Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F12210g8.773ON45345323600.0
TDEL0B033608.773ON43643416460.0
YMR238W (DFG5)8.773ON45845316450.0
NCAS0C008108.773ON45145616240.0
NDAI0K008408.773ON45944516080.0
Skud_13.4078.773ON45843516030.0
Suva_13.4228.773ON45845216010.0
Smik_13.4468.773ON45843516000.0
CAGL0M05049g8.773ON45345415900.0
SAKL0B05412g8.773ON45145115750.0
KLLA0F24926g8.773ON45144515660.0
Kpol_1030.208.773ON45145315340.0
TBLA0B033208.773ON45045315330.0
KNAG0J007008.773ON46342715320.0
KAFR0B034908.773ON45145315300.0
TPHA0J016008.773ON46146414970.0
Kwal_55.202668.773ON45744714850.0
KLTH0E04048g8.773ON45444414810.0
AFR530W8.773ON45943713970.0
Ecym_14748.773ON45445213780.0
NCAS0A08740singletonON43439913510.0
ACL201WsingletonON44845113021e-177
ACL200WsingletonON46345313011e-177
TBLA0C03850singletonON56741812741e-171
SAKL0D13574g2.570ON45145112541e-170
NCAS0A08730singletonON63138912671e-169
ACL202WsingletonON45040612461e-169
KLTH0D08008g2.570ON44843512311e-167
Kwal_26.82252.570ON44944412241e-166
NCAS0A127502.570ON44745112221e-165
TPHA0I024702.570ON45245311991e-162
YKL046C (DCW1)2.570ON44945511961e-161
KLLA0E07723g2.570ON45045611931e-161
Smik_11.2022.570ON44945511921e-161
KAFR0I017402.570ON44845411901e-160
Suva_11.1802.570ON45043511891e-160
NDAI0C006802.570ON45245811811e-159
Skud_11.1832.570ON44945511801e-159
KAFR0A021702.570ON44942711681e-157
CAGL0L01727g2.570ON44641811601e-156
NCAS0H029002.570ON45345811551e-155
NDAI0B015102.570ON44745111531e-155
TDEL0B065802.570ON44745311521e-155
TBLA0H02590singletonON45045411491e-154
TBLA0H02580singletonON44943911411e-153
Kpol_1056.42.570ON45043611381e-153
KNAG0A071802.570ON46340511281e-151
ABR060W2.570ON45143610961e-146
Ecym_45772.570ON45045210851e-144
ZYRO0E06380g2.570ON45343710751e-143
TBLA0H026002.570ON44945110621e-141
Suva_10.2068.308ON862153800.38
AGL182C8.308ON803177790.43
SAKL0F14058g7.460ON1144197761.2
TPHA0C009208.308ON82292741.9
Skud_12.1878.308ON861153732.2
Skud_4.6315.425ON458109704.2
Suva_10.865.232ON16844684.4
Smik_12.1818.308ON86096705.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F12210g
         (453 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F12210g Chr6 (992529..993890) [1362 bp, 453 aa] {ON} simila...   913   0.0  
TDEL0B03360 Chr2 complement(601081..602391) [1311 bp, 436 aa] {O...   638   0.0  
YMR238W Chr13 (746353..747729) [1377 bp, 458 aa] {ON}  DFG5Putat...   638   0.0  
NCAS0C00810 Chr3 complement(144534..145889) [1356 bp, 451 aa] {O...   630   0.0  
NDAI0K00840 Chr11 complement(190148..191527) [1380 bp, 459 aa] {...   624   0.0  
Skud_13.407 Chr13 (720539..721915) [1377 bp, 458 aa] {ON} YMR238...   622   0.0  
Suva_13.422 Chr13 (727776..729152) [1377 bp, 458 aa] {ON} YMR238...   621   0.0  
Smik_13.446 Chr13 (730295..731671) [1377 bp, 458 aa] {ON} YMR238...   620   0.0  
CAGL0M05049g Chr13 (547489..548850) [1362 bp, 453 aa] {ON} simil...   617   0.0  
SAKL0B05412g Chr2 (466158..467513) [1356 bp, 451 aa] {ON} highly...   611   0.0  
KLLA0F24926g Chr6 complement(2321928..2323283) [1356 bp, 451 aa]...   607   0.0  
Kpol_1030.20 s1030 complement(37060..38049,38052..38417) [1356 b...   595   0.0  
TBLA0B03320 Chr2 complement(774913..776265) [1353 bp, 450 aa] {O...   595   0.0  
KNAG0J00700 Chr10 complement(121298..122689) [1392 bp, 463 aa] {...   594   0.0  
KAFR0B03490 Chr2 (723671..725026) [1356 bp, 451 aa] {ON} Anc_8.7...   593   0.0  
TPHA0J01600 Chr10 complement(371534..372919) [1386 bp, 461 aa] {...   581   0.0  
Kwal_55.20266 s55 complement(327537..328910) [1374 bp, 457 aa] {...   576   0.0  
KLTH0E04048g Chr5 complement(369100..370464) [1365 bp, 454 aa] {...   575   0.0  
AFR530W Chr6 (1388049..1389428) [1380 bp, 459 aa] {ON} Syntenic ...   542   0.0  
Ecym_1474 Chr1 (976393..977757) [1365 bp, 454 aa] {ON} similar t...   535   0.0  
NCAS0A08740 Chr1 (1727048..1728352) [1305 bp, 434 aa] {ON}            525   0.0  
ACL201W Chr3 (10277..11623) [1347 bp, 448 aa] {ON} Non-syntenic ...   506   e-177
ACL200W Chr3 (12145..13536) [1392 bp, 463 aa] {ON} Non-syntenic ...   505   e-177
TBLA0C03850 Chr3 (921692..923395) [1704 bp, 567 aa] {ON}              495   e-171
SAKL0D13574g Chr4 (1125011..1126366) [1356 bp, 451 aa] {ON} high...   487   e-170
NCAS0A08730 Chr1 (1724401..1726296) [1896 bp, 631 aa] {ON}            492   e-169
ACL202W Chr3 (8390..9742) [1353 bp, 450 aa] {ON} Non-syntenic ho...   484   e-169
KLTH0D08008g Chr4 (680735..682081) [1347 bp, 448 aa] {ON} highly...   478   e-167
Kwal_26.8225 s26 (696173..697522) [1350 bp, 449 aa] {ON} YKL046C...   476   e-166
NCAS0A12750 Chr1 (2516616..2517959) [1344 bp, 447 aa] {ON} Anc_2...   475   e-165
TPHA0I02470 Chr9 (550108..551466) [1359 bp, 452 aa] {ON} Anc_2.5...   466   e-162
YKL046C Chr11 complement(351275..352624) [1350 bp, 449 aa] {ON} ...   465   e-161
KLLA0E07723g Chr5 complement(691980..693332) [1353 bp, 450 aa] {...   464   e-161
Smik_11.202 Chr11 complement(337711..339060) [1350 bp, 449 aa] {...   463   e-161
KAFR0I01740 Chr9 complement(352631..353977) [1347 bp, 448 aa] {O...   462   e-160
Suva_11.180 Chr11 complement(334319..335671) [1353 bp, 450 aa] {...   462   e-160
NDAI0C00680 Chr3 complement(132980..134338) [1359 bp, 452 aa] {O...   459   e-159
Skud_11.183 Chr11 complement(330975..332324) [1350 bp, 449 aa] {...   459   e-159
KAFR0A02170 Chr1 (454336..455685) [1350 bp, 449 aa] {ON} Anc_2.5...   454   e-157
CAGL0L01727g Chr12 complement(184249..185589) [1341 bp, 446 aa] ...   451   e-156
NCAS0H02900 Chr8 (566940..568301) [1362 bp, 453 aa] {ON} Anc_2.570    449   e-155
NDAI0B01510 Chr2 complement(354643..355986) [1344 bp, 447 aa] {O...   448   e-155
TDEL0B06580 Chr2 (1164804..1166147) [1344 bp, 447 aa] {ON} Anc_2...   448   e-155
TBLA0H02590 Chr8 complement(612543..613895) [1353 bp, 450 aa] {O...   447   e-154
TBLA0H02580 Chr8 complement(610287..611636) [1350 bp, 449 aa] {O...   444   e-153
Kpol_1056.4 s1056 complement(6537..7889) [1353 bp, 450 aa] {ON} ...   442   e-153
KNAG0A07180 Chr1 (1127961..1129352) [1392 bp, 463 aa] {ON}            439   e-151
ABR060W Chr2 (504045..505400) [1356 bp, 451 aa] {ON} Syntenic ho...   426   e-146
Ecym_4577 Chr4 complement(1128622..1129974) [1353 bp, 450 aa] {O...   422   e-144
ZYRO0E06380g Chr5 (484736..486097) [1362 bp, 453 aa] {ON} simila...   418   e-143
TBLA0H02600 Chr8 complement(614887..616236) [1350 bp, 449 aa] {O...   413   e-141
Suva_10.206 Chr10 (385842..388430) [2589 bp, 862 aa] {ON} YLR115...    35   0.38 
AGL182C Chr7 complement(354640..357051) [2412 bp, 803 aa] {ON} S...    35   0.43 
SAKL0F14058g Chr6 (1117019..1120453) [3435 bp, 1144 aa] {ON} sim...    34   1.2  
TPHA0C00920 Chr3 complement(192829..195297) [2469 bp, 822 aa] {O...    33   1.9  
Skud_12.187 Chr12 (360900..363485) [2586 bp, 861 aa] {ON} YLR115...    33   2.2  
Skud_4.631 Chr4 (1128086..1129462) [1377 bp, 458 aa] {ON} YDR363...    32   4.2  
Suva_10.86 Chr10 complement(171011..171517) [507 bp, 168 aa] {ON...    31   4.4  
Smik_12.181 Chr12 (359296..361878) [2583 bp, 860 aa] {ON} YLR115...    32   5.0  

>ZYRO0F12210g Chr6 (992529..993890) [1362 bp, 453 aa] {ON} similar
           to uniprot|Q05031 Saccharomyces cerevisiae YMR238W DFG5
           Mannosidase essential glycosylphosphatidylinositol
           (GPI)-anchored membrane protein required for cell wall
           biogenesis involved in filamentous growth homologous to
           Dcw1p
          Length = 453

 Score =  913 bits (2360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/453 (97%), Positives = 441/453 (97%)

Query: 1   MLLHNILVWLVFSLSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPP 60
           MLLHNILVWLVFSLSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPP
Sbjct: 1   MLLHNILVWLVFSLSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPP 60

Query: 61  YYWWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVW 120
           YYWWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVW
Sbjct: 61  YYWWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVW 120

Query: 121 GLTVMEAVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYK 180
           GLTVMEAVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYK
Sbjct: 121 GLTVMEAVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYK 180

Query: 181 NTISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCT 240
           NTISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCT
Sbjct: 181 NTISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCT 240

Query: 241 QVTELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHG 300
           QVTELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHG
Sbjct: 241 QVTELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHG 300

Query: 301 DSSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGL 360
           DSSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGL
Sbjct: 301 DSSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGL 360

Query: 361 NWFKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQ 420
           NWFKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQ
Sbjct: 361 NWFKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQ 420

Query: 421 KKLKIQSKDRAGAAIITXXXXXXXXXXXXWMLF 453
           KKLKIQSKDRAGAAIIT            WMLF
Sbjct: 421 KKLKIQSKDRAGAAIITGVVLMVVVGGSVWMLF 453

>TDEL0B03360 Chr2 complement(601081..602391) [1311 bp, 436 aa] {ON}
           Anc_8.773 YMR238W
          Length = 436

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/434 (70%), Positives = 348/434 (80%)

Query: 20  VDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYYWWQAGEAFGGMIDNWHF 79
           +DL    KDS+C ATALIQ+GMLDYY G + GG +GMFQ PYYWWQAGEAFGGMIDNW+F
Sbjct: 3   LDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWYF 62

Query: 80  CKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGLTVMEAVERNFTDPGDGK 139
           C+N TFE LI + ML Q GPHYDYMP+NQTMVEGNDDQGVWGLT+M AVERNFT+P +G 
Sbjct: 63  CENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNGA 122

Query: 140 PGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKNTISNGCYFQLAARLGRYT 199
           PGWLAMAQA+FN++N RWD  +C GG+RWQIFTWN GYNYKNTISN C FQ+AARLGRYT
Sbjct: 123 PGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRYT 182

Query: 200 NNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQVTELEWTYNHGIILGGSA 259
            N TYLEVAE VFDWL DVG+VVLKD GNVFDGA  D+NCT + +LEW+YNHG++LGG A
Sbjct: 183 GNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGLA 242

Query: 260 YMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGDSSNCNNDQRSFKSIFSRM 319
           +MYNATNGSS+WE RV QIL GA  YFF+D++MYES CQ   +S CN+DQRSFK+IFSRM
Sbjct: 243 FMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSRM 302

Query: 320 LGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLNWFKGSWDNQYGLGEQMSA 379
           LGLTSVLVPS   KVD LL  SA  AA SCSGG DGHTCGLNW K + D  YGLGEQMSA
Sbjct: 303 LGLTSVLVPSTQSKVDDLLKQSALAAAASCSGGTDGHTCGLNWNKQANDGYYGLGEQMSA 362

Query: 380 LEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQKKLKIQSKDRAGAAIITXX 439
           LEV+Q  LIH    P+ E TGGSS GD+ AGLNT++ NVLQ +L IQ+KDRAGAAIIT  
Sbjct: 363 LEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIITAV 422

