VDI+YSWFGVTQRL+Y   EK   +D
Sbjct: 361 GYTLIFLKYDRGIRVVTIVPFAIGNYFIICGMYRVDIIYSWFGVTQRLLYKHNEKNRDAD 420

Query: 360 REEDVPKSRTR---VPTIFALLGGRSRLMPVHHPFIKKLLLRRGMWCXXXXXXXXXXXXX 416
           RE  + +   +   V  I ALLGGRSRL+ + HPFIK +L++RG+WC             
Sbjct: 421 REVQMDEKNGKNHHVSGILALLGGRSRLIRIEHPFIKNILMKRGLWCLFLVLLSTGIFTV 480

Query: 417 XXXCVPGKRI 426
              CVPG RI
Sbjct: 481 IFSCVPGYRI 490

>NCAS0B00780 Chr2 (119384..120802) [1419 bp, 472 aa] {ON} Anc_8.774
           YOR301W
          Length = 472

 Score =  458 bits (1179), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 228/467 (48%), Positives = 314/467 (67%), Gaps = 41/467 (8%)

Query: 1   MEGDFTPIENQRLPTLYEVLLRQTSPPVDLWSFYTFLSQFPYAIDFLDFWIDLMAHVRLC 60
           ME DF  I+ +RLPTLYEVL+++T  PVDLWSFYTFLSQFPYAI++LDFW+DLM H+RLC
Sbjct: 6   MEPDFEKIQTERLPTLYEVLVQKTRAPVDLWSFYTFLSQFPYAINYLDFWMDLMTHLRLC 65

Query: 61  RDYVRGVKESIEARNS----------------ELIADDAHSDESNVLLDALLTEGYLDFK 104
           +DYV G++ES+   N                 E  ADD+ S  ++VLL+ALL EG+ D  
Sbjct: 66  KDYVDGIRESLVVNNERQGNSSLLNNEHAQQVEADADDSASVRTSVLLNALLEEGHFDLT 125

Query: 105 NARRVSQFLRGNVEESMRISRLLDTFKQDHR---------LSTQSDREADEFLAAMVDDM 155
           N   VSQ L+G V  S ++++L+D + +  +          S  +    +  L++++DD+
Sbjct: 126 NPAGVSQLLQGQVNHSPKLAQLIDDWNRHSQNVDDSNRNRSSNNNSNSNNNNLSSILDDI 185

Query: 156 LKQKIHKDKQPKMTRKQLINNASQICRQYLLSPQESPRYLINVPDEIRMKALHAVQSERR 215
           LK++   +++PK+T KQL+N+A +IC  YLLSP++S RYL N+PDE+R+KA++ +Q   R
Sbjct: 186 LKRQSQLEEKPKVTTKQLLNSALKICSLYLLSPEQSERYLTNIPDEVRLKAVNLIQRNSR 245

Query: 216 FDPELFEDLRNLSYDFLEMDCFPKFLNRVALHNLHDQLSDWRFQTTAAIGK--------S 267
            DPE+F++L+++SY FLE+DCFPKFL+ VALHN+HD++SDWRF   +  G         +
Sbjct: 246 HDPEVFDELKSVSYQFLEIDCFPKFLSTVALHNIHDEISDWRFHAHSTGGNRNKSQASLT 305

Query: 268 KGDIRGQR--SASPLSTYSGLGRIALGLCWLGIGFWIGYVLIFLHYSRAIRVTTIVPFGI 325
           + D+   R  S SP STY+ L RI  GL WLG+GFWIGY LIFL Y R IRV TIVPF I
Sbjct: 306 EKDLESMRHISKSPFSTYTTLSRIMFGLLWLGVGFWIGYTLIFLKYDRGIRVVTIVPFCI 365

Query: 326 GCYFSVCGIYQVDILYSWFGVTQRLMY-EKKLPSDREE-----DVPKSRTRVPTIFALLG 379
           G YF VCG+YQVDILYSWFG+TQRL+Y ++K+  D  +     DV +S+ ++P IF +LG
Sbjct: 366 GSYFVVCGLYQVDILYSWFGITQRLLYKDRKVTEDGYDGNVPVDVKESKDKIPFIFGILG 425

Query: 380 GRSRLMPVHHPFIKKLLLRRGMWCXXXXXXXXXXXXXXXXCVPGKRI 426
           GR+RL+ V HPFI+K L +RG+WC                CVPG R+
Sbjct: 426 GRNRLIEVKHPFIRKFLFQRGLWCCLLVLISTGVFTVVFSCVPGHRV 472

>KAFR0D01490 Chr4 (297425..298756) [1332 bp, 443 aa] {ON} Anc_8.774
           YOR301W
          Length = 443

 Score =  454 bits (1167), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 223/445 (50%), Positives = 302/445 (67%), Gaps = 21/445 (4%)

Query: 1   MEGDFTPIENQRLPTLYEVLLRQTSPPVDLWSFYTFLSQFPYAIDFLDFWIDLMAHVRLC 60
           ME DF  I+ +RLPTLYEVL+++TS PVDLWSFYT+LSQFPYAI++LDFWIDLMAH+RL 
Sbjct: 1   MELDFAKIQEERLPTLYEVLIQKTSVPVDLWSFYTYLSQFPYAINYLDFWIDLMAHLRLS 60

Query: 61  RDYVRGVKESI-------EARNSELIADDAHSDESNV------LLDALLTEGYLDFKNAR 107
           +DY+ G++ S+       E  N +   +D +S+  NV      LL+AL+ EG+LDF+N  
Sbjct: 61  KDYINGIRGSLLEESNFNELENQQSSQEDQNSNSENVSVTTSVLLNALMEEGHLDFENPD 120

Query: 108 RVSQFLRGNVEESMRISRLLDTFKQDHRL--STQSDREADEFLAAMVDDMLKQKIHKDKQ 165
           RVS+FL+G  + S ++S+LLD +K+   +  +  +    +  L  ++D+MLK K  +++ 
Sbjct: 121 RVSKFLQGKADYSPKLSQLLDGWKRHSGIYDANNNLNIDNGNLPTLLDEMLKNKSKRNET 180

Query: 166 PKMTRKQLINNASQICRQYLLSPQESPRYLINVPDEIRMKALHAVQSERRFDPELFEDLR 225
            ++T KQL+NNA QIC  YL S ++S +YL N+ +E RMK L +V ++ R+DPE+FE+L+
Sbjct: 181 SQITTKQLLNNALQICNTYLYSTEKSAKYLSNISEETRMKVLDSVVNQNRYDPEVFEELK 240

Query: 226 NLSYDFLEMDCFPKFLNRVALHNLHDQLSDWRFQT-TAAIGKSKGDIRGQRSASPLSTYS 284
             +Y  LE DCFPKFL+ VALHN+HD+LSDWRF +   AI  +    RG R  SP S ++
Sbjct: 241 ATTYQLLETDCFPKFLSTVALHNIHDELSDWRFHSEKGAIDNTTLRYRGSR--SPFSNHT 298

Query: 285 GLGRIALGLCWLGIGFWIGYVLIFLHYSRAIRVTTIVPFGIGCYFSVCGIYQVDILYSWF 344
            L R+  GL WLGIGFWIGYVLIFL YSRAIRV T+VPF IGCY  +CG+YQVDI+YSWF
Sbjct: 299 TLSRLIFGLVWLGIGFWIGYVLIFLKYSRAIRVVTVVPFAIGCYLIICGMYQVDIIYSWF 358

Query: 345 GVTQRLMY---EKKLPSDREEDVPKSRTRVPTIFALLGGRSRLMPVHHPFIKKLLLRRGM 401
           GVTQ L Y   + K+    +E+   ++ +VP + ALLGG  R + + H FIKKLL RRG+
Sbjct: 359 GVTQVLTYKDSDSKILRSNDEEHTTTKEKVPFLIALLGGGKRTVKIEHTFIKKLLQRRGL 418