Query: 440 XXXXXXXXXXWMLF 453
                     WMLF
Sbjct: 423 ILMVLVGGSIWMLF 436

>YMR238W Chr13 (746353..747729) [1377 bp, 458 aa] {ON}  DFG5Putative
           mannosidase, essential glycosylphosphatidylinositol
           (GPI)-anchored membrane protein required for cell wall
           biogenesis in bud formation, involved in filamentous
           growth, homologous to Dcw1p
          Length = 458

 Score =  638 bits (1645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/453 (65%), Positives = 349/453 (77%), Gaps = 3/453 (0%)

Query: 1   MLLHNILVWLVFSLSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPP 60
           M+L     +L F      A+DL    K S+C ATALIQ GMLDYY G +YGG +GMFQ P
Sbjct: 9   MILSICFTFLSF-FKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSP 67

Query: 61  YYWWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVW 120
           YYWW AGEAFGGM++NW  C+N+T++EL+ +A+L Q G +YDY+P NQTMVEGNDDQG+W
Sbjct: 68  YYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIW 127

Query: 121 GLTVMEAVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYK 180
           G+TVM AVERNFTDPGDGKPGWLAM QAVFN +  RWD + C GG+RWQIFTWNSGYNYK
Sbjct: 128 GITVMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYK 187

Query: 181 NTISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCT 240
           NT+SN C FQ+AARLGRYT N TYLEVAE+VFDWL DVG+VVL D  NVFDGA  D NCT
Sbjct: 188 NTVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCT 247

Query: 241 QVTELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHG 300
            +T++EWTYNHGI+LGG AYMYNATNG+ +WE  + +ILNGA  YFF+D++MYES CQ  
Sbjct: 248 DITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQ-- 305

Query: 301 DSSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGL 360
           D   CN DQR+FKSIFSRMLGLTSV+ P   D +D L+  SAE AAKSC+GG DGHTCGL
Sbjct: 306 DYGTCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGL 365

Query: 361 NWFKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQ 420
           NW K + D  YGLGEQMSALEVIQN LIH+   PY+E  GG+SKGD+ AG+N++TTNVLQ
Sbjct: 366 NWQKQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQ 425

Query: 421 KKLKIQSKDRAGAAIITXXXXXXXXXXXXWMLF 453
             L I+  DRAGAAIIT            WMLF
Sbjct: 426 NNLNIKKGDRAGAAIITAVILSVLTGGAVWMLF 458

>NCAS0C00810 Chr3 complement(144534..145889) [1356 bp, 451 aa] {ON}
           Anc_8.773
          Length = 451

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/456 (65%), Positives = 357/456 (78%), Gaps = 9/456 (1%)

Query: 2   LLHNILVWLVFSLSP---IWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQ 58
           +LH   VW+ F L     + ++DL V  KDS+C+ATALIQ+GMLDYY G++YGGA+GMFQ
Sbjct: 1   MLH---VWISFVLLLPLLVQSIDLDVTSKDSICAATALIQKGMLDYYEGERYGGAVGMFQ 57

Query: 59  PPYYWWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQG 118
           PPYYWW  G AFGGM++N + C+NNTFE L+ +A++ Q G +YDY+P NQ+MVEGNDDQG
Sbjct: 58  PPYYWWNGGVAFGGMLENMYLCENNTFESLLMDALVAQTGDNYDYIPSNQSMVEGNDDQG 117

Query: 119 VWGLTVMEAVERNFTDPG-DGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGY 177
           VWGLT+M+AVERNFT P   G PGWLAMAQAVFN +  RWD   C GG+RWQIFTWNSGY
Sbjct: 118 VWGLTIMDAVERNFTAPNKSGVPGWLAMAQAVFNTMYARWDPDHCGGGLRWQIFTWNSGY 177

Query: 178 NYKNTISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDD 237
           NYKNTI+N C FQ+AARLGRYT NQTYL+VAEKVFDW+ D+ ++VL DK NVFDGA  D+
Sbjct: 178 NYKNTIANACLFQMAARLGRYTGNQTYLDVAEKVFDWMVDINYIVLNDKANVFDGADIDE 237

Query: 238 NCTQVTELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGC 297
           NCT +T LEWTYNHG++LGG AYMYNATNGSS WE RVN+IL GA +YFFQDNVM ES C
Sbjct: 238 NCTDITTLEWTYNHGVVLGGCAYMYNATNGSSTWETRVNKILAGAQEYFFQDNVMLESAC 297

Query: 298 QHGDSSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHT 357
           Q  ++  CNNDQR FKSIFSRMLG TSVL P  ++ +D L+ ASAE AA SC+GG DGHT
Sbjct: 298 QSYNT--CNNDQRCFKSIFSRMLGFTSVLAPFTAETIDPLIKASAEAAATSCTGGKDGHT 355

Query: 358 CGLNWFKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTN 417
           CGL+W KGS D  YGLGEQM+ALE++ N LIH+   P   +TGG+S+GD++AGLN+TTTN
Sbjct: 356 CGLDWTKGSNDGYYGLGEQMNALEIMSNLLIHDRPAPLTANTGGTSEGDASAGLNSTTTN 415

Query: 418 VLQKKLKIQSKDRAGAAIITXXXXXXXXXXXXWMLF 453
           VL+ KLKI   DRAGAAI+T            WMLF
Sbjct: 416 VLENKLKITQGDRAGAAIVTAVILGIFVGGAVWMLF 451

>NDAI0K00840 Chr11 complement(190148..191527) [1380 bp, 459 aa] {ON}
           Anc_8.773
          Length = 459

 Score =  624 bits (1608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/445 (66%), Positives = 349/445 (78%), Gaps = 3/445 (0%)

Query: 10  LVFSLSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYYWWQAGEA 69
           L+ ++    A+DL +  K+S+C AT+LIQ GM+DYY G +YGG +GMFQPPYYWW+AGEA
Sbjct: 17  LLLTVHNTQAIDLDITSKESICDATSLIQGGMMDYYWGTQYGGTVGMFQPPYYWWEAGEA 76

Query: 70  FGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGLTVMEAVE 129
           FGGMI+NW+ C+N+T+E++++ A+L Q G +YDY+P NQ+MVEGNDDQGVWGLT+M A E
Sbjct: 77  FGGMIENWYLCQNDTYEDMLKSALLAQTGSNYDYIPANQSMVEGNDDQGVWGLTLMGAAE 136

Query: 130 RNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKNTISNGCYF 189
           RNFTDP DG PGWLAM QAVFN +N RWD   C GG+RWQIFTWNSGYNYKNTISN C F
Sbjct: 137 RNFTDPDDGTPGWLAMTQAVFNTMNARWDSAHCGGGLRWQIFTWNSGYNYKNTISNACLF 196

Query: 190 QLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQVTELEWTY 249
           QLAARLGRYT N TYLEVAEKVF WL DVG+V+L D  NVFDGA  D NCT +T++EWTY
Sbjct: 197 QLAARLGRYTGNTTYLEVAEKVFTWLVDVGYVLLDDTANVFDGAEIDSNCTDMTQIEWTY 256

Query: 250 NHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDN-VMYESGCQHGDSSNCNND 308
           NHG++LGG+AYMYNATNGSS WE RV ++L GA+ YFF  N +M+E+ CQ  + + CNND
Sbjct: 257 NHGVVLGGAAYMYNATNGSSDWESRVTKLLKGATTYFFDSNGIMFENACQ--EYNTCNND 314

Query: 309 QRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLNWFKGSWD 368
           QRSFKSIFSRMLGLTSVL P  SD VD L+  SA  AAKSC+GG DGHTCGLNW KGS D
Sbjct: 315 QRSFKSIFSRMLGLTSVLAPFTSDTVDPLIKTSAAAAAKSCTGGTDGHTCGLNWAKGSHD 374

Query: 369 NQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQKKLKIQSK 428
             YGLGEQM ALEV+QN LIH+   P   +TGGSSKGD+ AGLN+TTTNVL+ K+ I + 
Sbjct: 375 GYYGLGEQMCALEVMQNLLIHDRPAPLTGNTGGSSKGDALAGLNSTTTNVLENKMTITNG 434

Query: 429 DRAGAAIITXXXXXXXXXXXXWMLF 453
           DRAGAAI+T            WM F
Sbjct: 435 DRAGAAIVTAIILGVLTGGAVWMFF 459

>Skud_13.407 Chr13 (720539..721915) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/435 (68%), Positives = 344/435 (79%), Gaps = 2/435 (0%)

Query: 19  AVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYYWWQAGEAFGGMIDNWH 78
           A+DL    K S+C ATALIQ GMLDYY G +YGGA+GMFQ PYYWW AGEAFGGM++NW 
Sbjct: 26  AMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPYYWWHAGEAFGGMLENWF 85

Query: 79  FCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGLTVMEAVERNFTDPGDG 138
            C+N T++EL+ +A+L Q G +YDY+P NQTMVEGNDDQG+WG+TVM AVERNFTDP +G
Sbjct: 86  LCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTDPDEG 145

Query: 139 KPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKNTISNGCYFQLAARLGRY 198
           KPGWLAM QAVFN +  RWD + C GG+RWQIFTWNSGYNYKNT+SN C FQ+AARLGRY
Sbjct: 146 KPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARLGRY 205

Query: 199 TNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQVTELEWTYNHGIILGGS 258
           T N TYL+VAE+VFDWL DVG+VVL D  NVFDGA  D NCT +T++EWTYNHGI+LGG 
Sbjct: 206 TGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHGIVLGGL 265

Query: 259 AYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGDSSNCNNDQRSFKSIFSR 318
           AYMYNATNG+S+WE R+ QILNGA  YFF+D +MYES CQ  D S CN DQR+FKSIFSR
Sbjct: 266 AYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQ--DYSTCNTDQRTFKSIFSR 323

Query: 319 MLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLNWFKGSWDNQYGLGEQMS 378
           MLGLTSV+ P  SD +D L+  SAE AAKSC+GG DGHTCGL+W K + D  YGLGEQMS
Sbjct: 324 MLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDWGKQTHDGYYGLGEQMS 383

Query: 379 ALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQKKLKIQSKDRAGAAIITX 438
           ALEVIQN LIH+   PY+ES GG+SKGD+ AG+N++TTNVLQ  L I    RAGAAIIT 
Sbjct: 384 ALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNITKGGRAGAAIITA 443

Query: 439 XXXXXXXXXXXWMLF 453
                      WMLF
Sbjct: 444 IILSVLIGGAVWMLF 458

>Suva_13.422 Chr13 (727776..729152) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  621 bits (1601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/452 (64%), Positives = 347/452 (76%), Gaps = 6/452 (1%)

Query: 6   ILVWLVFSLSPIW----AVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPY 61
           I + L F+L   +    A+DL      S+C ATALIQ GMLDYY G +YGG +GMFQ PY
Sbjct: 9   IALPLCFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPY 68

Query: 62  YWWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWG 121
           YWW AGEAFGGM++NW+ C+N+T++ L+ +A+L Q G  YDY+P NQTMVEGNDDQG+WG
Sbjct: 69  YWWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWG 128

Query: 122 LTVMEAVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKN 181
           +TVM AVERNFT+P +G PGWLAM QAVFN +  RWD ++C GG+RWQIFTWNSGYNYKN
Sbjct: 129 ITVMGAVERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKN 188

Query: 182 TISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQ 241
           TISN C FQ+AARLGRYT N TYL+VAE+VFDWL DVG+VVL D  NV+DGA  D NCT 
Sbjct: 189 TISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDTNCTD 248

Query: 242 VTELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGD 301
           +T++EWTYNHGI+LGG AYMYNATNG+S+W+  + Q+LNGA+ YFF+D +MYES CQ  D
Sbjct: 249 ITKIEWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQ--D 306

Query: 302 SSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLN 361
              CN DQR+FKSIFSRMLGLTSV+ P  SD +D L+  SAE AAKSC GG DGHTCGL+
Sbjct: 307 YGTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLD 366

Query: 362 WFKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQK 421
           W K + D  YGLGEQMSALEVIQN LIH+   PY+E  GG+SKGD+ AG+N++TT+VLQ 
Sbjct: 367 WEKETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQN 426

Query: 422 KLKIQSKDRAGAAIITXXXXXXXXXXXXWMLF 453
            L I   DRAGAAIIT            WMLF
Sbjct: 427 NLNITKGDRAGAAIITAVILSVLIGGAVWMLF 458

>Smik_13.446 Chr13 (730295..731671) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/435 (68%), Positives = 347/435 (79%), Gaps = 2/435 (0%)

Query: 19  AVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYYWWQAGEAFGGMIDNWH 78
           A++L    K S+C ATALIQ GMLDYY G +YGGA+GMFQ PYYWW AGEAFGGM++NW 
Sbjct: 26  AMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPYYWWHAGEAFGGMLENWF 85

Query: 79  FCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGLTVMEAVERNFTDPGDG 138
            C+N+T++EL+ +A+L Q G +YDY+P NQTMVEGNDDQG+WG+TVM AVERNFTDP DG
Sbjct: 86  LCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTDPSDG 145

Query: 139 KPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKNTISNGCYFQLAARLGRY 198
           KPGWLAM QAVFN +  RWD + C GG+RWQIFTWNSGYNYKNTISN C FQ+AARLGRY
Sbjct: 146 KPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGRY 205

Query: 199 TNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQVTELEWTYNHGIILGGS 258
           T N TYL+VAE+VFDWL DVG+VVL D  NVFDGA  D NCT +T++EWTYNHGI+LGG 
Sbjct: 206 TGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHGIVLGGL 265

Query: 259 AYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGDSSNCNNDQRSFKSIFSR 318
           AYMYNATNG+S+WE  + +ILNGA  YFF+D++MYES CQ  D S CN DQR+FKSIFSR
Sbjct: 266 AYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQ--DYSTCNTDQRTFKSIFSR 323