Query: 402 WCXXXXXXXXXXXXXXXXCVPGKRI 426
           WC                CVPG RI
Sbjct: 419 WCLLLVVISTAIFTVIFSCVPGFRI 443

>YOR301W Chr15 (880965..882272) [1308 bp, 435 aa] {ON}  RAX1Protein
           involved in bud site selection during bipolar budding;
           localization requires Rax2p; has similarity to members
           of the insulin-related peptide superfamily
          Length = 435

 Score =  435 bits (1118), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 205/425 (48%), Positives = 291/425 (68%), Gaps = 4/425 (0%)

Query: 4   DFTPIENQRLPTLYEVLLRQTSPPVDLWSFYTFLSQFPYAIDFLDFWIDLMAHVRLCRDY 63
           +F  I+ +RLPTLYEVL+++TS PVDLW+FYTFLSQFPYAI++LDFW+DLM H RLC++Y
Sbjct: 13  NFEMIQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWVDLMTHTRLCKNY 72

Query: 64  VRGVKESIEARNSELIADDAHSDESNVLLDALLTEGYLDFKNARRVSQFLRGNVEESMRI 123
           +  V++S+     E   + + S  +  LL+AL+ EG+LD +   ++ +    +V  S ++
Sbjct: 73  IELVRKSLINFPQEQQQNGSTSTATFDLLNALIEEGHLDPEAPDKLLENSGPDVPFSPKL 132

Query: 124 SRLLDTFKQDHRLSTQSDREADEFLAAMVDDMLKQKIHKDKQPKMTRKQLINNASQICRQ 183
           + LL  +K    +  ++ R  D  +A +VD+++K++  +D +P++T KQL+++A  +C  
Sbjct: 133 NELLGDWKHQSGIGQEALRNED--VALIVDEIMKRRSQQDGKPQITTKQLLHSAVGLCNT 190

Query: 184 YLLSPQESPRYLINVPDEIRMKALHAVQSERRFDPELFEDLRNLSYDFLEMDCFPKFLNR 243
           YL+SP++S RYL N+P E R + + +VQ ER++D E+F+DL+NL+Y FLEMDCFPKFL+R
Sbjct: 191 YLVSPEQSERYLSNIPMETRNRIIESVQIERKYDIEIFDDLKNLTYQFLEMDCFPKFLSR 250

Query: 244 VALHNLHDQLSDWRFQTTAAIGKSKGDIRGQR--SASPLSTYSGLGRIALGLCWLGIGFW 301
           VALHN+HD++SDWRF +     +     RGQ   S SP S ++ + RI  GL WLGIGFW
Sbjct: 251 VALHNIHDEISDWRFHSVGVTNEKSNRSRGQTHISRSPFSNHTSISRIGFGLLWLGIGFW 310

Query: 302 IGYVLIFLHYSRAIRVTTIVPFGIGCYFSVCGIYQVDILYSWFGVTQRLMYEKKLPSDRE 361
           IGYVLIFL YSRAIRV T+VPF +GCY  VCG+YQVDI+YSWFGVTQRL++  K   + E
Sbjct: 311 IGYVLIFLAYSRAIRVVTVVPFTLGCYCIVCGMYQVDIVYSWFGVTQRLLHRHKNAGNDE 370

Query: 362 EDVPKSRTRVPTIFALLGGRSRLMPVHHPFIKKLLLRRGMWCXXXXXXXXXXXXXXXXCV 421
            D       VP I A+ GGR RL  + HPF ++LL +RG+WC                CV
Sbjct: 371 GDASSDTDHVPMILAVFGGRRRLTRIEHPFTRQLLRKRGLWCLLLVVGATAAFTVIFSCV 430

Query: 422 PGKRI 426
           PG+R+
Sbjct: 431 PGRRV 435

>Smik_15.482 Chr15 (830795..832072) [1278 bp, 425 aa] {ON} YOR301W
           (REAL)
          Length = 425

 Score =  428 bits (1100), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 206/425 (48%), Positives = 289/425 (68%), Gaps = 7/425 (1%)

Query: 4   DFTPIENQRLPTLYEVLLRQTSPPVDLWSFYTFLSQFPYAIDFLDFWIDLMAHVRLCRDY 63
           DF  I+ +RLPTLYEVL+++TS PVDLW+FYTFLSQFPYAI++LDFW+DLMAH RLC+ Y
Sbjct: 6   DFEKIQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWVDLMAHTRLCKSY 65

Query: 64  VRGVKESIEARNSELIADDAHSDESNVLLDALLTEGYLDFKNARRVSQFLRGNVEESMRI 123
           V  V +S+     E   +   S  +  LL+AL+ EG+LD +   R+ +    ++  S ++
Sbjct: 66  VELVTKSLINFPKE---NGGASTTTLDLLNALIEEGHLDLEAPGRLLKSDGQDMPFSPKL 122

Query: 124 SRLLDTFKQDHRLSTQSDREADEFLAAMVDDMLKQKIHKDKQPKMTRKQLINNASQICRQ 183
           ++LL  +K+   +S  S R  D  +A +VD++LK++  +D  P++T KQL ++A  +C  
Sbjct: 123 NQLLGDWKRQSGMSQDSLRRDD--IALIVDEILKRRSQQDGIPQITTKQLFHSAVGLCNT 180

Query: 184 YLLSPQESPRYLINVPDEIRMKALHAVQSERRFDPELFEDLRNLSYDFLEMDCFPKFLNR 243
           YL+SP++S RYL N+P E R + +  +Q ++++D E+F+D++NL+Y FLEMDCFPKFL+R
Sbjct: 181 YLVSPEQSERYLSNIPTETRNRIIEDIQVQQKYDIEVFDDIKNLTYQFLEMDCFPKFLSR 240

Query: 244 VALHNLHDQLSDWRFQTTAAIGKSKGDIRGQR--SASPLSTYSGLGRIALGLCWLGIGFW 301
           VALHN+HD++SDWRF +  A  +     RGQ   S SP S ++ + RI  GL WLGIGFW
Sbjct: 241 VALHNIHDEISDWRFHSVNATNEKGKRFRGQAHISRSPFSNHTSISRIGFGLLWLGIGFW 300

Query: 302 IGYVLIFLHYSRAIRVTTIVPFGIGCYFSVCGIYQVDILYSWFGVTQRLMYEKKLPSDRE 361
           IGYVLIFL Y RAIRV T+VPF +GCY  VCG+YQVDI+YSWFGVTQRL++  K  S  +
Sbjct: 301 IGYVLIFLAYGRAIRVVTVVPFALGCYCIVCGMYQVDIVYSWFGVTQRLLHRHKNSSSDQ 360

Query: 362 EDVPKSRTRVPTIFALLGGRSRLMPVHHPFIKKLLLRRGMWCXXXXXXXXXXXXXXXXCV 421
           + V      VP + A+ GG+ RL  V HPF ++LL +RG+WC                CV
Sbjct: 361 DGVSAGSDHVPVLLAVFGGKRRLTRVKHPFTRQLLRKRGLWCLLLVVGATAAFTVIFSCV 420

Query: 422 PGKRI 426
           PG+R+
Sbjct: 421 PGRRV 425

>Skud_15.468 Chr15 (820871..822142) [1272 bp, 423 aa] {ON} YOR301W
           (REAL)
          Length = 423

 Score =  426 bits (1096), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 209/425 (49%), Positives = 290/425 (68%), Gaps = 9/425 (2%)

Query: 4   DFTPIENQRLPTLYEVLLRQTSPPVDLWSFYTFLSQFPYAIDFLDFWIDLMAHVRLCRDY 63
           DF  ++  RLPTLYEVL+++TS PVDLW+FYTFLSQFPYAI++LDFWIDLMAH RLC+ Y
Sbjct: 6   DFEELQRVRLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWIDLMAHTRLCQSY 65

Query: 64  VRGVKESIEARNSELIADDAHSDESNVLLDALLTEGYLDFKNARRVSQFLRGNVEESMRI 123
           V  V++S+     E   +   S +++ LL AL+ EG+LD +   ++ Q    ++  S ++
Sbjct: 66  VELVRKSLVNYPQEQQENGGASVKTHDLLSALVEEGHLDPETPEKLLQNSGPDLPFSPKL 125