Query: 319 MLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLNWFKGSWDNQYGLGEQMS 378
           MLGLTSV+ P  SD +D L+  SAE AAKSC GG DGHTCGLNW K + D  YGLGEQM+
Sbjct: 324 MLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNWGKQTNDGYYGLGEQMN 383

Query: 379 ALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQKKLKIQSKDRAGAAIITX 438
           ALEVIQN LIH+   PY+ES GG+SKGD+ AG+N++TTNVLQ  L I++ DRAGAAIIT 
Sbjct: 384 ALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNIKNGDRAGAAIITA 443

Query: 439 XXXXXXXXXXXWMLF 453
                      WMLF
Sbjct: 444 IILSVLIGGAVWMLF 458

>CAGL0M05049g Chr13 (547489..548850) [1362 bp, 453 aa] {ON} similar
           to uniprot|P36091 Saccharomyces cerevisiae YKL046c or
           uniprot|Q05031 Saccharomyces cerevisiae YMR238w DFG5
          Length = 453

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/454 (64%), Positives = 352/454 (77%), Gaps = 5/454 (1%)

Query: 2   LLHNILVW-LVFSLSP-IWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQP 59
           LL ++ +W L+ +L P   A++LQ  +KDS+C+ATALIQ GMLDYY G +YGG +GMFQP
Sbjct: 3   LLFSLQLWVLIGTLFPDAGAINLQ-DNKDSICAATALIQGGMLDYYEGTRYGGTVGMFQP 61

Query: 60  PYYWWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGV 119
           PYYWWQAG AFGGM++NW  C+N+T+++L+  A++ Q GP+YDY+P NQT VEGNDDQGV
Sbjct: 62  PYYWWQAGVAFGGMLENWFLCQNDTYKDLLMNALVAQTGPNYDYIPANQTTVEGNDDQGV 121

Query: 120 WGLTVMEAVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNY 179
           WGLT+++AVERNF+ P DGKPGWLAM+Q +FN +  RWD +SC GG+RWQIFTWNSGYNY
Sbjct: 122 WGLTILDAVERNFSAPIDGKPGWLAMSQGIFNTMYARWDMQSCNGGLRWQIFTWNSGYNY 181

Query: 180 KNTISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNC 239
           KNTISN C FQ+AARLGRYT N TYL+VAE+VFDWL  VG++VL +KGNV+DGA  +DNC
Sbjct: 182 KNTISNACLFQIAARLGRYTGNTTYLDVAERVFDWLVGVGYIVLSEKGNVYDGAKVEDNC 241

Query: 240 TQVTELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQH 299
           T +T +EWTYNHG++LGG AYMYNATNGSS W+ R+  +L GA+ YFFQD++MYES CQ 
Sbjct: 242 TDITAIEWTYNHGVVLGGLAYMYNATNGSSVWQSRLTSVLGGATAYFFQDDIMYESACQ- 300

Query: 300 GDSSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCG 359
                CNNDQR FKSIFSRMLG TSVL P  SD +D LL ASA  AA SC GG DGHTCG
Sbjct: 301 -PYKTCNNDQRCFKSIFSRMLGFTSVLAPFTSDTIDPLLKASAMAAAGSCDGGTDGHTCG 359

Query: 360 LNWFKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVL 419
           L+W   + D  YGLGEQMSALEVIQ  LIH    PYR   GG+S GD+AAGLN+TTTNVL
Sbjct: 360 LDWQLKTNDGYYGLGEQMSALEVIQQLLIHERPAPYRADNGGTSVGDAAAGLNSTTTNVL 419

Query: 420 QKKLKIQSKDRAGAAIITXXXXXXXXXXXXWMLF 453
           +  LKI   DRAGAAI+T            WM+F
Sbjct: 420 KNNLKITGGDRAGAAIVTTIVLGIIIGGAAWMMF 453

>SAKL0B05412g Chr2 (466158..467513) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 451

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/451 (63%), Positives = 351/451 (77%), Gaps = 4/451 (0%)

Query: 5   NILVWLVF-SLSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYYW 63
           ++L+ L++ SL+ + A+DL    KDS+C AT+LIQ+GMLDYY G KYGG +GMFQPPYYW
Sbjct: 3   SLLISLIYMSLNIVHAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYW 62

Query: 64  WQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGLT 123
           WQAGEAFGGM+DN + C N T+++LI +AM+ Q G +YDY+P NQ+MVEGNDDQGVWG+T
Sbjct: 63  WQAGEAFGGMLDNIYLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGIT 122

Query: 124 VMEAVERNFTDP-GDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKNT 182
           +M AVERNFT+P  +G PGWLAM QAVFN +  RWD + C GG+RWQIFTWNSGYNYKNT
Sbjct: 123 IMGAVERNFTNPTKEGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNT 182

Query: 183 ISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQV 242
           I+NGC FQ+AARLGRYT N TYLEVA KV+DWL DVGFVVL+DK NVFDGA  ++NC+ +
Sbjct: 183 IANGCLFQIAARLGRYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSI 242

Query: 243 TELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGDS 302
            ++EWTYNHG++LGG+AYMYNATNGS  W+ R+ Q+L+GA ++FF +++MYE  CQ   S
Sbjct: 243 VKIEWTYNHGVVLGGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQ--GS 300

Query: 303 SNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLNW 362
             CNNDQRSFKSIFSRMLGLTSVL P   D +D L+ ASAEGAA+SC+GG DGHTCGL+W
Sbjct: 301 GTCNNDQRSFKSIFSRMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDW 360

Query: 363 FKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQKK 422
             G  D  YGLGEQMSALE++QN LI +   P+    GGSS GD  AGLN+++ NVL+  
Sbjct: 361 TLGHHDGYYGLGEQMSALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENN 420

Query: 423 LKIQSKDRAGAAIITXXXXXXXXXXXXWMLF 453
           L I  KDR GAAIIT            WM+F
Sbjct: 421 LSITHKDRVGAAIITAIVLGVMIGGSVWMVF 451

>KLLA0F24926g Chr6 complement(2321928..2323283) [1356 bp, 451 aa]
           {ON} similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 451

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/445 (63%), Positives = 337/445 (75%), Gaps = 3/445 (0%)

Query: 10  LVFSLSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYYWWQAGEA 69
           L  ++  + A+DL    K S+C+ATALIQQG+ DYY GD YGG +GMF  PYYWW+AG  
Sbjct: 9   LFLTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWWEAGLV 68

Query: 70  FGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGLTVMEAVE 129
           FGGMI+NW+ C+N ++E+++ +A++ Q G  YDYMP NQTMVEGNDDQGVW LTVM AVE
Sbjct: 69  FGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTVMTAVE 128

Query: 130 RNFTDPG-DGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKNTISNGCY 188
           RNFT+P  DG PGWLAM QAVFN++  RWD   C GG+RWQIFTWNSGYNYKNTISNGC 
Sbjct: 129 RNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTISNGCL 188

Query: 189 FQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQVTELEWT 248
           FQLAARLGRYT N TYLEVAEKVFDWL D+ FVV+K++ NVFDGA  DDNCT + + EW+
Sbjct: 189 FQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCTSIVKYEWS 248

Query: 249 YNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGDSSNCNND 308
           YNHG++LGG AYMYNATNGS  W+ R  QIL GA+ +FF+D++MYES CQ   S+ CN D
Sbjct: 249 YNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQA--SNKCNTD 306

Query: 309 QRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLNWFKGSWD 368
           QR FK+IFSRMLG TSVL P  +D +  L++ SA  AAKSCSGG DGHTCGLNWF G WD
Sbjct: 307 QRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSAAAAAKSCSGGTDGHTCGLNWFTGDWD 366

Query: 369 NQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQKKLKIQSK 428
            QYGLGEQ  ALE+I   L+H+   P  ESTGGSS GD++AGLN +TTNVLQK + I + 
Sbjct: 367 GQYGLGEQACALEIINQLLVHDLPAPLTESTGGSSSGDASAGLNVSTTNVLQKNINITAG 426

Query: 429 DRAGAAIITXXXXXXXXXXXXWMLF 453
           D+AGA IIT            WM+ 
Sbjct: 427 DKAGAGIITTIVLGVLVLGTVWMVL 451

>Kpol_1030.20 s1030 complement(37060..38049,38052..38417) [1356 bp,
           451 aa] {ON} complement(37060..38049,38052..38417) [1356
           nt, 452 aa]
          Length = 451

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/453 (62%), Positives = 340/453 (75%), Gaps = 3/453 (0%)

Query: 1   MLLHNILVWLVFSLSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPP 60
           +LL  +L+     ++ + A+DL V  KDS+C+AT+LIQ GMLDYY G +YGG +GMFQPP
Sbjct: 2   VLLLTVLLQAFNFITTVTAIDLDVNSKDSICAATSLIQGGMLDYYEGTRYGGTVGMFQPP 61

Query: 61  YYWWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVW 120
           YYWW+AGEAFGGMI+NW  C+N+T+ ++I +A+L Q G +YDY+P NQT VE    + V+
Sbjct: 62  YYWWEAGEAFGGMIENWFLCQNDTYHDIIYDALLAQTGSNYDYVPANQTFVEVMMIK-VF 120

Query: 121 GLTVMEAVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYK 180
           G TVM+A ERNFT P DGKP WLAMAQAVFN +  RWD  +C GG+RWQI+TWNSGYNYK
Sbjct: 121 GGTVMDAAERNFTAPSDGKPDWLAMAQAVFNTMYARWDSANCGGGLRWQIYTWNSGYNYK 180

Query: 181 NTISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCT 240
           NT+SN C FQ+AARLGRYT N TYLEVAEKVFDWL DV FVVL D+ NVFDGA    NC+
Sbjct: 181 NTVSNACLFQIAARLGRYTGNDTYLEVAEKVFDWLVDVNFVVLNDEANVFDGANITSNCS 240

Query: 241 QVTELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHG 300
            V +LEW+YNHGI+LGG AYMYNATNG+SKWE  + ++LNGA   FF++N+MYE  CQ  
Sbjct: 241 AVVKLEWSYNHGIVLGGLAYMYNATNGTSKWESGLTKVLNGAKSIFFKNNIMYEQACQ-- 298

Query: 301 DSSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGL 360
           D + CN DQRSFKSIFSRMLGLTSVL P  SD +  L+ ASAEGAAKSC GG DGHTCGL
Sbjct: 299 DHNTCNTDQRSFKSIFSRMLGLTSVLAPYTSDTITPLIQASAEGAAKSCDGGTDGHTCGL 358

Query: 361 NWFKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQ 420
           NW  G+ D +YGLGEQM ALE++ N LI N   PY    GG+S GD +AGLN T+T+VL 
Sbjct: 359 NWNLGTNDGKYGLGEQMCALEIMSNLLILNRPAPYTMHNGGTSVGDPSAGLNATSTSVLS 418

Query: 421 KKLKIQSKDRAGAAIITXXXXXXXXXXXXWMLF 453
             L I+ KDRAGAAI+T            WMLF
Sbjct: 419 NNLDIKQKDRAGAAIVTAVILFVLLGGSVWMLF 451

>TBLA0B03320 Chr2 complement(774913..776265) [1353 bp, 450 aa] {ON}
           Anc_8.773 YMR238W
          Length = 450

 Score =  595 bits (1533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/453 (61%), Positives = 348/453 (76%), Gaps = 3/453 (0%)

Query: 1   MLLHNILVWLVFSLSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPP 60
           M+L+ +++  +  +S  +A+DL    K+S+C AT+LI +GMLDYY G +YGG +GMFQPP
Sbjct: 1   MILNELILSALSFVSFTFAMDLDTSSKESICGATSLIIKGMLDYYWGTQYGGTVGMFQPP 60

Query: 61  YYWWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVW 120
           YYWW+AGEAFGGM++NW+ C+N+T+ +L+ +A+  Q GP YDY+PQNQTMVEGNDDQ +W
Sbjct: 61  YYWWEAGEAFGGMLENWYLCQNDTYADLLFDALTAQTGPDYDYIPQNQTMVEGNDDQCIW 120

Query: 121 GLTVMEAVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYK 180
           GLTVM+AVERNFT+P +G PGWLAM QAVFN +  RWD   C GG+RWQIFTWNSGY+YK
Sbjct: 121 GLTVMDAVERNFTNPTEG-PGWLAMGQAVFNTMWSRWDAADCGGGLRWQIFTWNSGYDYK 179

Query: 181 NTISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCT 240
           NTISN C FQ+AARLGRYT N TYL+VA  VFDWLT VG+V + +   V+DGA   +NCT
Sbjct: 180 NTISNACLFQMAARLGRYTGNNTYLDVANDVFDWLTGVGYVNMDNAAEVYDGADISENCT 239

Query: 241 QVTELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHG 300
            +T+ +W+YN+G +LGG+AYMYNATNGSS WE RV Q+LNGA  YFFQD++MYES CQ  
Sbjct: 240 DITKYQWSYNNGCMLGGAAYMYNATNGSSIWETRVTQLLNGAKAYFFQDDIMYESACQT- 298

Query: 301 DSSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGL 360
            +  CNNDQRSFKS+FSRMLG TSVLVPS  D +D L+ ASA+GAA++C+GG DGHTCGL
Sbjct: 299 -AKTCNNDQRSFKSLFSRMLGFTSVLVPSTRDIIDPLILASAQGAARTCNGGTDGHTCGL 357