Query: 124 SRLLDTFKQDHRLSTQSDREADEFLAAMVDDMLKQKIHKDKQPKMTRKQLINNASQICRQ 183
           ++LL+ +K+   +S  S R  D  +  +VD++LK++  +D  P++T KQL+++A  +C  
Sbjct: 126 NQLLEGWKRQSGISEDSLRNED--MTLIVDEILKRRSQQDGVPQITTKQLLHSAMGLCTT 183

Query: 184 YLLSPQESPRYLINVPDEIRMKALHAVQSERRFDPELFEDLRNLSYDFLEMDCFPKFLNR 243
           YL S ++  RYL N+P E R + +  VQ +RR+D E+F+D++NL+Y FLEMDCFPKFL+R
Sbjct: 184 YLASSEQRERYLSNIPTETRNRIVKDVQVKRRYDIEVFDDVKNLAYQFLEMDCFPKFLSR 243

Query: 244 VALHNLHDQLSDWRFQTTAAIGKSKGDIRGQR--SASPLSTYSGLGRIALGLCWLGIGFW 301
           VALHN+HD++SDWRF +  A  +    +RGQ   S SP S ++ + RI  GL WLGIGFW
Sbjct: 244 VALHNIHDEISDWRFHSVGATNEKNKRVRGQTHISRSPFSNHTSISRIGFGLLWLGIGFW 303

Query: 302 IGYVLIFLHYSRAIRVTTIVPFGIGCYFSVCGIYQVDILYSWFGVTQRLMYEKKLPSDRE 361
           IGYVLIFL YSRAIRV T+VPF +GCY  VCG+YQVDI+YSWFGVTQRL++  K  SD E
Sbjct: 304 IGYVLIFLAYSRAIRVVTVVPFALGCYCIVCGMYQVDIVYSWFGVTQRLLHRHKDGSDNE 363

Query: 362 EDVPKSRTRVPTIFALLGGRSRLMPVHHPFIKKLLLRRGMWCXXXXXXXXXXXXXXXXCV 421
           +D  +    VP I      +SRL  V HPFI++LL +RG+WC                CV
Sbjct: 364 DDSSEDFDHVPAIL-----KSRLTCVQHPFIRQLLRKRGLWCLLLVVGATAAFTVIFSCV 418

Query: 422 PGKRI 426
           PG+R+
Sbjct: 419 PGRRV 423

>Kpol_1010.13 s1010 complement(27385..28884) [1500 bp, 499 aa] {ON}
           complement(27385..28884) [1500 nt, 500 aa]
          Length = 499

 Score =  428 bits (1101), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 221/496 (44%), Positives = 309/496 (62%), Gaps = 75/496 (15%)

Query: 4   DFTPIENQRLPTLYEVLLRQTSPPVDLWSFYTFLSQFPYAIDFLDFWIDLMAHVRLCRDY 63
           DF  I+ +RLPTLYEVL+++T  PVDLWSFYTFLSQFP+A+++L+FWIDLM+H+RLC+DY
Sbjct: 6   DFDRIQQERLPTLYEVLIQKTDSPVDLWSFYTFLSQFPHALNYLEFWIDLMSHIRLCKDY 65

Query: 64  VRGVKESIEARNSELIA-------------------------------DDAHSDESNVLL 92
           +RG++ES+   N EL +                                D  S  S++L+
Sbjct: 66  IRGIRESVLIPNEELKSRRQSEVYENVERNVIETENDIEQPNKENNGDQDNISVTSSILI 125

Query: 93  DALLTEGYLDFKNARRVSQFLRGNVEESMRISRLLDTFKQDHRLSTQSDREA------DE 146
           DAL+ EGYLDF+N ++V++FL+G++E S ++S+LLD +K+       S+ ++      D 
Sbjct: 126 DALMDEGYLDFQNPQKVNRFLQGDLEYSPQLSQLLDDWKRHSGYIDHSNDDSYASSGKDN 185

Query: 147 FLAAMVDDMLKQ--KIHKDKQPKMTRKQLINNASQICRQYLLSPQESPRYLINVPDEIRM 204
            + + VD +L+   K+H+++ P++T K L+ NA  IC  YL+SP++S +YLINVP+ IR 
Sbjct: 186 KIVSAVDGLLQNYTKMHQER-PQVTAKLLLQNAQTICSLYLISPEKSEKYLINVPEHIRN 244

Query: 205 KALHAVQSERRFDPELFEDLRNLSYDFLEMDCFPKFLNRVALHNLHDQLSDWRFQ----- 259
           + L  V+   R DPE+FE +R+L+Y FLE+DCF KFLNRVALHN+HDQ+SDW++      
Sbjct: 245 ETLQLVEIGGRHDPEVFESMRSLAYQFLEIDCFSKFLNRVALHNIHDQISDWKYHPVKPH 304

Query: 260 -----------------------TTAAIGKSKGDIRGQR--SASPLSTYSGLGRIALGLC 294
                                  + A+  +S  ++   R  S SP S Y+ + RI  G  
Sbjct: 305 SHNDNNTEKKQPKKNLKIFGMNLSNASDDESVNEVEYSRHQSRSPFSNYTTISRICFGTF 364

Query: 295 WLGIGFWIGYVLIFLHYSRAIRVTTIVPFGIGCYFSVCGIYQVDILYSWFGVTQRLMYEK 354
           W+GIGFWIGYVLIFL+Y+R IRV TIVPF IG YF VCGIYQVD++YSWFGVTQ LM+  
Sbjct: 365 WMGIGFWIGYVLIFLNYNRGIRVVTIVPFAIGSYFIVCGIYQVDVVYSWFGVTQELMFRH 424

Query: 355 KLPSDREEDVP----KSRTRVPTIFALLGGRSRLMPVHHPFIKKLLLRRGMWCXXXXXXX 410
           K  SD E   P    K+   VP I  +LGG+SRL+ + H FI+ LL +RG+WC       
Sbjct: 425 K-SSDEENGHPMNLDKNNKGVPGILKVLGGKSRLIRIDHQFIRNLLFKRGLWCCAIITIS 483

Query: 411 XXXXXXXXXCVPGKRI 426
                    CVPG+R+
Sbjct: 484 TAIFTVIFSCVPGRRV 499

>SAKL0B05456g Chr2 (470064..471362) [1299 bp, 432 aa] {ON} similar
           to uniprot|Q08760 Saccharomyces cerevisiae YOR301W RAX1
           Protein involved in bud site selection during bipolar
           budding localization requires Rax2p
          Length = 432

 Score =  417 bits (1071), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 215/443 (48%), Positives = 308/443 (69%), Gaps = 28/443 (6%)

Query: 1   MEGDFTPIENQRLPTLYEVLLRQTSPPVDLWSFYTFLSQFPYAIDFLDFWIDLMAHVRLC 60
           ME + T +++ RLPTLYEVL +QT+ PVDLWSFYT+LSQFP+AI++LDFWID+MAH+RLC
Sbjct: 1   METESTKLQSDRLPTLYEVLNQQTTTPVDLWSFYTYLSQFPHAINYLDFWIDIMAHLRLC 60

Query: 61  RDYVRGVKESI----EA-------RNSELIADDAHSDES-NVLLDALLTEGYLDFKNARR 108
           +DYV+G++ES+    EA       ++   ++D+  S  S ++LL+AL+ +G LDF++++R
Sbjct: 61  KDYVKGIRESVLVWEEANRPPRIPKHDSGVSDNYRSSVSTSLLLEALMNDGVLDFQDSKR 120

Query: 109 VSQFLRGNVEESMRISRLLDTFKQDHRLSTQSDREADEFLAAMVDDMLKQKIHKDKQPKM 168
           VSQFL+G  + S R+S+L++ +K+      QS  E ++ L  ++DD LKQ++ + +QP++
Sbjct: 121 VSQFLQGQTD-SPRLSQLMENWKR------QSALEDNDRLTEVLDDFLKQEMKESQQPRI 173

Query: 169 TRKQLINNASQICRQYLLSPQESPRYLINVPDEIRMKALHAVQSERRFDPELFEDLRNLS 228
           T KQL+NNA QI   YL SPQ+SP++L+NVP++IR+ A+H VQ ++R DP++FE L++++
Sbjct: 174 TTKQLLNNALQIVNMYLSSPQQSPKFLVNVPEKIRLDAIHTVQVQQRHDPDVFESLKSVA 233

Query: 229 YDFLEMDCFPKFLNRVALHNLHDQLSDWRFQTTAAIGKSKGDIRGQRSASPLSTYSGLGR 288
           + FLEMDCFPKFL  VALHNLHD ++D     ++ +G      +  R +S  STY+ L R
Sbjct: 234 FQFLEMDCFPKFLGCVALHNLHDDMTD----HSSPLGGKTATTQRHRKSSLFSTYTILSR 289

Query: 289 IALGLCWLGIGFWIGYVLIFLHYSRAIRVTTIVPFGIGCYFSVCGIYQVDILYSWFGVTQ 348
           + LGL  LGIGFWIGYVLIFL YSR IRV TIVPF +G Y+ VCGIYQ+D++Y+ FGVTQ
Sbjct: 290 VFLGLLLLGIGFWIGYVLIFLDYSRGIRVVTIVPFFLGFYYVVCGIYQLDVVYALFGVTQ 349

Query: 349 RLMYEK-----KLPSDREEDVPKSRTRVPTIFALLGGRSRLMPVHHPFIKKLLLRRGMWC 403
            L+  K     +L   R      +  R+P IF +LGGR RL+ V HPF+ ++L RR +WC
Sbjct: 350 NLVTNKDKRDLELGYQRNSSKSSNVRRLPVIFRVLGGRGRLVKVRHPFVDRILKRRSVWC 409

Query: 404 XXXXXXXXXXXXXXXXCVPGKRI 426
                           CVPG R+
Sbjct: 410 WFLILLGTAIFTVIFSCVPGHRL 432

>TPHA0G01210 Chr7 complement(246099..247583) [1485 bp, 494 aa] {ON}
           Anc_8.774 YOR301W
          Length = 494

 Score =  413 bits (1062), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 209/495 (42%), Positives = 309/495 (62%), Gaps = 70/495 (14%)

Query: 1   MEGDFTPIENQRLPTLYEVLLRQTSPPVDLWSFYTFLSQFPYAIDFLDFWIDLMAHVRLC 60
           M  DF  ++ +RLPTLYEVL+ +T  PVDLWSFYTFLSQFP+AI++L+FWIDLMAH+RLC
Sbjct: 1   MAIDFEKLQEERLPTLYEVLILKTEKPVDLWSFYTFLSQFPHAINYLEFWIDLMAHIRLC 60

Query: 61  RDYVRGVKESI-----EARNSELI-----------------------------ADDAHSD 86
           +DY+  ++ S+     E+R S+                               ADD+ S 
Sbjct: 61  KDYLENIRSSVIEVVDESRVSDEYGNLTTAGDHRKHKEESSSDRYGPGGNDGDADDSASV 120

Query: 87  ESNVLLDALLTEGYLDFKNARRVSQFLRGNVEESMRISRLLDTFKQDHRLSTQSDREADE 146
            S++L++AL+ EGYLDF++  +V++FL+G++E S ++S+LL  +++   +  + + + +E
Sbjct: 121 TSSLLINALMNEGYLDFQDPDQVNRFLQGDIEYSPQLSQLLAEWRRHSGIPGKRNDDVNE 180

Query: 147 F------------------LAAMVDDMLKQKIHKDK------QPKMTRKQLINNASQICR 182
                              + + +DD+LK  +          +P++T KQL +NA+QIC 
Sbjct: 181 SEIDENTGEKKNQVGYENKILSAIDDLLKNHVSGQNNAGETIKPQITTKQLHHNAAQICT 240

Query: 183 QYLLSPQESPRYLINVPDEIRMKALHAVQSERRFDPELFEDLRNLSYDFLEMDCFPKFLN 242
            YLLSP+ S +YLIN+P+ +R   L A+Q+++R+DP++FE+L+N+SY FLE+DCF KFL 
Sbjct: 241 LYLLSPERSDKYLINIPEHVREDTLKAIQNDKRYDPDVFEELKNISYQFLEIDCFTKFLG 300

Query: 243 RVALHNLHDQLSDWRFQTTAA-------IGKSKGDIRGQRSASPLSTYSGLGRIALGLCW 295
           RVALHNLHDQ+SDWRF  ++          + K  +R   S S  S+Y+ L R+ LGL +
Sbjct: 301 RVALHNLHDQISDWRFHNSSTRFLPNEETHEKKKQLR-HHSRSLFSSYTTLSRVMLGLFF 359

Query: 296 LGIGFWIGYVLIFLHYSRAIRVTTIVPFGIGCYFSVCGIYQVDILYSWFGVTQRLMYEKK 355
           +GIGFWIGY LIFL+Y+R IRV TIVPF IG YF VCGIYQ+DI Y+ FG+TQ LMY+ K
Sbjct: 360 MGIGFWIGYALIFLNYARGIRVVTIVPFIIGSYFIVCGIYQIDIAYACFGITQELMYKHK 419

Query: 356 LPSDRE----EDVPKSRTRVPTIFALLGGRSRLMPVHHPFIKKLLLRRGMWCXXXXXXXX 411
              D E    +++      +  +F +LGG++RL+ + HPFI+ L+ +RG+WC        
Sbjct: 420 RSPDEETNHSDNLEAKDGEISGLFKILGGQTRLIKIKHPFIRNLIYKRGLWCLLWVLIST 479

Query: 412 XXXXXXXXCVPGKRI 426
                   CVP +R+
Sbjct: 480 GVFTVIFACVPSRRV 494

>KNAG0G03100 Chr7 (673022..674413) [1392 bp, 463 aa] {ON} Anc_8.774
           YOR301W
          Length = 463

 Score =  387 bits (993), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 211/465 (45%), Positives = 293/465 (63%), Gaps = 41/465 (8%)

Query: 1   MEGDFTPIENQRLPTLYEVLLRQTSPPVDLWSFYTFLSQFPYAIDFLDFWIDLMAHVRLC 60
           M+ +F  I+ +RLPTLYEVL++++  P+DLWSFYT+LSQFP+AI++LDFWIDLMAH+RLC
Sbjct: 1   MDRNFAQIQKERLPTLYEVLIQKSGAPLDLWSFYTYLSQFPFAINYLDFWIDLMAHIRLC 60

Query: 61  RDYVRGVKESI-EA--RNSELI----ADDAHSDESNVLLDALLTEGYLDFKNARRVSQFL 113
           +D+++GV+ SI EA  RN E      ADD  S  ++VL+  ++ E  LD      V  F 
Sbjct: 61  KDFIKGVRRSIGEAAERNEEQQGGGGADDTASVTTSVLMQTIMEEAQLDLNRPDDVYSFF 120

Query: 114 RGNVEE-------------SMRISRLLDTF--KQDHRLSTQSDREADEFLAAMVDDMLKQ 158
           R + ++             S R+S++LD +  +  HR +  S   ++  L  ++D+ L +
Sbjct: 121 RNSHQQDGLGDNLRASSRYSARVSQMLDEWNGRTSHRYTGHSVDISNGNLTTLMDEFLNE 180

Query: 159 --KIHKDKQPKMTRKQLINNASQICRQYLLSPQESPRYLINVPDEIRMKALHAVQSERRF 216
             K   D    +T KQL++NA+ +CR YL+S +ES RYL N+P EIR   L  V   +++
Sbjct: 181 HSKTRGDGGAYITTKQLLHNATHMCRTYLISREESERYLTNIPTEIREYILVGVLDAKKY 240

Query: 217 DPELFEDLRNLSYDFLEMDCFPKFLNRVALHNLHDQLSDWRFQT----------TAAIGK 266
           DP +F+DL+ L+Y FLE+DCFPKFL++VALHNLHD++S+WRF             A  G 
Sbjct: 241 DPGIFDDLKTLTYQFLEIDCFPKFLSQVALHNLHDEISNWRFNKLDSTKYSGGGGALTGD 300