Query: 361 NWFKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQ 420
           NW   + D  YGLGEQMSALEVIQN LIH+   PY    GGSS+GD+ AGLN T+ NVL 
Sbjct: 358 NWQASTHDGYYGLGEQMSALEVIQNLLIHDRPAPYTSIDGGSSEGDANAGLNKTSKNVLS 417

Query: 421 KKLKIQSKDRAGAAIITXXXXXXXXXXXXWMLF 453
             L I++ D+ GAAI+T            WMLF
Sbjct: 418 NDLDIKTGDKVGAAILTAGVLAILVGGAIWMLF 450

>KNAG0J00700 Chr10 complement(121298..122689) [1392 bp, 463 aa] {ON}
           Anc_8.773 YMR238W
          Length = 463

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/427 (64%), Positives = 336/427 (78%), Gaps = 3/427 (0%)

Query: 28  DSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYYWWQAGEAFGGMIDNWHFCKNNTFEE 87
           D VCSATAL+  G+LDYY+G +YGG +GMFQPPYYWW AGEAFGGMI+NW  C+N+T+E 
Sbjct: 39  DPVCSATALVTDGLLDYYSGTRYGGTVGMFQPPYYWWHAGEAFGGMIENWFLCQNSTYET 98

Query: 88  LIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGLTVMEAVERNFTDP-GDGKPGWLAMA 146
           L+ +A + Q G +YDY+P+NQTMVEGNDDQG+WGLT+M+AVERNFT P  DG PGWLAM+
Sbjct: 99  LLMDAFIAQTGNNYDYIPENQTMVEGNDDQGIWGLTIMDAVERNFTKPTKDGVPGWLAMS 158

Query: 147 QAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKNTISNGCYFQLAARLGRYTNNQTYLE 206
           QAVFN +  RWD + C GG+RWQIFTWNSGYNYKNTISN C F LAARLGRYT N TYL+
Sbjct: 159 QAVFNTMWARWDTQHCGGGLRWQIFTWNSGYNYKNTISNACLFNLAARLGRYTGNSTYLD 218

Query: 207 VAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQVTELEWTYNHGIILGGSAYMYNATN 266
           VA++VFDW+  VG+VVL D  NVFDGA  +DNCT +T  EW+YNHG++LGG+A+MYNATN
Sbjct: 219 VADQVFDWMVSVGYVVLGDTANVFDGANIEDNCTTITTFEWSYNHGVVLGGTAFMYNATN 278

Query: 267 GSSKWEERVNQILNGASDYFFQDNVMYESGCQHGDSSNCNNDQRSFKSIFSRMLGLTSVL 326
           GSS WE+RVN+IL GA+ YFF+D++M+ES CQ  D+  CNNDQR+FK+IFSRML  T+VL
Sbjct: 279 GSSVWEDRVNRILKGATTYFFRDSIMFESACQ--DTGKCNNDQRTFKAIFSRMLSFTAVL 336

Query: 327 VPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLNWFKGSWDNQYGLGEQMSALEVIQNT 386
           VPS +  +D L+ +SA+ AA+SCSGG DGHTCGLNW    WD  YGLGEQMSALEV+   
Sbjct: 337 VPSTASTIDPLMQSSAQAAAQSCSGGTDGHTCGLNWQHSGWDGMYGLGEQMSALEVMNYL 396

Query: 387 LIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQKKLKIQSKDRAGAAIITXXXXXXXXX 446
           L+H+   PY  + GGSS GD++AGLN+T TNV    L I+ KD+AGAAI+T         
Sbjct: 397 LVHDRPAPYTAAAGGSSVGDASAGLNSTATNVFANSLNIRGKDKAGAAIVTTVILGTLAG 456

Query: 447 XXXWMLF 453
              WMLF
Sbjct: 457 GSIWMLF 463

>KAFR0B03490 Chr2 (723671..725026) [1356 bp, 451 aa] {ON} Anc_8.773
           YMR238W
          Length = 451

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/453 (62%), Positives = 339/453 (74%), Gaps = 7/453 (1%)

Query: 6   ILVWLVFSL--SPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYYW 63
           +++ L+F L  +   A+DL    K S+C ATALIQ GMLDYY G +YGG +GMFQ PYYW
Sbjct: 1   MMITLLFPLLLTVAKAIDLDTSSKTSICDATALIQDGMLDYYEGIRYGGTVGMFQSPYYW 60

Query: 64  WQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGLT 123
           W+AGEAFGGM++NW  C+N+TF+E+I +A+L Q G  YD+MP+NQTMVEGNDDQ VWGLT
Sbjct: 61  WEAGEAFGGMLENWFLCENDTFKEIIYDAILAQTGSDYDFMPENQTMVEGNDDQCVWGLT 120

Query: 124 VMEAVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKNTI 183
           +M+AVERNFTDP DG PGWL M QA+FNE+  RWD  +C GG+RWQIFTWNSGY+YK+TI
Sbjct: 121 IMDAVERNFTDPTDGSPGWLYMTQAIFNEMWSRWDSANCGGGLRWQIFTWNSGYDYKSTI 180

Query: 184 SNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFV-VLKDKGNVFDGAVTDDNCTQV 242
           SN C FQLA+RLGRYT N TYL+VAE V+DWL DVGF+ V      V+DGA   +NCT +
Sbjct: 181 SNVCLFQLASRLGRYTGNDTYLDVAESVYDWLVDVGFINVANGTAYVYDGADISENCTDI 240

Query: 243 TELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGDS 302
           T ++W+YNHGI+LGG+AY YNATNGSS WE RV  I+ GA   FF D +MYES CQ  D+
Sbjct: 241 TTIDWSYNHGILLGGAAYAYNATNGSSVWESRVTDIVEGAKSIFFSDGIMYESACQDYDT 300

Query: 303 SNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLNW 362
             CNNDQRSFKSIFSRMLG TSVL P  +  +D L+ +SA   A SC GG DGHTCGLNW
Sbjct: 301 --CNNDQRSFKSIFSRMLGFTSVLAPFTASTIDPLIKSSAAACALSCDGGTDGHTCGLNW 358

Query: 363 FKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTT--NVLQ 420
              + D  YGLGEQMSALEVIQN LIH+   PY  STGGSS GD++AGLNTTT+  +VL+
Sbjct: 359 QDKTCDGNYGLGEQMSALEVIQNLLIHDRPAPYTASTGGSSVGDASAGLNTTTSSADVLE 418

Query: 421 KKLKIQSKDRAGAAIITXXXXXXXXXXXXWMLF 453
             L I SKDRAGAAIIT            WMLF
Sbjct: 419 NNLTITSKDRAGAAIITAVILGCMAGGAIWMLF 451

>TPHA0J01600 Chr10 complement(371534..372919) [1386 bp, 461 aa] {ON}
           Anc_8.773 YMR238W
          Length = 461

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/464 (60%), Positives = 346/464 (74%), Gaps = 15/464 (3%)

Query: 2   LLHNILVWLVFSLSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPY 61
           + +  L+ L+  +    A+ L V  KDSVC ATALIQ+GMLDYY G +YGG +GMFQPPY
Sbjct: 1   MFYLTLLGLISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPY 60

Query: 62  YWWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWG 121
           YWW+AGEAFGGM++NW+ C+N+TFE LI +A++ QAG +YDY+P NQT+VEGNDDQGVWG
Sbjct: 61  YWWEAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWG 120

Query: 122 LTVMEAVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKN 181
           LTV+ AVERN  D  DG PGWLA++QAVFN +  RWD   C GG+RWQI+TWNSGYNYKN
Sbjct: 121 LTVLGAVERNLPDR-DGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKN 179

Query: 182 TISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQ 241
           TISN C FQ+AARLGRYT N TYLEVAEKVFDW+ DV ++VLKD  NV+DGA T+ NC+ 
Sbjct: 180 TISNACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSD 239

Query: 242 VTELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGD 301
           + + EW+YNHG++LGG AYMYNATNG+SKWE  + Q+L+GA+ YFF++N+MYES CQ  +
Sbjct: 240 IVQYEWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQ--E 297

Query: 302 SSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLN 361
           +  CN DQRSFKSIFSRMLG T VL P  +  +D L+  SA+ AA SC GG DG TCGL+
Sbjct: 298 AKTCNTDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLS 357

Query: 362 WFKGSWDNQYGLGEQMSALEVIQNTLI------------HNSDPPYRESTGGSSKGDSAA 409
           WF  + D  YGLGEQMSALE+I   L+             ++  PY  S+GG+S GD++A
Sbjct: 358 WFDSTNDGYYGLGEQMSALEIINQLLVSSSGAAAEAASSGSASSPYTSSSGGNSTGDASA 417

Query: 410 GLNTTTTNVLQKKLKIQSKDRAGAAIITXXXXXXXXXXXXWMLF 453
           GLNTT+TNVLQ  L I+SKD+AGAA+ T            WMLF
Sbjct: 418 GLNTTSTNVLQNNLDIESKDKAGAAVATAVILAVLVGGSVWMLF 461

>Kwal_55.20266 s55 complement(327537..328910) [1374 bp, 457 aa] {ON}
           YMR238W (DFG5) - involved in pseudohyphal growth [contig
           152] FULL
          Length = 457

 Score =  576 bits (1485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/447 (61%), Positives = 334/447 (74%), Gaps = 7/447 (1%)

Query: 11  VFSLSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYYWWQAGEAF 70
           VF+ S + A+DL    KDS+C AT+LIQ+G++DYY G+++GG +GMFQ PYYWW+AGE F
Sbjct: 14  VFT-SQVSAIDLDTSSKDSICDATSLIQKGVMDYYEGNRFGGTVGMFQQPYYWWEAGEVF 72

Query: 71  GGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGLTVMEAVER 130
           GGM++NW  C+N+T+E+ + +AM+ QAGP YD+MP NQ+MVEGNDDQGVWGLT+M AVER
Sbjct: 73  GGMMENWFLCQNDTYEKTLYDAMIAQAGPDYDFMPSNQSMVEGNDDQGVWGLTLMSAVER 132

Query: 131 NFTDPGD-GKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKNTISNGCYF 189
           NFT+P + G PGWLAM Q VFN +  RWD   C GG+RWQIFTWNSGYNYKNT+SN C F
Sbjct: 133 NFTNPTEKGVPGWLAMVQGVFNTMWSRWDSDHCGGGLRWQIFTWNSGYNYKNTVSNACLF 192

Query: 190 QLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKG--NVFDGAVTDDNCTQVTELEW 247
           QLAARLGRYT N+TYL  AE V++WL D+GFV   + G  NV+DGA  D NCT + E+EW
Sbjct: 193 QLAARLGRYTGNETYLTKAETVWNWLVDIGFVRFNESGNANVYDGATIDKNCTDIVEIEW 252

Query: 248 TYNHGIILGGSAYMYNAT-NGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGDSSNCN 306
           +YN GI+LGG+AYMYNAT NG+S WE R+NQI+ G++D FF++ +MYE+ CQ  DS  CN
Sbjct: 253 SYNQGIVLGGAAYMYNATHNGTSDWESRLNQIVGGSTDIFFRNKIMYEATCQ--DSGKCN 310

Query: 307 NDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLNWFKGS 366
            DQRSFKSIFSRML LT  L P  +DK+D L+ ASAEGAAKSC+GG DGHTCGLNW KG 
Sbjct: 311 QDQRSFKSIFSRMLSLTRTLAPYTADKIDPLMKASAEGAAKSCTGGTDGHTCGLNWEKGE 370

Query: 367 WDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQKKLKIQ 426
            D  YGLGEQ  ALE IQ+ L      PY    GG+S GD+ AGLN T+TNVL   L I 
Sbjct: 371 HDGWYGLGEQACALEGIQSQLYSMRPAPYTADNGGTSVGDTEAGLNKTSTNVLHSDLNIT 430

Query: 427 SKDRAGAAIITXXXXXXXXXXXXWMLF 453
            KD+ GA+IIT            WM+F
Sbjct: 431 QKDKVGASIITAVLLAVLVGGSIWMIF 457

>KLTH0E04048g Chr5 complement(369100..370464) [1365 bp, 454 aa] {ON}
           similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 454

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/444 (61%), Positives = 330/444 (74%), Gaps = 6/444 (1%)

Query: 14  LSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYYWWQAGEAFGGM 73
           L PI  +DL   D  S+C AT+LIQ G++DYYAG + GG +GMFQ PYYWW+AGE FGGM
Sbjct: 13  LQPILGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFGGM 72

Query: 74  IDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGLTVMEAVERNFT 133
           ++NW  C+N+T+ ++I +AM+ QAGP YD+MP NQ+MVEGNDDQGVWGLTVM A ERNFT
Sbjct: 73  LENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERNFT 132

Query: 134 DPG-DGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKNTISNGCYFQLA 192
           +P  DG PGWLAMAQ VFN +  RWD + C GGVRWQIFTWNSGYNYKNT+SN C FQLA
Sbjct: 133 NPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQLA 192

Query: 193 ARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKG--NVFDGAVTDDNCTQVTELEWTYN 250
           ARLGRYT N TYL  AE V+DWL DVGFVVL + G  NV+DGA  DDNCT + + EW+YN
Sbjct: 193 ARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIVKNEWSYN 252

Query: 251 HGIILGGSAYMYNAT-NGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGDSSNCNNDQ 309
            GI+LGG+AYMYNAT N +S W+ R++QI+ G++++FF+D VMYES CQ  DS  CN DQ
Sbjct: 253 QGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQ--DSKTCNQDQ 310

Query: 310 RSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLNWFKGSWDN 369
           RSFKSIFSRML LT  L P  ++ +D L+ ASAEGAAKSC+GG DGHTCGLNW  G  D 
Sbjct: 311 RSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDG 370

Query: 370 QYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQKKLKIQSKD 429
            YGLGEQ  ALE IQ+ +      PY    GGSS GD+ A LN+T+TNVLQ  +KI  KD
Sbjct: 371 YYGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKITHKD 430

Query: 430 RAGAAIITXXXXXXXXXXXXWMLF 453
           + GA+IIT            WM+F
Sbjct: 431 KVGASIITAVILAVLVGGSIWMIF 454

>AFR530W Chr6 (1388049..1389428) [1380 bp, 459 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5)
          Length = 459

 Score =  542 bits (1397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/437 (56%), Positives = 316/437 (72%), Gaps = 4/437 (0%)

Query: 19  AVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYYWWQAGEAFGGMIDNWH 78
           A+DL +  ++ VC  T  IQ+G++DYY G KYGG +GMFQPPYYWW+AGE FGGM++NW+
Sbjct: 25  ALDLDLSSREDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWY 84

Query: 79  FCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGLTVMEAVERNFTDP-GD 137
            C N  +E ++RE+M+ Q G  +DY+P NQ+  EGNDDQGVW L +M AVERNF DP  +
Sbjct: 85  LCDNQEYESVLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKE 144

Query: 138 GKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKNTISNGCYFQLAARLGR 197
           G PGWL M Q VFN++  RWD ++C GG+RWQIF WN+GY YKNTI+NGC FQLAARLGR
Sbjct: 145 GMPGWLTMVQTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGR 204

Query: 198 YTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQVTELEWTYNHGIILGG 257
           YT NQTYL+VA KVF WL DV ++VL+DK  VFDGA   +NC+ +  +EW+YNHGIIL G
Sbjct: 205 YTGNQTYLDVASKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAG 264

Query: 258 SAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGDSSNCNNDQRSFKSIFS 317
           +AYMYNAT GS +WE  V +IL GA+D++F+D +MYE  CQ  D + C+NDQRSFKSIFS
Sbjct: 265 AAYMYNATGGSPEWESHVTKILAGAADFYFRDKIMYERACQ--DYNTCDNDQRSFKSIFS 322

Query: 318 RMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLNWFKGSWDNQYGLGEQM 377
           RML +TSV+ P     +D+L+ ASA  A+KSC  G  G+TCGLNW KG++D  YGLGEQ 
Sbjct: 323 RMLAITSVVAPFTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQA 382

Query: 378 SALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLN-TTTTNVLQKKLKIQSKDRAGAAII 436
           SALE+IQN LIH   PP    TGG S+G+  AGL+  +   +L+    I  KDR GA++I
Sbjct: 383 SALEIIQNVLIHTKAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLI 442

Query: 437 TXXXXXXXXXXXXWMLF 453
           T            WM+F
Sbjct: 443 TAISLGLMLGCALWMIF 459

>Ecym_1474 Chr1 (976393..977757) [1365 bp, 454 aa] {ON} similar to
           Ashbya gossypii AFR530W
          Length = 454

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/452 (58%), Positives = 316/452 (69%), Gaps = 5/452 (1%)

Query: 3   LHNILVWLVFSLSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYY 62
           L+++L  L+  +     + L V  KDS+C+AT  IQ+G++DYY G   GG +GMF  PYY
Sbjct: 7   LYSLL--LLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYY 64

Query: 63  WWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGL 122
           WW+AG  F GM++NW+ C N  +   + E+M+ Q G +YDY+P NQ+M EGNDDQG+WGL
Sbjct: 65  WWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGL 124

Query: 123 TVMEAVERNFTDPGDGK-PGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKN 181
            +M AVERNF D   G  PGWL MAQAVFN +  RWD + C GG+RWQIFTWN GY+YKN
Sbjct: 125 FIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYKN 184

Query: 182 TISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQ 241
           TI+NGC FQLAARLGRYT N TYL++A + F WL DV FVVLKD+ NVFDGA   DNC  
Sbjct: 185 TIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQD 244

Query: 242 VTELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGD 301
           +  +EWTYNHG+ILGG AYMYNATNG   WE R+ QIL GA  +FF++N+MYE  CQ  D
Sbjct: 245 IKGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQ--D 302

Query: 302 SSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLN 361
           +  CNNDQRSFKSIFSRML +TSVL P   + +D LL ASA  AA SCSGG DG TCGL+
Sbjct: 303 NKICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEASAAAAAASCSGGKDGETCGLD 362

Query: 362 WFKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQK 421
           W  GSWD  YGLGEQ SALEVIQN LIH   PP  ++ GG+S GD  AGL T   NVL  
Sbjct: 363 WTTGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLHS 422

Query: 422 KLKIQSKDRAGAAIITXXXXXXXXXXXXWMLF 453
           +L I SKDR  AA+IT            WM+ 
Sbjct: 423 RLNIGSKDRIKAALITAVCLGLLVGTALWMVI 454

>NCAS0A08740 Chr1 (1727048..1728352) [1305 bp, 434 aa] {ON} 
          Length = 434

 Score =  525 bits (1351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/399 (61%), Positives = 299/399 (74%), Gaps = 8/399 (2%)

Query: 19  AVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYYWWQAGEAFGGMIDNWH 78
           ++ L V    S+C AT++I +G+LDYY G ++ G +GMFQ PYYWW+AG AFGGM++NW+
Sbjct: 26  SIKLNVTSNTSICDATSIITKGILDYYEGTRFNGTVGMFQQPYYWWKAGSAFGGMLENWY 85

Query: 79  FCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGLTVMEAVERNFTDP-GD 137
            C+N+TFE L+ +AML QAG  YDY+P+NQTMVE NDDQGVWGLT+M AVERNFTDP G 
Sbjct: 86  LCQNDTFESLLTDAMLHQAGKDYDYLPENQTMVEANDDQGVWGLTIMGAVERNFTDPQGK 145

Query: 138 GKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKNTISNGCYFQLAARLGR 197
             PGWLAMAQ++FN++  RWD  SC GG+RWQI+ WN GYNYKNTIS  C FQ+AARLGR
Sbjct: 146 DVPGWLAMAQSIFNQMYSRWDTGSCGGGLRWQIYDWNKGYNYKNTISTACLFQMAARLGR 205

Query: 198 YTNNQTYLEVAEKVFDWLTDVGFVVLK-DKGNVFDGAVTDDNCTQVTELEWTYNHGIILG 256
           YT N TYL+VA+K F W+ D+G++ L    G VFDGA  + NC+ +T+LEW+YNHGI+LG
Sbjct: 206 YTGNSTYLKVADKTFQWMVDIGYIQLNTSSGRVFDGAHIESNCSDITKLEWSYNHGIVLG 265

Query: 257 GSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGDSSNCNNDQRSFKSIF 316
           G AYMYNAT  S +W     +ILNGA+ YFFQ+  M E+ CQ  D   CNNDQR+FKSIF
Sbjct: 266 GCAYMYNATK-SPEWGMNTIKILNGATTYFFQNKTMLETACQRPDRVFCNNDQRTFKSIF 324

Query: 317 SRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLNWFKGSWDNQYGLGEQ 376
           SRMLGLTSV+ P  S+++D L+  SAE AA SC+GG D  TCGLNW +G  D  YGLGEQ
Sbjct: 325 SRMLGLTSVMAPFTSERIDPLIVQSAEAAALSCTGGFDNETCGLNWLEGKNDGYYGLGEQ 384

Query: 377 MSALEVIQNTLIHNSDPPYREST-----GGSSKGDSAAG 410
           +SALEVIQN LIH   PPY   T     GG SKGD AAG
Sbjct: 385 LSALEVIQNLLIHKRPPPYMAKTDKNKVGGVSKGDPAAG 423

>ACL201W Chr3 (10277..11623) [1347 bp, 448 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 448

 Score =  506 bits (1302), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 244/451 (54%), Positives = 310/451 (68%), Gaps = 7/451 (1%)

Query: 3   LHNILVWLVFSLSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYY 62
           ++ +LV L   LS   A+D+     +S+C AT LIQ G+LDYY G K GG  G    PYY
Sbjct: 1   MYVLLVILNIVLSN--ALDVDFNSSESICDATKLIQVGILDYYEGAKPGGRAGFLVKPYY 58

Query: 63  WWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGL 122
           WW AGEAFGGM++NW+ C N  +++L+ +AM++Q G + DYMP +Q MVEGNDDQG+WGL
Sbjct: 59  WWMAGEAFGGMVENWYLCNNTEYQDLLTDAMVSQIGENKDYMPSHQKMVEGNDDQGIWGL 118

Query: 123 TVMEAVERNFTD-PGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKN 181
            VM A ERNF D P +  PGWLA+AQAVFN +  RWD ++C GG+RWQIF WN GY+YKN
Sbjct: 119 LVMGAAERNFPDAPPERAPGWLALAQAVFNTMWARWDPENCGGGLRWQIFPWNGGYDYKN 178

Query: 182 TISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQ 241
           TISN C FQ+AARL R+T N TY +VAE VFDWL DV  V L++   V DGA   + C  
Sbjct: 179 TISNACLFQIAARLARFTGNSTYQDVAETVFDWLVDVKLVELENDARVLDGAHISERCED 238

Query: 242 VTELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGD 301
            ++LEWTYNHG++LGG AYMYN TNGS+ W +R+N++LNG S  FF++ ++YE  CQ  D
Sbjct: 239 HSQLEWTYNHGVVLGGCAYMYNITNGSAVWGDRLNKVLNG-SLLFFENGILYERACQ--D 295

Query: 302 SSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLN 361
            + CN+DQRSF+SIFSRML LTSVL P    +++  +  SAE AAKSCSGG DGHTCG+ 
Sbjct: 296 VNKCNDDQRSFRSIFSRMLALTSVLAPHTKARIEPNIRKSAEAAAKSCSGGRDGHTCGMV 355

Query: 362 WFKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQK 421
           W   +WD +YGLGEQ+SALE+IQNTLIH   PP   + G  S+GD  AGL  ++ N +  
Sbjct: 356 WRNYTWDGKYGLGEQLSALEIIQNTLIHTKPPPTTANEGAKSQGDPGAGLQLSSPNSITL 415

Query: 422 KLK-IQSKDRAGAAIITXXXXXXXXXXXXWM 451
             + I+ KDR GA   T            WM
Sbjct: 416 PTRQIRLKDRVGAGFATVVFLLPFITGSIWM 446

>ACL200W Chr3 (12145..13536) [1392 bp, 463 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 463

 Score =  505 bits (1301), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 242/453 (53%), Positives = 312/453 (68%), Gaps = 7/453 (1%)

Query: 1   MLLHNILVWLVFSLSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPP 60
           + ++ +LV L   LS   A+D+     +S+C AT LIQ G+LDYY G + GG +G FQ P
Sbjct: 14  LPMYVLLVILNIVLSN--ALDVDFNSSESICDATKLIQVGILDYYEGLRPGGRVGFFQKP 71

Query: 61  YYWWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVW 120
           YYWW AGEAFGGM++NW+ C N  +++L+ +AM++Q G + DY+P +Q M+EGNDDQG+W
Sbjct: 72  YYWWMAGEAFGGMVENWYLCNNTEYQDLLTDAMVSQIGENKDYVPSHQKMIEGNDDQGIW 131

Query: 121 GLTVMEAVERNFTD-PGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNY 179
           GL VM A ERNF D P +  PGWLA+AQAVFN +  RWD ++C GG+RWQIF WN+GY+Y
Sbjct: 132 GLLVMGAAERNFPDAPPERAPGWLALAQAVFNTMWARWDPENCGGGLRWQIFPWNNGYDY 191

Query: 180 KNTISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNC 239
           KNTISN C FQ+AARL R+T N TY +VAE VFDWL D   V L++   V DGA   + C
Sbjct: 192 KNTISNACLFQIAARLARFTGNSTYQDVAETVFDWLVDSKLVQLENDAKVLDGAHISERC 251

Query: 240 TQVTELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQH 299
              ++LEWTYNHG++L G AYMYN TNGS+ W +R+N++LNG S  FF + ++YE  CQ 
Sbjct: 252 EDHSKLEWTYNHGVVLAGCAYMYNITNGSAVWGDRLNKVLNG-SLLFFPNGILYERACQ- 309

Query: 300 GDSSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCG 359
            D   CN+DQRSF+SIFSRML LTSVL P    +++  +  SAE AAKSCSGG DGHTCG
Sbjct: 310 -DVQKCNDDQRSFRSIFSRMLALTSVLAPHTKARIEPNIRKSAEAAAKSCSGGRDGHTCG 368

Query: 360 LNWFKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVL 419
           + W   +WD +YGLGEQ+SALE+IQNTLIH   PP   + G  SKGD +AGL   + N++
Sbjct: 369 MVWRNYTWDGKYGLGEQLSALEIIQNTLIHTKPPPTTANEGAKSKGDPSAGLYDNSPNII 428

Query: 420 QKKLK-IQSKDRAGAAIITXXXXXXXXXXXXWM 451
               + I  KDR GA  +T            WM
Sbjct: 429 TLSTRQIGLKDRVGAGFMTVVLLIPFITGSIWM 461

>TBLA0C03850 Chr3 (921692..923395) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score =  495 bits (1274), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 227/418 (54%), Positives = 304/418 (72%), Gaps = 13/418 (3%)

Query: 20  VDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYYWWQAGEAFGGMIDNWHF 79
           +++    K+S+C+AT+LIQ G+LDYY G++YGG +G+FQPPYYWWQ+GEAFG +++NW+ 
Sbjct: 17  IEIDTHSKESICNATSLIQDGLLDYYEGNRYGGTVGIFQPPYYWWQSGEAFGSLLNNWYL 76