Query: 267 SKGDIRGQRSA-SPLSTYSGLGRIALGLCWLGIGFWIGYVLIFLHYSRAIRVTTIVPFGI 325
            + D  G R A +P S Y+ L RI  GL WLGIGFWIGY LIFL YSRAIRV T+VPF +
Sbjct: 301 PEKDAVGYRGAHTPFSNYTTLSRILFGLLWLGIGFWIGYTLIFLKYSRAIRVVTVVPFAL 360

Query: 326 GCYFSVCGIYQVDILYSWFGVTQRLMYEKKLPSDREEDVP----KSRTRVPTIFALLGGR 381
           GCY+ +CG+YQVDI+YS FGVTQRL+  +   +   ED P     +  +VP++  L GGR
Sbjct: 361 GCYYCICGLYQVDIIYSIFGVTQRLLQRETAAAG--EDPPTHTDATTAKVPSLLVLFGGR 418

Query: 382 SRLMPVHHPFIKKLLLRRGMWCXXXXXXXXXXXXXXXXCVPGKRI 426
            RL+ + H F ++LLLRRG+WC                CVPG R+
Sbjct: 419 GRLLKIEHEFTRRLLLRRGLWCLLLVTFSTAAFTVIFSCVPGYRV 463

>Kwal_34.15943 s34 complement(128372..129670) [1299 bp, 432 aa] {ON}
           YOR301W (RAX1) - Similar to B-chains of the
           insulin-related hormone superfamily. [contig 272] FULL
          Length = 432

 Score =  379 bits (974), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 200/429 (46%), Positives = 277/429 (64%), Gaps = 19/429 (4%)

Query: 11  QRLPTLYEVLLRQTSPPVDLWSFYTFLSQFPYAIDFLDFWIDLMAHVRLCRDYVRGVKES 70
            RLPTL+EVL RQ++ PVDLWSFY FLSQ+PYAI+FLDFWID+MAH+RLC+DYV+G++ES
Sbjct: 10  SRLPTLFEVLNRQSAAPVDLWSFYIFLSQYPYAINFLDFWIDVMAHLRLCKDYVKGIRES 69

Query: 71  IEARNSELIADDAHSDESNVLL-----DALLTEGYLDFKNARRVSQFLRGNVEESMRISR 125
           +      L    A+ D  + L      +AL+ +GYLD+++++RVS+FL+G+ + S R++R
Sbjct: 70  VIEWEDSLERSGANRDSRDSLSSSLLLEALMNDGYLDYEDSKRVSRFLQGHTD-SPRLTR 128

Query: 126 LLDTFKQDHRLSTQSDREADEFLAAMVDDMLKQKIHKDKQPKMTRKQLINNASQICRQYL 185
           LLD + Q H     +       L  +VDD LK + H   + ++T K+L+NNA  I   YL
Sbjct: 129 LLDNW-QKHADQDSAGAPFKSPLTGLVDDFLKTQAHDFHKARITSKELLNNAQNIVNTYL 187

Query: 186 LSPQESPRYLINVPDEIRMKALHAVQSERRFDPELFEDLRNLSYDFLEMDCFPKFLNRVA 245
           LSP+ S RYLIN+PD +R   L  V+ E+R DPELFE L++L++ FLEMDCFPKFL  VA
Sbjct: 188 LSPETSVRYLINLPDHMRENTLRMVRDEKRHDPELFEQLKSLAFQFLEMDCFPKFLTSVA 247

Query: 246 LHNLHDQLSDWRFQTTAAIGKSKGDIRGQRSASPLSTYSGLGRIALGLCWLGIGFWIGYV 305
           LHNLHD ++        A      +    R  SP + ++ L R+ALG+ +L +G W+GY 
Sbjct: 248 LHNLHDDITT---PPLTAPQTPAHEPSFTRRHSPFAHHTTLSRVALGMLFLWMGLWLGYT 304

Query: 306 LIFLHYSRAIRVTTIVPFGIGCYFSVCGIYQVDILYSWFGVTQRLMYEKKLPSDREEDVP 365
           LIFL YSR IRVTTIVPF +G YF  CGIY++DILY+  GVTQ L+  +++ S ++ ++ 
Sbjct: 305 LIFLDYSRGIRVTTIVPFFLGFYFICCGIYRIDILYALAGVTQTLVSNEQV-SLKDLEIG 363

Query: 366 KSRTRV--------PTIFALLGGRSRLMPVHHPFIKKLLLRRGMWCXXXXXXXXXXXXXX 417
            +R  V        P +F +LGG  RL+ + HPFI KLL +RG WC              
Sbjct: 364 LNRNSVNHRMSHNAPFVFRILGGTGRLVRIKHPFINKLLKKRGYWCLLLVLTLTGVFTVI 423

Query: 418 XXCVPGKRI 426
             CVPG+R+
Sbjct: 424 FSCVPGRRL 432

>KLTH0H15070g Chr8 (1304724..1306040) [1317 bp, 438 aa] {ON} similar
           to uniprot|Q08760 Saccharomyces cerevisiae YOR301W RAX1
           Protein involved in bud site selection during bipolar
           budding localization requires Rax2p
          Length = 438

 Score =  378 bits (970), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 199/434 (45%), Positives = 277/434 (63%), Gaps = 24/434 (5%)

Query: 11  QRLPTLYEVLLRQTSPPVDLWSFYTFLSQFPYAIDFLDFWIDLMAHVRLCRDYVRGVKES 70
           QRLPTLYEVL RQT  PVDLWSFYTFLSQ+PYAI+FLDFWID MAH+RLC+DYV+GV+ES
Sbjct: 11  QRLPTLYEVLNRQTCAPVDLWSFYTFLSQYPYAINFLDFWIDAMAHLRLCKDYVKGVRES 70

Query: 71  I-----------EARNSELIADDAHSDESNVLLDALLTEGYLDFKNARRVSQFLRGNVEE 119
                         R+S    D+  S  S++LL+AL+ +G+LD+++++RVS+FL+G  + 
Sbjct: 71  FVEWEDSQERSGANRDSRDSHDNRDSLSSSLLLEALMNDGFLDYEDSKRVSRFLQGQTD- 129

Query: 120 SMRISRLLDTFKQDHRLSTQSDREADEFLAAMVDDMLKQKIHKDKQPKMTRKQLINNASQ 179
           S R+++LLD +++  +    SD      L  +VD+ LK +    ++ ++T K+L+NNA  
Sbjct: 130 SPRLTKLLDNWQK--QTEHDSDAPFKSPLTGLVDEFLKTQAQDFQKARITSKELLNNARN 187

Query: 180 ICRQYLLSPQESPRYLINVPDEIRMKALHAVQSERRFDPELFEDLRNLSYDFLEMDCFPK 239
           I   YLL+P+ES RYLIN+PD +R  A+H V  E+R DP++FE L+ +S+ FLEMDCFPK
Sbjct: 188 IVHTYLLAPEESSRYLINLPDHMRQNAVHMVLEEKRHDPDVFEQLKAISFQFLEMDCFPK 247

Query: 240 FLNRVALHNLHDQLSDWRFQTTAAIGKSKGDIRGQRSASPLSTYSGLGRIALGLCWLGIG 299
           FL+ VALHNLHD ++        AI  S       R  S  + Y+ L R+ LG+ +L +G
Sbjct: 248 FLSCVALHNLHDDITSSSLSDPLAILGSSAP---GRRRSLFARYTTLSRVVLGMIFLWMG 304

Query: 300 FWIGYVLIFLHYSRAIRVTTIVPFGIGCYFSVCGIYQVDILYSWFGVTQRLMYEKKLPS- 358
            W+GY L+FL+YSR IRVTTIVPF +G YF  CGIY++DILY+  GVTQ L+  + + S 
Sbjct: 305 LWLGYTLVFLNYSRGIRVTTIVPFFLGFYFIWCGIYKIDILYALCGVTQTLVSNELVSSK 364

Query: 359 ------DREEDVPKSRTRVPTIFALLGGRSRLMPVHHPFIKKLLLRRGMWCXXXXXXXXX 412
                 +R     K+R     +F + GG SRL+ +  PF+  +L RR +WC         
Sbjct: 365 DLEIGLNRNAVHNKTRQSTSPVFRVFGGSSRLVSIQQPFVNSMLRRRALWCLVLVLAGTA 424