Query: 80  CKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGLTVMEAVERNFTDPGDGK 139
           C+N+T+E+LI +A+L QAGP+YD++P+NQTMVEGNDDQGV+ +T+++A+ERNFT P  G 
Sbjct: 77  CQNDTYEKLIYDAILAQAGPNYDFVPKNQTMVEGNDDQGVFDMTILDAMERNFTAPPKGS 136

Query: 140 PGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKNTISNGCYFQLAARLGRYT 199
           P WL M Q VFN + +RWD  SC GG+RWQI++WN+GY+YKN +S G  F +AARL RYT
Sbjct: 137 PSWLDMNQRVFNSMYDRWDTTSCNGGIRWQIYSWNNGYDYKNAVSTGSLFHIAARLARYT 196

Query: 200 NNQTYLEVAEKVFDWLTDVGFVVLKDK-GNVFDGAVTDDNCTQVTELEWTYNHGIILGGS 258
            N +Y +VA+ +FDWLT V +V+  DK G V DGA  + NCT +T +EWTYN GII+ G 
Sbjct: 197 GNASYFQVADTIFDWLTSVNYVMFDDKYGYVMDGASIEQNCTDITRIEWTYNFGIIMDGC 256

Query: 259 AYMYNATNGSSKWEERVNQILNGASDYFFQDN-VMYESGCQHGDSSNCNNDQRSFKSIFS 317
           AY+YNATNGS+KWE+   ++L GA D FF  N +MYE+ CQ  +   CNNDQRSFK++ +
Sbjct: 257 AYLYNATNGSAKWEQCTTKLLAGAKDDFFDKNDIMYEAACQTNNK--CNNDQRSFKALLA 314

Query: 318 RMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLNWFKGSWDNQYGLGEQM 377
           R LG TSVL P     +  ++NASA GAAKSC+GG DGHTCGL+W KG+ D  YG+GEQM
Sbjct: 315 RFLGTTSVLAPYTESTIKPMINASAIGAAKSCNGGYDGHTCGLSWQKGTNDGYYGMGEQM 374

Query: 378 SALEVIQNTLIHNSDPPYRESTGG---------SSKGDSAAGLNTTTTNVLQKKLKIQ 426
           SALE+IQN LI++  PP     GG          ++     GLN T+   L   +  Q
Sbjct: 375 SALEIIQNLLINDYPPPLVAPNGGCFNETVNDTQTRLRPPRGLNVTSRTTLNGTVIPQ 432

>SAKL0D13574g Chr4 (1125011..1126366) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 451

 Score =  487 bits (1254), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 236/451 (52%), Positives = 310/451 (68%), Gaps = 5/451 (1%)

Query: 3   LHNILVWLVFSLSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYY 62
           L N+L   +   SP  A+DL V D +S+ +ATAL+  G++DYY G +YG  IGMF  PYY
Sbjct: 6   LINVLCGSLLLYSPTGAMDLDVDDLNSLKNATALVAYGLMDYYTGLQYGQTIGMFSNPYY 65

Query: 63  WWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGL 122
           WW+AG A+G M+D W + +N+T+ +++++A+L Q G  +DY+P NQ+  EGNDDQ  WGL
Sbjct: 66  WWEAGGAWGSMLDYWWYMENDTYNDIVKQALLYQTGDDHDYVPLNQSTTEGNDDQAFWGL 125

Query: 123 TVMEAVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKNT 182
            VM A ERNF++P   +P WL +AQAVFN +  RWD  SC GG+RWQIFTWNSGY+YKN+
Sbjct: 126 AVMAAAERNFSNPDPDQPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFTWNSGYDYKNS 185

Query: 183 ISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQV 242
           +SNG  F +AARL RYT NQ+Y++ AEKVFDW+ DVG +   D   V DG   DDNCT V
Sbjct: 186 VSNGALFHIAARLARYTGNQSYVDWAEKVFDWMRDVGLITEGDWAFVHDGVSIDDNCTSV 245

Query: 243 TELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGDS 302
           T  +WTYNHG+I+ GSAY+YN T GS  W  R  + L+ +S +F   ++++E+ CQ   S
Sbjct: 246 TPYQWTYNHGLIMAGSAYLYNFT-GSEVWHNRTKEFLHSSSVFFKNGSILWEAACQA--S 302

Query: 303 SNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLNW 362
           + CN DQRSFK+ FSR LGLT+ LVP    ++ + + +SA+GAA+SCSGG DGHTCG+NW
Sbjct: 303 NTCNTDQRSFKAYFSRFLGLTAQLVPESRSQIMEWIRSSAKGAAESCSGGRDGHTCGINW 362

Query: 363 FKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQKK 422
           F GSWD  YGLGEQM+ALE+IQN    +   PY  +TGGSS+GDSAAG  T  TN+    
Sbjct: 363 FNGSWDGFYGLGEQMAALEIIQNVRCLDRPAPYTSTTGGSSQGDSAAGTETHPTNL--TP 420

Query: 423 LKIQSKDRAGAAIITXXXXXXXXXXXXWMLF 453
           L I +  RAGA IIT            W++ 
Sbjct: 421 LTITAGSRAGAGIITAVIGISIVACAVWLVL 451

>NCAS0A08730 Chr1 (1724401..1726296) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score =  492 bits (1267), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 218/389 (56%), Positives = 290/389 (74%), Gaps = 4/389 (1%)

Query: 7   LVWLVFSLSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYYWWQA 66
            +++   +    ++ L      S+C AT+L+Q+G+LDYY G  YGG +GMFQ PYYWW +
Sbjct: 16  FIYVSLFIGKTLSLTLDQTSSKSICDATSLLQKGILDYYEGTTYGGTVGMFQAPYYWWHS 75

Query: 67  GEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGLTVME 126
           G AFG MI+NW+ C+++T+E LI +A+L QAG +YD++PQNQTMVEGNDDQGVWGL +M+
Sbjct: 76  GCAFGSMIENWYLCQDDTYESLITDAILAQAGDNYDFVPQNQTMVEGNDDQGVWGLALMD 135

Query: 127 AVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKNTISNG 186
           A ER F     G+P WL MA+ +F  +  RWD+ +C GG+RWQI++WN+GY+YKNT+S  
Sbjct: 136 AAEREFPQV-KGQPSWLTMAENIFESMFARWDNANCGGGLRWQIYSWNNGYDYKNTVSTT 194

Query: 187 CYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDK-GNVFDGAVTDDNCTQVTEL 245
           C FQLAARLGRYT N+TY++ A + FDWL  VGFV+ K+  G VFDGA    NCT + + 
Sbjct: 195 CLFQLAARLGRYTGNETYVKAANQAFDWLQGVGFVMFKNNDGYVFDGADISTNCTNIKKY 254

Query: 246 EWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGDSSNC 305
           EW+YNHGI+LGG+AYMYN T+GSS WE R +Q+LN AS YFFQ+ +M+E+ CQ   S+ C
Sbjct: 255 EWSYNHGIVLGGAAYMYNLTDGSSTWETRTSQLLNLASSYFFQNGIMFEAECQ--TSNIC 312

Query: 306 NNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLNWFKG 365
           NNDQRSF+SIF+RMLG TS++ P  ++ +D LL  +++ AA +CSGG DGHTCGLNW   
Sbjct: 313 NNDQRSFRSIFARMLGKTSIMAPFTAETIDPLLKTTSKAAANACSGGKDGHTCGLNWLNS 372

Query: 366 SWDNQYGLGEQMSALEVIQNTLIHNSDPP 394
           ++D  YGLGE+MSA+EVIQN LIH    P
Sbjct: 373 NFDGNYGLGEEMSAMEVIQNLLIHQRPAP 401

>ACL202W Chr3 (8390..9742) [1353 bp, 450 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 450

 Score =  484 bits (1246), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 231/406 (56%), Positives = 288/406 (70%), Gaps = 4/406 (0%)

Query: 10  LVFSLSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYYWWQAGEA 69
           ++F++    A+D+      S+C+AT LIQQG+LDYY G + GG +G FQ PYYWW AG+ 
Sbjct: 5   VIFNIVLCNALDVNFNSSASICNATKLIQQGILDYYEGLRPGGRVGFFQEPYYWWMAGDV 64

Query: 70  FGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGLTVMEAVE 129
           FGGM++NW+ C N  +++L+ EAM++Q G + DY+P +Q MVEGNDDQG+WGL VM+A E
Sbjct: 65  FGGMVENWYLCDNTEYKDLLTEAMVSQIGENKDYVPWHQRMVEGNDDQGIWGLLVMDAAE 124

Query: 130 RNFTD-PGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKNTISNGCY 188
           R+F D P D  PGWLA+AQAVFN +  RWD  +CAGG+ WQI+ WN GY+YKNTISNG  
Sbjct: 125 RDFPDAPPDQAPGWLALAQAVFNTMWARWDMDNCAGGLLWQIYPWNVGYDYKNTISNGYL 184

Query: 189 FQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQVTELEWT 248
           FQ+AARL R+T N TY  VAE VFDWL D   V L +   V DGA    NCT  T  EWT
Sbjct: 185 FQIAARLARFTGNSTYGRVAETVFDWLVDSKLVQLDNVALVLDGAHVYTNCTDFTRYEWT 244

Query: 249 YNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGDSSNCNND 308
           YN+G++LGG AYMYN TNGS  W  R+N++LNGA   FF++ +MYE  CQ  D   CNND
Sbjct: 245 YNYGVVLGGCAYMYNFTNGSPVWANRLNRVLNGAL-LFFENGIMYERTCQ--DVDRCNND 301

Query: 309 QRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLNWFKGSWD 368
           QR FKSIF+RML LTSVL P    +++  +  SAE AAKSC+GG DGHTCGL W   +WD
Sbjct: 302 QRFFKSIFTRMLALTSVLAPHTKARIEPNIRKSAEAAAKSCNGGSDGHTCGLVWRNYTWD 361

Query: 369 NQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTT 414
            + GLGEQ+ ALE+IQNTLIH   PP     G  SKGD AAGLN++
Sbjct: 362 GKAGLGEQLCALEIIQNTLIHTKRPPLTAKQGAKSKGDPAAGLNSS 407

>KLTH0D08008g Chr4 (680735..682081) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 448

 Score =  478 bits (1231), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 228/435 (52%), Positives = 303/435 (69%), Gaps = 6/435 (1%)

Query: 19  AVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYYWWQAGEAFGGMIDNWH 78
           A+D  V ++ S+ +ATAL+  G+LDYY G +YG  IGMF  PYYWW+AG A+G ++D W 
Sbjct: 20  ALDFDVDNEGSIKNATALVAGGLLDYYTGQQYGQTIGMFSNPYYWWEAGGAWGSILDFWW 79

Query: 79  FCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGLTVMEAVERNFTDPGDG 138
           + +N+T+  ++ EA+L QAG ++DY+P NQ+  EGNDDQ  WGL VM A ERNFT+P + 
Sbjct: 80  YTQNDTYNAMLEEALLYQAGENHDYIPLNQSTTEGNDDQAFWGLVVMAAAERNFTNPPET 139

Query: 139 KPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKNTISNGCYFQLAARLGRY 198
           +P WL +AQAVFN +  RWDD+SC GG+RWQIFTWNSGY+YKNT+SNG  F LAARL RY
Sbjct: 140 EPQWLYLAQAVFNTMALRWDDESCGGGLRWQIFTWNSGYDYKNTVSNGALFHLAARLARY 199

Query: 199 TNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQVTELEWTYNHGIILGGS 258
           T N TY++ AEKVFDW+  +G +   D   V+DGA  D NC+ +T+L WTYN G+++ G 
Sbjct: 200 TGNNTYVDWAEKVFDWMKGIGLLTENDNSYVYDGAKVDGNCSTITKLIWTYNQGLLMSGC 259

Query: 259 AYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGDSSNCNNDQRSFKSIFSR 318
           AY+YN T GS  W  R  + LN +SD FF ++++YE  CQ  ++  CN DQRSFK+ FSR
Sbjct: 260 AYLYNYT-GSETWHTRTFEFLN-SSDIFFNNSILYERTCQEANT--CNTDQRSFKAYFSR 315

Query: 319 MLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLNWFKGSWDNQYGLGEQMS 378
            LGLT+ LVP+  +++   + ASA+GAA+SCSGG DGHTCGLNWF   WD ++GLGEQM+
Sbjct: 316 FLGLTAQLVPAARNQIMDWIRASAKGAAQSCSGGTDGHTCGLNWFYDGWDGKWGLGEQMA 375

Query: 379 ALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQKKLKIQSKDRAGAAIITX 438
           ALE++QN L  +   PY  +TGGSS G+ AAG  T+ TN+    L I +  RA A IIT 
Sbjct: 376 ALEIMQNVLCLDRPAPYTAATGGSSVGNGAAGTETSATNL--SPLDITTGSRAAAGIITA 433

Query: 439 XXXXXXXXXXXWMLF 453
                      W++ 
Sbjct: 434 VIGLSIVACTVWLVL 448

>Kwal_26.8225 s26 (696173..697522) [1350 bp, 449 aa] {ON} YKL046C -
           Hypothetical ORF [contig 58] FULL
          Length = 449

 Score =  476 bits (1224), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 230/444 (51%), Positives = 306/444 (68%), Gaps = 5/444 (1%)

Query: 10  LVFSLSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYYWWQAGEA 69
           L+ +L     + L V + +S+ +ATAL+  G+LDYY G +YG  IGMF  PYYWW+AG A
Sbjct: 11  LLVTLRGSLGIYLDVNNTESIKNATALVAGGLLDYYTGLQYGETIGMFSDPYYWWEAGGA 70

Query: 70  FGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGLTVMEAVE 129
           +G ++D WH+ +N+T+ +++ +A+L Q+G ++DY+P NQ+  EGNDDQ  WGL VM A E
Sbjct: 71  WGSILDYWHYTQNDTYNKILEQALLYQSGENHDYIPLNQSTTEGNDDQAFWGLVVMAAAE 130

Query: 130 RNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKNTISNGCYF 189
           RNFT+P   +P WL +AQAVFN +  RWD+ +C GG+RWQIFTWNSGY+YKNT+SNG  F
Sbjct: 131 RNFTNPPPDQPQWLYLAQAVFNTMALRWDEDTCGGGLRWQIFTWNSGYDYKNTVSNGALF 190

Query: 190 QLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQVTELEWTY 249
            LAARL RYT N TY+E AEKVFDW+  +  +  +++  V+DGA  DDNCT +T+L WTY
Sbjct: 191 HLAARLARYTGNDTYVEWAEKVFDWMKGIKLLTEENENFVYDGAKVDDNCTVITKLIWTY 250

Query: 250 NHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGDSSNCNNDQ 309
           N G+++ GSAY+YN T G+ KW  R  + LN +S  FF ++V+YE  CQ G + +CN DQ
Sbjct: 251 NQGLLMSGSAYLYNYT-GAEKWHTRTFEFLN-SSHIFFNNSVLYERACQ-GVTVSCNTDQ 307

Query: 310 RSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLNWFKGSWDN 369
           RSFK+ FSR +GLT+ LVP    K+   + ASA GAA+SCSGG DGHTCGLNWF   WD 
Sbjct: 308 RSFKAYFSRFMGLTAQLVPESRSKIMAWIQASALGAAQSCSGGRDGHTCGLNWFYDGWDG 367

Query: 370 QYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQKKLKIQSKD 429
           ++GLGEQMSALE++QN L  +   PY   TGGSS G+ AAG  T+ TN+    L I +  
Sbjct: 368 KWGLGEQMSALEIMQNLLCLDRPAPYTAETGGSSVGNGAAGTETSATNL--SPLAITAGS 425

Query: 430 RAGAAIITXXXXXXXXXXXXWMLF 453
           RA A IIT            W++ 
Sbjct: 426 RAAAGIITAVIGLSIVACTIWLVL 449

>NCAS0A12750 Chr1 (2516616..2517959) [1344 bp, 447 aa] {ON}
           Anc_2.570
          Length = 447

 Score =  475 bits (1222), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 232/451 (51%), Positives = 306/451 (67%), Gaps = 10/451 (2%)

Query: 7   LVWLVFSLS----PIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYY 62
           +++L+F++S    PI AVDL +    S+ +AT+L+  G++DYY GD+YG  +GMF  PYY
Sbjct: 3   IIYLLFTVSSFSFPIAAVDLNLNSLQSLQNATSLVAYGLMDYYTGDQYGQTVGMFSDPYY 62

Query: 63  WWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGL 122
           WW+AG A+G M+D W+F +N+T+ ++I  A+L Q G   +Y+P NQ+  EGNDDQ  WG+
Sbjct: 63  WWEAGGAWGTMLDYWYFMQNDTYNDIITAALLHQVGTDNNYIPLNQSTTEGNDDQAFWGI 122

Query: 123 TVMEAVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKNT 182
           TVM A ERNFT+P + +P WL +AQAVFN +  RWD  SC GG+RWQIF WNSGY+YKN+
Sbjct: 123 TVMTAAERNFTNPPEDQPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNS 182

Query: 183 ISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQV 242
           +SNG  F +AARL RYT NQ+Y++ AE+V+DW++DVG +       V+DGA T DNCT +
Sbjct: 183 VSNGALFHMAARLARYTGNQSYVDWAERVYDWMSDVGLISNGSYKFVYDGASTTDNCTVL 242

Query: 243 TELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGDS 302
           T  +WTYN G++L G+AY+YN T GS  W  R NQ+LN AS  FF ++++YE+ CQ   S
Sbjct: 243 TTYQWTYNQGLLLSGAAYLYNYT-GSDTWLLRTNQLLN-ASSVFFNNSILYEAACQK--S 298

Query: 303 SNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLNW 362
             CNNDQRSFK+ F R LG T+ LV      + + LNASA  AA+SCSGG DGHTCGLNW
Sbjct: 299 GTCNNDQRSFKAYFLRFLGQTAQLVSETQPTIMKWLNASAYAAAQSCSGGTDGHTCGLNW 358

Query: 363 FKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQKK 422
           F G WD  YGLGEQMSALE + NT + +   PY  + GGSS G+SAAG     TN+    
Sbjct: 359 FSGGWDGMYGLGEQMSALEALVNTRVLHLPGPYNSTDGGSSIGNSAAGTEQEATNL--AP 416

Query: 423 LKIQSKDRAGAAIITXXXXXXXXXXXXWMLF 453
           L I    +A AAIIT            W++ 
Sbjct: 417 LHITDGSKAAAAIITSVVGISIVAAGVWLII 447

>TPHA0I02470 Chr9 (550108..551466) [1359 bp, 452 aa] {ON} Anc_2.570
           YKL046C
          Length = 452

 Score =  466 bits (1199), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 228/453 (50%), Positives = 304/453 (67%), Gaps = 8/453 (1%)

Query: 1   MLLHNILVWLVFSLSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPP 60
           +L  N ++ L  SL+   AV L + + +S+ +ATAL+  G++DYY G +YG  IGMF  P
Sbjct: 8   LLFVNCILSLYSSLTS--AVYLDLDNYESLQNATALVAYGLMDYYTGLQYGKTIGMFSDP 65

Query: 61  YYWWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVW 120
           YYWW+AG A+G M+D W F +N+T+ ++I++A+L Q G   DY+P NQ+  EGNDDQ  W
Sbjct: 66  YYWWEAGGAWGCMLDYWFFMENDTYNDIIKQALLYQVGTANDYVPLNQSTTEGNDDQAFW 125

Query: 121 GLTVMEAVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYK 180
           G+  M A ERNFT+P + +P WL +AQAVFN +  RWD  SC GG+RWQIF WNSGY+YK
Sbjct: 126 GIAAMMAAERNFTNPAEDEPQWLYLAQAVFNTMALRWDTDSCGGGLRWQIFQWNSGYDYK 185

Query: 181 NTISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCT 240
           N++SNG  F +AARL RYT N +Y E AEKV+DW+ DV  +       V+DG  ++DNCT
Sbjct: 186 NSVSNGALFHIAARLARYTGNDSYAEWAEKVYDWMVDVDLITQDQYYFVYDGVDSNDNCT 245

Query: 241 QVTELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHG 300
            +T+ +WTYN G+IL G AY+YN T GS  W  R    L+ +S  FF D ++YE+ CQ+ 
Sbjct: 246 TITKYQWTYNQGLILSGCAYLYNYT-GSELWHTRTKNFLS-SSSVFFNDTILYEAACQNQ 303

Query: 301 DSSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGL 360
           ++  CN DQRSFK+ FSR LG+T+ LVP   D + + ++ASA GAA+SCSGG DGHTCG+
Sbjct: 304 ET--CNTDQRSFKAYFSRFLGVTAQLVPETRDNIMKWIDASAYGAAESCSGGTDGHTCGI 361

Query: 361 NWFKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQ 420
           NWF G WD +YGLGEQM+ALE++ NT   +   PY  S GGSS GD AAG  T+ TN+  
Sbjct: 362 NWFYGGWDGKYGLGEQMAALEILVNTRALDRPAPYTSSNGGSSTGDGAAGTETSATNL-- 419

Query: 421 KKLKIQSKDRAGAAIITXXXXXXXXXXXXWMLF 453
             L I +  RAGA IIT            W++ 
Sbjct: 420 SPLNITAGSRAGAGIITAVIGISIVACACWLVI 452

>YKL046C Chr11 complement(351275..352624) [1350 bp, 449 aa] {ON}
           DCW1Putative mannosidase, GPI-anchored membrane protein
           required for cell wall biosynthesis in bud
           formation;homologous to Dfg5p
          Length = 449

 Score =  465 bits (1196), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 232/455 (50%), Positives = 301/455 (66%), Gaps = 8/455 (1%)

Query: 1   MLLHNI--LVWLVFSLSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQ 58
           ML++ +  L+ ++F+     AV+L + + +S+ +AT+LI  G++DYY G++YG  +GMF 
Sbjct: 1   MLVNKVIGLLGVLFATRFTNAVELDLDNYESLQNATSLIAYGLMDYYTGNQYGKTVGMFS 60

Query: 59  PPYYWWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQG 118
            PYYWW+AG A+G M+D W F  N+T+ + I  AM+ QAG   DY+P NQ+  EGNDDQ 
Sbjct: 61  DPYYWWEAGGAWGCMLDYWFFMDNDTYNDEIIAAMIHQAGDDNDYIPLNQSTTEGNDDQA 120

Query: 119 VWGLTVMEAVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYN 178
            WG+  M A ERNFT+P + +P WL +AQAVFN +  RWD  SC GG+RWQIF WNSGY+
Sbjct: 121 FWGIAAMTAAERNFTNPPENEPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYD 180

Query: 179 YKNTISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDN 238
           YKNT+SNG  F +AARL RYT NQTY++ AEKV++W+  V  +       V+DG   DDN
Sbjct: 181 YKNTVSNGALFHIAARLARYTGNQTYVDWAEKVYEWMVGVNLISNGTYKYVYDGVSIDDN 240

Query: 239 CTQVTELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQ 298
           CT+VT  +WTYN G++L GSAY+YN T GS  W  R  + LN AS  FF D ++YE+ CQ
Sbjct: 241 CTKVTSYQWTYNQGLLLAGSAYLYNFT-GSDLWHTRTKEFLN-ASQVFFHDGIVYEAACQ 298

Query: 299 HGDSSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTC 358
             +S  CN DQRSFK+ F+R LG+T+ LVP   +++   LN SA  AAKSCSGG DGHTC
Sbjct: 299 GPNS--CNTDQRSFKAYFARFLGVTAQLVPETRNQIMSWLNTSAIAAAKSCSGGTDGHTC 356

Query: 359 GLNWFKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNV 418
           GLNWF G+WD  YGLGEQMSALEV+ NT   +   PY    GGSS GD AAG     TN+
Sbjct: 357 GLNWFNGTWDGMYGLGEQMSALEVMVNTRALDKPAPYTAENGGSSVGDGAAGTQAQPTNL 416

Query: 419 LQKKLKIQSKDRAGAAIITXXXXXXXXXXXXWMLF 453
               L I    +AGA IIT            W++F
Sbjct: 417 --APLNITKGSKAGAGIITAVIGISIVACALWLVF 449

>KLLA0E07723g Chr5 complement(691980..693332) [1353 bp, 450 aa] {ON}
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 450

 Score =  464 bits (1193), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 229/456 (50%), Positives = 305/456 (66%), Gaps = 9/456 (1%)

Query: 1   MLLHNILVWLVFSLSPI-WAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQP 59
           M +  +++ LV   S + + +DL V D +S+ +AT+L+  G++DYY G +YG  IGMF  
Sbjct: 1   MRVFKLVLSLVTLFSSVSFGLDLDVNDLNSLKNATSLVAYGLMDYYTGLQYGKTIGMFAS 60

Query: 60  PYYWWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGV 119
           P YWWQAG A+G ++D W + +N+T+ +++ +A+L Q G ++DYMP NQT+ EGNDDQ  
Sbjct: 61  PSYWWQAGGAWGSILDYWFYMENDTYNDILTQALLYQTGDNHDYMPLNQTVTEGNDDQAF 120

Query: 120 WGLTVMEAVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNY 179
           WG  VM A ERN+ +P D +P WL +AQAVFN ++ RWD  SC GG+RWQIFTWNSGY+Y
Sbjct: 121 WGFAVMAAAERNYPNPPDDEPQWLYLAQAVFNTMSSRWDMDSCGGGLRWQIFTWNSGYDY 180

Query: 180 KNTISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGN--VFDGAVTDD 237
           KN++SN   F L+ARL RYT N +Y E AEK++DW+ D+  +V ++     V+DGA  ++
Sbjct: 181 KNSVSNAALFHLSARLARYTGNSSYTEWAEKIYDWMQDIQLLVDEEPTQYYVYDGASIEE 240

Query: 238 NCTQVTELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGC 297
           NCT   + +WTYN G++L GSAY+YN T  S  W ER    LN +S  FF +++MYE+ C
Sbjct: 241 NCTDTVKYQWTYNQGLMLSGSAYLYNFTE-SETWHERTKNFLN-SSGIFFNNSIMYEAAC 298

Query: 298 QHGDSSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHT 357
           Q   S  CNNDQRSFK+ FSR LGLT+ LVP   D V  LL ASA+GAA SCSGG DGHT
Sbjct: 299 Q--GSGYCNNDQRSFKAYFSRFLGLTAQLVPETRDTVLALLQASAQGAADSCSGGTDGHT 356

Query: 358 CGLNWFKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTN 417
           CGLNWF G WD +YGLGEQM+ALEV+QN    +   PY    GG+S G+ AAG   + TN
Sbjct: 357 CGLNWFYGGWDGKYGLGEQMAALEVMQNLRCLDRPAPYTADDGGTSAGNPAAGTEQSPTN 416

Query: 418 VLQKKLKIQSKDRAGAAIITXXXXXXXXXXXXWMLF 453
           +    L I   D+AGA IIT            W++ 
Sbjct: 417 L--APLTIGKGDQAGAGIITAVIGITIIGSVVWLII 450