Query: 413 XXXXXXXCVPGKRI 426
                  CVPG R+
Sbjct: 425 IFTVIFSCVPGHRL 438

>Suva_8.352 Chr8 (621701..623104) [1404 bp, 467 aa] {ON} YOR301W
           (REAL)
          Length = 467

 Score =  370 bits (950), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 191/388 (49%), Positives = 269/388 (69%), Gaps = 7/388 (1%)

Query: 4   DFTPIENQRLPTLYEVLLRQTSPPVDLWSFYTFLSQFPYAIDFLDFWIDLMAHVRLCRDY 63
           DF  I+ +RLPTLYEVL+++TS PVDLW+FYTFLSQFPYAI++LDFW+DLMAH RLC+ Y
Sbjct: 6   DFEKIQYERLPTLYEVLIQRTSRPVDLWTFYTFLSQFPYAINYLDFWVDLMAHTRLCQSY 65

Query: 64  VRGVKESIEARNSELIADDAHSDESNVLLDALLTEGYLDFKNARRVSQFLRGNVEESMRI 123
           V+ V++S+     E       S  +  LLDAL+ EG+L+ ++   + Q    +V  S ++
Sbjct: 66  VKMVRKSLANFPQEHQQKGDGSATTFNLLDALIEEGHLNLQSPENLLQNEPSDVPFSPKL 125

Query: 124 SRLLDTFKQDHRLSTQSDREADEFLAAMVDDMLKQKIHKDKQPKMTRKQLINNASQICRQ 183
           + +L  +K  H      D   +E +A ++D++LK++  +D  P++T KQL+++A  +C  
Sbjct: 126 NEMLGNWK--HHSGISQDALQNEDMALILDEILKRRSQQDGVPQITTKQLLHSAMGLCTT 183

Query: 184 YLLSPQESPRYLINVPDEIRMKALHAVQSERRFDPELFEDLRNLSYDFLEMDCFPKFLNR 243
           YL+SP++S RYL N+P E R + L  +Q +R++D  +F+D++ L+Y FLEMDCFPKFL+R
Sbjct: 184 YLVSPEQSERYLSNIPAETRTRILEDIQVDRKYDVAIFDDVKALTYQFLEMDCFPKFLSR 243

Query: 244 VALHNLHDQLSDWRFQTTAAIGKSKGDIRGQRSASPLSTYSGLGRIALGLCWLGIGFWIG 303
           VALHN+HD++SDWRF +  +  + +  I    S SP S ++ + RI LGL WLGIGFWIG
Sbjct: 244 VALHNIHDEISDWRFHSKNSRSRGQTHI----SRSPFSNHTSISRIGLGLLWLGIGFWIG 299

Query: 304 YVLIFLHYSRAIRVTTIVPFGIGCYFSVCGIYQVDILYSWFGVTQRLMYEKKLPSDREED 363
           YVLIFL Y RAIRV T+VPF +GCY  VCG+YQVDI+YSWFGVTQRL++  K  S+ +  
Sbjct: 300 YVLIFLAYGRAIRVVTVVPFALGCYCVVCGMYQVDIVYSWFGVTQRLLHRHK-NSNDDAG 358

Query: 364 VPKSRTRVPTIFALLGGRSRLMPVHHPF 391
                  VP + A+ GG+SRL  V HPF
Sbjct: 359 AATDADHVPGVLAVFGGKSRLTSVQHPF 386

>KLLA0F24904g Chr6 complement(2319858..2321132) [1275 bp, 424 aa]
           {ON} similar to uniprot|Q08760 Saccharomyces cerevisiae
           YOR301W RAX1 Protein involved in bud site selection
           during bipolar budding localization requires Rax2p
          Length = 424

 Score =  360 bits (923), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 187/434 (43%), Positives = 268/434 (61%), Gaps = 33/434 (7%)

Query: 9   ENQRLPTLYEVLLRQTSPPVDLWSFYTFLSQFPYAIDFLDFWIDLMAHVRLCRDYVRGVK 68
           +  RLPTLYEVL +QT+ P+DLWSFYT+LSQ+P+AI +LDFW D+MA++RLC+DYV+G++
Sbjct: 8   QRARLPTLYEVLNQQTAAPLDLWSFYTYLSQYPHAIVYLDFWTDVMAYLRLCKDYVKGIR 67

Query: 69  ESIEARNS--------ELIADDA-HSDESNVLLDALLTEGYLDFKNARRVSQFLRGNVEE 119
           ES+   N         E   DD   S  S +LL+AL+ +GYLD+ +++RVSQFL+G  + 
Sbjct: 68  ESVLDVNKLETPTVLQEGNGDDKRESVSSAMLLEALMNDGYLDYNDSQRVSQFLKGETD- 126

Query: 120 SMRISRLLDTFKQDHRLSTQSDREADEFLAAMVDDMLKQKIHKDKQPKMTRKQLINNASQ 179
           S R+S+LL  +KQ +  + Q D       +  VD ++K  + KD +PK+T KQLI++A  
Sbjct: 127 SPRLSQLLQDWKQVN--NDQID------FSDFVDGLVKSNVTKDHKPKLTTKQLISSAQD 178

Query: 180 ICRQYLLSPQESPRYLINVPDEIRMKALHAVQSERRFDPELFEDLRNLSYDFLEMDCFPK 239
           I   YLLS ++S R+L  +P  +R   +  +  E+R DPE+FE ++ + Y FLE+DCFP+
Sbjct: 179 IVSTYLLSQEQSDRFLFEIPAYLRNDTIRLIMEEKRHDPEVFEPIKEIVYQFLEVDCFPR 238

Query: 240 FLNRVALHNLHDQLSDWRFQTTAAIGKSKGDIRGQRSASPLSTYSGLGRIALGLCWLGIG 299
           FL  VALHNLHD++   R          K      RS SP S +S   R+ +GL W  +G
Sbjct: 239 FLGCVALHNLHDEIVLQR--------PKKNKSYNSRSNSPFSQWSTASRLTIGLAWWLVG 290

Query: 300 FWIGYVLIFLHYSRAIRVTTIVPFGIGCYFSVCGIYQVDILYSWFGVTQRLMYEKKLP-- 357
            WIGY LIF++YS+ IRV  IVPF +G Y+ +CGIY VDI+Y++ GVTQ L+ ++KL   
Sbjct: 291 LWIGYTLIFMNYSKGIRVVCIVPFFLGSYYIICGIYLVDIIYAFSGVTQTLVSKRKLDDL 350

Query: 358 -----SDREEDVPKSRTRVPTIFALLGGRSRLMPVHHPFIKKLLLRRGMWCXXXXXXXXX 412
                ++   +   S   VP    + GGRSRL  V HPF+  +++RR +WC         
Sbjct: 351 ELRSMNNHRSNSLHSSNEVPWWLTIFGGRSRLCKVKHPFVNSIMIRRALWCLLLVLIMTA 410

Query: 413 XXXXXXXCVPGKRI 426
                   VPG+RI
Sbjct: 411 ILTAIFAAVPGRRI 424

>AFR532W Chr6 (1391215..1392483) [1269 bp, 422 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR301W (RAX1)
          Length = 422

 Score =  338 bits (867), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 181/444 (40%), Positives = 273/444 (61%), Gaps = 40/444 (9%)

Query: 1   MEGDFTPIENQRLPTLYEVLLRQTSPPVDLWSFYTFLSQFPYAIDFLDFWIDLMAHVRLC 60
           ME +   ++++RLPTL+EVL  QT+ PVD WSFYTFL Q+P A++++DFW+D+MAH+RLC
Sbjct: 1   METEEWRLQSERLPTLFEVLNNQTAAPVDSWSFYTFLFQYPGALNYMDFWVDVMAHLRLC 60

Query: 61  RDYVRGVKES-----IEARNSELIADDAHSDE------SNVLLDALLTEGYLDFKNARRV 109
           +DYV+G++ES     +E +        A S E      S+VLLDALL +GYLD+ + RR+
Sbjct: 61  KDYVKGIRESMMLLEVEEQQGRSRGRPAGSTEKRQSLSSSVLLDALLNDGYLDYHDNRRI 120

Query: 110 SQFLRGNVEESMRISRLLDTFKQDHRLSTQSDREADEFLAAMVDDMLKQKIHKDKQPKMT 169
           SQFL+G+  ES R+S+L +    D   S +     +  L+ M+D+ L +++ + ++PK+T
Sbjct: 121 SQFLKGD-GESARLSQLFEGRGGDS--SGEKAPTEEPHLSLMLDEFLVRQMKESQRPKLT 177

Query: 170 RKQLINNASQICRQYLLS--PQESPRYLINVPDEIRMKALHAVQSERRFDPELFEDLRNL 227
            KQL+ +A+ I  +YL+S     S R L  VP+ +R++ ++ V+ E+R+DP++FE L+ +
Sbjct: 178 TKQLVASANTIVDRYLVSKDSMRSERLLTTVPEHMRLEVINLVKGEQRYDPDVFEPLKII 237

Query: 228 SYDFLEMDCFPKFLNRVALHNLHDQLSDWRFQTTAAIGKSKGDIRGQRSASPLSTYSGLG 287
           S+ FLE+ CFPKFL+ VALHNLH  +S                +  + S SP S  + L 
Sbjct: 238 SFQFLEIYCFPKFLSSVALHNLHYDIS----------------LSQKASRSPYSQCTTLA 281

Query: 288 RIALGLCWLGIGFWIGYVLIFLHYSRAIRVTTIVPFGIGCYFSVCGIYQVDILYSWFGVT 347
           R+A G  +  +GFW+GY LIFL Y R +R  T+VPF IG Y+ VCG+Y +DI+Y+  GVT
Sbjct: 282 RVATGFFFWAVGFWVGYSLIFLDYPRRVRTVTLVPFLIGSYYIVCGVYHLDIIYAVCGVT 341

Query: 348 QRLMY-----EKKLPSDREEDVPKSRTRVPTIFALLGGRSRLMPVHHPFIKKLLLRRGMW 402
           Q L+      E +L  D++++   S T+VP  F  LGGR RL  V HPF+  ++ +R +W
Sbjct: 342 QTLISPRRYEEPELGLDQKQN---SATKVPFFFTFLGGRKRLTKVRHPFVLNIMRKRALW 398

Query: 403 CXXXXXXXXXXXXXXXXCVPGKRI 426
           C                 VP  R+
Sbjct: 399 CLFLVIVTTAVLTVIFTAVPSVRL 422

>Ecym_1476 Chr1 (980938..982299) [1362 bp, 453 aa] {ON} similar to
           Ashbya gossypii AFR532W
          Length = 453

 Score =  320 bits (821), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 179/471 (38%), Positives = 274/471 (58%), Gaps = 63/471 (13%)

Query: 1   MEGDFTPIENQRLPTLYEVLLRQTSPPVDLWSFYTFLSQFPYAIDFLDFWIDLMAHVRLC 60
           ME +    +++RLPTLYEVL  QT+ PVD WSFYTFL Q+P A++++DFW+D+MAH+RLC
Sbjct: 1   METEERRFQSERLPTLYEVLTNQTAAPVDSWSFYTFLFQYPGALNYMDFWVDVMAHLRLC 60

Query: 61  RDYVRGVKES---IEARNSELIADDAHSDESNV-----------------------LLDA 94
           +DYVRG++ES   +E    +          S V                       LLDA
Sbjct: 61  KDYVRGIRESMLLLEVEEQQQQQKHRQKRHSQVSAAGSDAAADNNNNNRMSVSSSLLLDA 120

Query: 95  LLTEGYLDFKNARRVSQFLRGNVEESMRISRLLDTFKQDHRLSTQSDR------------ 142
           LL +GYLD+ + +R+SQFL+G   +S R S+LL+           +++            
Sbjct: 121 LLNDGYLDYHDNKRISQFLKGEA-DSDRFSQLLENLPHGAEGGEGNNKGYDGEEPGHGDY 179

Query: 143 --EADEFLAAMVDDMLKQKIHKDKQPKMTRKQLINNASQICRQYLLSPQE--SPRYLINV 198
               D  L+ M+D+ L +++ + ++PK+T KQLI +A+ I  +YL++     S R L +V
Sbjct: 180 ATAEDAHLSVMLDEYLVRQMKESQRPKLTTKQLIASANAIVDRYLVAKDNMRSERLLTSV 239

Query: 199 PDEIRMKALHAVQSERRFDPELFEDLRNLSYDFLEMDCFPKFLNRVALHNLHDQLSDWRF 258
           P+ +R++ ++ V+ E+R+DP++FE L+ +S+ FLE+ CFPKFL+ VALHNLH  +S    
Sbjct: 240 PEHMRLEVINMVKGEQRYDPDVFEPLKIISFQFLEIYCFPKFLSSVALHNLHYDVS---- 295

Query: 259 QTTAAIGKSKGDIRGQRSASPLSTYSGLGRIALGLCWLGIGFWIGYVLIFLHYSRAIRVT 318
                       +  +   SP S  + L R+A G  + GIGFW+GY LIFL Y+R +R  
Sbjct: 296 ------------LTQKTRTSPYSQCTTLSRVATGFFFWGIGFWVGYTLIFLDYNRKVRTV 343

Query: 319 TIVPFGIGCYFSVCGIYQVDILYSWFGVTQRLMYEKKLPSDREEDVPKSRT---RVPTIF 375
           T++PF +GCY+ VCGIY +DI+Y+  GVTQ L+  ++  ++ E  + KS+T   +VP +F
Sbjct: 344 TLLPFFVGCYYIVCGIYHLDIIYAICGVTQTLVSPRRF-AEPELGLKKSKTNSAKVPLLF 402

Query: 376 ALLGGRSRLMPVHHPFIKKLLLRRGMWCXXXXXXXXXXXXXXXXCVPGKRI 426
           +LLGGR+RL  V HPF+  ++ +R +WC                 VP  R+
Sbjct: 403 SLLGGRNRLTKVRHPFVLNIMRKRALWCLFLVLVTTAVLTTIFTAVPSTRL 453

>TBLA0D00840 Chr4 (221070..222803) [1734 bp, 577 aa] {ON} Anc_8.774
           YOR301W
          Length = 577

 Score =  278 bits (711), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 158/441 (35%), Positives = 238/441 (53%), Gaps = 91/441 (20%)

Query: 77  ELIADDAHSDESNVLLDALLTEGYLDFKNARRVSQFLRGNVEES--MRISRLLDTFKQDH 134
           E I +D  S  S++LL+ L+ EGYL+  +  R+S+F +GN+  S   R+S+L+  +++ +
Sbjct: 137 EDIDNDNDSITSSILLNVLMNEGYLNPDDHYRMSKFFQGNIGGSNDYRMSQLMQNWQRHN 196

Query: 135 RLSTQSD-READ---------------------EFLAAMVDDMLKQK-------IHKDKQ 165
             S  ++ R+ +                     E  AAMVD++L+         I  + Q
Sbjct: 197 DNSNSNNTRQTNTGETNNAGNNSNSNSYTNNTTERFAAMVDELLQNNRIPMPSPILPNTQ 256

Query: 166 PK------------------MTRKQLINNASQICRQYLLSPQESPRYLINVPDEIRMKAL 207
                               +T + LI NA  IC  YL+SP++S +YLIN+P+ I+   +
Sbjct: 257 ENIQEQEDQANASSSSFLNGLTTRDLIKNARNICNLYLISPEKSKKYLINIPETIKFDII 316

Query: 208 HAVQSERRFDPELFEDLRNLSYDFLEMDCFPKFLNRVALHNLHDQLSDWRFQTTAAI--- 264
             ++ E RFDP +F+DL+NL+Y+FLE+DCFPKFL+++ALHN+HDQ+SDWRF ++  +   
Sbjct: 317 KKIKFENRFDPLIFDDLQNLTYNFLEVDCFPKFLSKIALHNIHDQISDWRFHSSFKLTSQ 376

Query: 265 ------GKSKGD------------------------IRGQRSASPLSTYSGLGRIALGLC 294
                 G S+ D                        I    S SP S Y+ + R+ +G  
Sbjct: 377 NRKSNRGLSENDNSSSTDNEKNYQSDNDDNDSMIYNIDNHISRSPFSNYTIISRLFVGFI 436

Query: 295 WLGIGFWIGYVLIFLHYSRAIRVTTIVPFGIGCYFSVCGIYQVDILYSWFGVTQRLMYE- 353
           WLGIGFWIGY LIFL+YSR IRVTT+ PF  GCY+ +CG+YQ+DI YS FGVTQ LM++ 
Sbjct: 437 WLGIGFWIGYTLIFLNYSRGIRVTTLPPFLFGCYYIICGLYQLDIFYSLFGVTQDLMFQP 496

Query: 354 --------KKLPSDREEDVPKSRTRVPTIFALLGGRSRLMPVHHPFIKKLLLRRGMWCXX 405
                   KK+    ++++   +  +P  F L GG+ RL+ + HP+I+ LL +RG+WC  
Sbjct: 497 KRNLLHANKKIDKTTKKNLKHLKRGIPFFFNLFGGKKRLIKIDHPYIRNLLFKRGIWCAI 556

Query: 406 XXXXXXXXXXXXXXCVPGKRI 426
                          VPG R+
Sbjct: 557 LVALSTAGLTVIFSVVPGWRV 577

 Score =  103 bits (256), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 44/75 (58%), Positives = 59/75 (78%)

Query: 1  MEGDFTPIENQRLPTLYEVLLRQTSPPVDLWSFYTFLSQFPYAIDFLDFWIDLMAHVRLC 60
          M  D+  I+++RLPTLYEVL++++S P DLWSFYT+LSQFPYAI++L+FWIDLM H RLC
Sbjct: 1  MSIDYKQIQHERLPTLYEVLIQKSSAPADLWSFYTYLSQFPYAINYLEFWIDLMNHNRLC 60

Query: 61 RDYVRGVKESIEARN 75
          R  +  +K S+   N
Sbjct: 61 RHLINEIKNSLIQNN 75

>Kwal_56.23939 s56 (788304..790319) [2016 bp, 671 aa] {ON} YGL083W
           (SCY1) - similar to bovine rhodopsin kinase; suppressor
           of GTPase mutation [contig 171] FULL
          Length = 671

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 3   GDFTPIENQRLPTLYEVLLRQTSPPVDLWSFYTFLSQFPYAIDFLDFWIDLMAHVRLCRD 62
           G +TP  N R P+  +V L  ++P + L +  +  + F +++  L +++    H+  C+D
Sbjct: 82  GQYTPDFNPRFPSFMQVPLNYSAPEIVLENMLSPKNDF-FSLGLLIYFLYYKKHLFTCQD 140

Query: 63  YVRGVKES 70
           Y+   KES
Sbjct: 141 YIGDYKES 148

>KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} similar
           to uniprot|P53275 Saccharomyces cerevisiae YGR127W
           Hypothetical ORF
          Length = 300

 Score = 33.5 bits (75), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 38/86 (44%), Gaps = 5/86 (5%)

Query: 6   TPIENQRLPTLYEVLLRQTSPPVDLWSFYTFLSQFP--YAIDFLDFWIDLMAHVRLCRDY 63
           +PI    +P  Y   L    P  D  SF  F+S++P     +F  F+ D +A    C D 
Sbjct: 87  SPISRGSVPMKY---LMDRGPSTDWNSFEKFVSKYPQITECEFNMFYGDCIAGEYTCIDS 143

Query: 64  VRGVKESIEARNSELIADDAHSDESN 89
           +    E++ A    L+  + H D S+
Sbjct: 144 LGYSSEALTANKPNLVLSNDHIDSSS 169

>CAGL0E05060g Chr5 complement(493370..496669) [3300 bp, 1099 aa]
           {ON} similar to uniprot|P53114 Saccharomyces cerevisiae
           YGL151w NUT1 negative transcription regulator
          Length = 1099

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 49/95 (51%), Gaps = 4/95 (4%)

Query: 32  SFYTFLSQFPYAIDFLDFWIDLMAHVRLCRDYVRGVKESIEARNSELIADDAHSDESNVL 91
           SF++  S   Y +DFL   ID +   +   D +R ++  +E    + + + + S+ES+ +
Sbjct: 901 SFWSLHSSTYYNLDFLKTLIDTLTPKQFLLDVLRTLEYKVETLGVKDVRNKSSSNESDQV 960

Query: 92  LDALLTEGYL-DFKN---ARRVSQFLRGNVEESMR 122
           +D L     L D +N   A+ ++QF+   V+ S+ 
Sbjct: 961 IDYLFYFLVLYDIENSEDAKAMAQFMEDTVDISIN 995

>Skud_10.120 Chr10 complement(219864..222485) [2622 bp, 873 aa] {ON}
           YJL094C (REAL)
          Length = 873

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 49/109 (44%), Gaps = 23/109 (21%)

Query: 274 QRSASPLSTYSGLGRIALGLCWLGIGFWIGYVLIFLHYSRAIRVTTI-VPFGIGCY---- 328
           Q S   L+  + LG I L + +LG+   I ++   L  + AI +TT+ VPFG GC     
Sbjct: 80  QSSIPGLNLVANLG-IILFMFFLGLEVDIAFIKKHLKKALAIGITTLAVPFGFGCLLAIP 138

Query: 329 ----------------FSVCGIY-QVDILYSWFGVTQRLMYEKKLPSDR 360
                           FSV  ++  V I  + F V  R++ E +L  DR
Sbjct: 139 LFHAYSNQTEGQRHVKFSVFMVFIAVSIAVTAFPVLCRILNELRLIKDR 187

>Ecym_6156 Chr6 complement(286295..292063) [5769 bp, 1922 aa] {ON}
            similar to Ashbya gossypii ACL181C
          Length = 1922

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 23/43 (53%)

Query: 54   MAHVRLCRDYVRGVKESIEARNSELIADDAHSDESNVLLDALL 96
            +A+VR+ R  V G K  +    SE I D A +  +NVL   LL
Sbjct: 1568 IAYVRVSRARVTGFKRKLIGDESEAIGDSARAHRTNVLAAELL 1610

>SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON}
           similar to uniprot|Q12150 Saccharomyces cerevisiae
           YLR087C CSF1 Protein required for fermentation at low
           temperature
          Length = 2997

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 38/67 (56%), Gaps = 7/67 (10%)

Query: 28  VDLWSFYTFLSQFPYAIDFL-----DFWIDLMAHVRLCRDYVRGVKESIEARNSELIADD 82
           ++  S YT L    + I +L     +++ D + H +   +Y R ++E +E R +E+IAD+
Sbjct: 751 IECQSKYTTLQCCGFVIRYLMNINMNYFGDFI-HFKTTEEYTRELQEKLETREAEVIADN 809

Query: 83  AHSDESN 89
             SDES+
Sbjct: 810 V-SDESS 815

>NDAI0E03720 Chr5 complement(803907..805655) [1749 bp, 582 aa] {ON}
           Anc_7.36
          Length = 582

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 37/81 (45%), Gaps = 17/81 (20%)

Query: 162 KDKQPKMTRKQLINNASQICR------QYLLSPQESPRYLINVPDEIRMKALHAVQSERR 215
           K   P + +K++ N+ S I          L++ + S  + IN PD  + K          
Sbjct: 78  KAHNPNLMKKEMTNHQSSINEYSKDILNKLITFEYSTDFKINKPDLSKFK---------- 127

Query: 216 FDPELFEDLRNLSYDFLEMDC 236
             PE+ E +RNL +DFL M C
Sbjct: 128 LQPEINESMRNLIFDFL-MCC 147

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.140    0.434 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,080,729
Number of extensions: 1774366
Number of successful extensions: 6984
Number of sequences better than 10.0: 49
Number of HSP's gapped: 7135
Number of HSP's successfully gapped: 53
Length of query: 426
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 314
Effective length of database: 40,638,807
Effective search space: 12760585398
Effective search space used: 12760585398
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 67 (30.4 bits)