>Smik_11.202 Chr11 complement(337711..339060) [1350 bp, 449 aa] {ON}
           YKL046C (REAL)
          Length = 449

 Score =  463 bits (1192), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 232/455 (50%), Positives = 299/455 (65%), Gaps = 8/455 (1%)

Query: 1   MLLHNILVWL--VFSLSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQ 58
           ML++ ++ +L  +F+     AV+L + + +S+ +AT+L+  G++DYY G++YG  IGMF 
Sbjct: 1   MLMNKVIGFLSVLFATRFTNAVELDLDNYESLQNATSLVAYGLMDYYTGNQYGKTIGMFS 60

Query: 59  PPYYWWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQG 118
            PYYWW+AG A+G M+D W F  N+T+ + I  AM+ QAG   DY+P NQ+  EGNDDQ 
Sbjct: 61  DPYYWWEAGGAWGCMLDYWFFMDNDTYNDEIIAAMIHQAGDDNDYIPLNQSTTEGNDDQA 120

Query: 119 VWGLTVMEAVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYN 178
            WG+  M A ERNFT+P +  P WL +AQAVFN +  RWD  SC GG+RWQIF WNSGY+
Sbjct: 121 FWGIAAMTAAERNFTNPPEDDPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYD 180

Query: 179 YKNTISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDN 238
           YKNT+SNG  F +AARL RYT NQTY++ AEKV++W+  V  +       V+DG   DDN
Sbjct: 181 YKNTVSNGALFHIAARLARYTGNQTYVDWAEKVYEWMVGVDLISNGTYKYVYDGVSIDDN 240

Query: 239 CTQVTELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQ 298
           CT+VT  +WTYN G++L GSAY+YN T GS  W  R  + LN AS  FF D ++YE+ CQ
Sbjct: 241 CTKVTSYQWTYNQGLLLAGSAYLYNFT-GSDLWHTRTKEFLN-ASQVFFHDGIVYEAACQ 298

Query: 299 HGDSSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTC 358
             +S  CN DQRSFK+ F+R LG+T+ LVP    ++   LN SA  AAKSCSGG DGHTC
Sbjct: 299 GPNS--CNTDQRSFKAYFARFLGVTAQLVPETRHQIMSWLNTSAIAAAKSCSGGTDGHTC 356

Query: 359 GLNWFKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNV 418
           GLNWF G+WD  YGLGEQMSALEV+ NT   +   PY    GGSS GD AAG     TN+
Sbjct: 357 GLNWFNGTWDGMYGLGEQMSALEVLVNTRALDRPAPYTAENGGSSVGDGAAGTQARPTNL 416

Query: 419 LQKKLKIQSKDRAGAAIITXXXXXXXXXXXXWMLF 453
               L I    +AGA IIT            W++F
Sbjct: 417 --APLNITKGSKAGAGIITAVIGISIVACALWLVF 449

>KAFR0I01740 Chr9 complement(352631..353977) [1347 bp, 448 aa] {ON}
           Anc_2.570 YKL046C
          Length = 448

 Score =  462 bits (1190), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 229/454 (50%), Positives = 299/454 (65%), Gaps = 7/454 (1%)

Query: 1   MLLHN-ILVWLVFSLSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQP 59
           M+++N IL+ L   +  +++++L +   +S+ +ATAL+  G++DYY G++YG  +GMF  
Sbjct: 1   MVINNLILLILSTFIGRVYSLELDLDSFESLQNATALVAYGLMDYYTGNQYGKTVGMFSD 60

Query: 60  PYYWWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGV 119
           PYYWW+AG A+G MID W++  NNT+ + I  A+L Q G  +DY+P NQ+  EGNDDQ  
Sbjct: 61  PYYWWEAGGAWGSMIDFWYYMDNNTYNDDIMAALLHQTGDDWDYIPLNQSTTEGNDDQAF 120

Query: 120 WGLTVMEAVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNY 179
           WG+ VM A ERNFT+P D +P WL +AQAVFN +  RWDD +C GG+RWQIFTWNSGY+Y
Sbjct: 121 WGIAVMTAAERNFTNPPDDQPQWLYLAQAVFNTMALRWDDATCGGGLRWQIFTWNSGYDY 180

Query: 180 KNTISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNC 239
           KNT+SNG  F LAARL RYT N +Y++ AEKV++W+ D   +    +  V+DGA   DNC
Sbjct: 181 KNTVSNGALFHLAARLARYTGNTSYVDWAEKVYNWMEDTYLISNGTQMFVYDGASVTDNC 240

Query: 240 TQVTELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQH 299
           T VT+ +WTYN G++L GSAY+YN T  S  W ER    LN AS  FF +++MYE+ CQ 
Sbjct: 241 TTVTKYQWTYNQGLLLSGSAYLYNFTE-SELWHERTKGFLN-ASVVFFNNSIMYEAACQ- 297

Query: 300 GDSSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCG 359
                CN DQRSFK+ FSR LG T+ LVP   D V   +N SA  AA SCSGG DGHTCG
Sbjct: 298 -GPQTCNTDQRSFKAYFSRFLGATAQLVPETRDTVMHWVNTSAVAAATSCSGGTDGHTCG 356

Query: 360 LNWFKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVL 419
           +NWF G WD  YGLGEQMSALE++ NT   +   PY    GGSS GD AAG   T TN+ 
Sbjct: 357 INWFYGGWDGYYGLGEQMSALEIMVNTRALHKPGPYTSENGGSSMGDGAAGTQATATNL- 415

Query: 420 QKKLKIQSKDRAGAAIITXXXXXXXXXXXXWMLF 453
              L +    +A A IIT            W+++
Sbjct: 416 -SPLNVTPGSKAAAGIITAVIGISIFACVLWLIY 448

>Suva_11.180 Chr11 complement(334319..335671) [1353 bp, 450 aa] {ON}
           YKL046C (REAL)
          Length = 450

 Score =  462 bits (1189), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 227/435 (52%), Positives = 288/435 (66%), Gaps = 6/435 (1%)

Query: 19  AVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYYWWQAGEAFGGMIDNWH 78
           AV+L + +  S+ +AT+LI  G++DYY GD+YG  +GMF  PYYWW+AG A+G M+D W 
Sbjct: 22  AVELDLDNYQSLQNATSLIAYGLMDYYTGDQYGKTVGMFSDPYYWWEAGGAWGCMLDYWF 81

Query: 79  FCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGLTVMEAVERNFTDPGDG 138
           F +N+T+ + I  AM+ QAG   DY+P NQ+  EGNDDQ  WG+  M A ERNFT+P   
Sbjct: 82  FMENDTYNDEITAAMIHQAGDDNDYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNPPSD 141

Query: 139 KPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKNTISNGCYFQLAARLGRY 198
           +P WL +AQAVFN +  RWD  SC GG+RWQIF WNSGY+YKNT+SNG  F +AARL RY
Sbjct: 142 EPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNTVSNGALFHIAARLARY 201

Query: 199 TNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQVTELEWTYNHGIILGGS 258
           T N+TY++ AEKV++W+  V  +       V+DG   DDNCT+VT  +WTYN G++L GS
Sbjct: 202 TGNETYVDWAEKVYEWMVGVNLISNGTYKYVYDGVSIDDNCTKVTSYQWTYNQGLLLAGS 261

Query: 259 AYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGDSSNCNNDQRSFKSIFSR 318
           AY+YN T GS  W  R  + LN AS  FF D ++YE+ CQ  +S  CN DQRSFK+ F+R
Sbjct: 262 AYLYNFT-GSDLWHTRTKEFLN-ASQVFFHDGIVYEAACQGPNS--CNTDQRSFKAYFAR 317

Query: 319 MLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLNWFKGSWDNQYGLGEQMS 378
            LG+T+ LVP    ++   LN SA  AAKSCSGG DGHTCGLNWF G+WD  YGLGEQM+
Sbjct: 318 FLGVTAQLVPETRSQIMSWLNTSAIAAAKSCSGGTDGHTCGLNWFNGTWDGMYGLGEQMA 377

Query: 379 ALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQKKLKIQSKDRAGAAIITX 438
           ALEV+ NT   +   PY    GGSS GD AAG     TN+    L I    +AGA IIT 
Sbjct: 378 ALEVMVNTRALDRPSPYTADNGGSSVGDGAAGTQAQPTNL--SPLNITKGSKAGAGIITA 435

Query: 439 XXXXXXXXXXXWMLF 453
                      W++F
Sbjct: 436 VIGISIVACALWLVF 450

>NDAI0C00680 Chr3 complement(132980..134338) [1359 bp, 452 aa] {ON}
           Anc_2.570
          Length = 452

 Score =  459 bits (1181), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 227/458 (49%), Positives = 301/458 (65%), Gaps = 11/458 (2%)

Query: 1   MLLHNILVWLVFSLSPIW-----AVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIG 55
           MLL N L+ +V + + +      A+++ + D DS+ +AT+L+  G++DYY G++YG  IG
Sbjct: 1   MLLTNTLLSIVTTTTLLLSHSTKALEIDLDDIDSLRNATSLVAYGLMDYYTGNQYGKTIG 60

Query: 56  MFQPPYYWWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGND 115
           MF  PYYWW+AG A+G M+D W++  N+T+ + I  A+L Q G + DY+P NQ+  EGND
Sbjct: 61  MFSDPYYWWEAGGAWGSMLDYWYYMDNDTYNDEIMAALLHQTGDNNDYVPLNQSTTEGND 120

Query: 116 DQGVWGLTVMEAVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNS 175
           DQ  WG+ VM A ERNFT+P +  P WL +AQAVFN +  RWD  +C GG+RWQIF WNS
Sbjct: 121 DQAFWGIAVMTAAERNFTNPPEDSPQWLYLAQAVFNTMALRWDGDTCGGGLRWQIFVWNS 180

Query: 176 GYNYKNTISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVT 235
           GY+YKNT+SNG  F +AARL RYT NQ+Y++ AEKV+DW+ +VG V       V+DG   
Sbjct: 181 GYDYKNTVSNGALFHMAARLARYTGNQSYVDWAEKVYDWMYEVGLVSNGSSMFVYDGVNI 240

Query: 236 DDNCTQVTELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYES 295
            +NC+ +T  +WTYNHG+++ G+AY+YN T  +  W  R   +++ AS  FF +++MYE+
Sbjct: 241 ANNCSTITPYQWTYNHGLVMAGAAYLYNFTE-NEVWHNRTKMLVD-ASTVFFNNSIMYEA 298

Query: 296 GCQHGDSSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDG 355
            CQ  +S  CN DQRSFK+ FSR LG T+ LVP    K+  L+NASA  A KSCSGG DG
Sbjct: 299 ACQGPNS--CNTDQRSFKAYFSRFLGATAQLVPETRSKILPLINASAIAAGKSCSGGTDG 356

Query: 356 HTCGLNWFKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTT 415
           HTCGLNWF G WD  YGLGEQM ALEV+ NT   +   PY  + GGSS GD AAG     
Sbjct: 357 HTCGLNWFIGDWDGMYGLGEQMCALEVMVNTRCLHKPAPYTSTNGGSSVGDGAAGTEHHP 416

Query: 416 TNVLQKKLKIQSKDRAGAAIITXXXXXXXXXXXXWMLF 453
           TN+    L I    RAGA IIT            W++F
Sbjct: 417 TNL--APLHITKGSRAGAGIITAVIGISILACALWLVF 452

>Skud_11.183 Chr11 complement(330975..332324) [1350 bp, 449 aa] {ON}
           YKL046C (REAL)
          Length = 449

 Score =  459 bits (1180), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 231/455 (50%), Positives = 299/455 (65%), Gaps = 8/455 (1%)

Query: 1   MLLHNI--LVWLVFSLSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQ 58
           MLL+ +  L+ ++F      AV+L + + +S+ +AT+LI  G++DYY G++YG  IGMF 
Sbjct: 1   MLLNKVIGLLSVLFFTKFSNAVELDLDNYESLENATSLIAYGLMDYYTGNQYGKTIGMFS 60

Query: 59  PPYYWWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQG 118
            PYYWW+AG A+G M+D W F  N+T+ + I  AM+ Q+G   DY+P NQ+  EGNDDQ 
Sbjct: 61  DPYYWWEAGGAWGCMLDYWFFMDNDTYNDEIIAAMVHQSGDDNDYIPLNQSTTEGNDDQA 120

Query: 119 VWGLTVMEAVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYN 178
            WG+  M A ERNFT+P   +P WL +AQAVFN +  RWD  SC GG+RWQIF WNSGY+
Sbjct: 121 FWGIAAMTAAERNFTNPPADEPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYD 180

Query: 179 YKNTISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDN 238
           YKNT+SNG  F +AARL RYT NQTY++ AEKV++W+  V  +       V+DG    DN
Sbjct: 181 YKNTVSNGALFHIAARLARYTGNQTYVDWAEKVYEWMVGVNLISNGTYKYVYDGVSIGDN 240

Query: 239 CTQVTELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQ 298
           CT+VT  +WTYN G++L GSAY+YN T GS  W  R  + LN +S  FFQD ++YE+ CQ
Sbjct: 241 CTKVTSYQWTYNQGLLLAGSAYLYNFT-GSDLWHTRTKEFLN-SSQVFFQDGIVYEAACQ 298

Query: 299 HGDSSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTC 358
             +S  CN DQRSFK+ F+R LG+T+ LVP   +++   LN SA  AAKSCSGG DGHTC
Sbjct: 299 GPNS--CNTDQRSFKAYFARFLGVTAQLVPETRNQIMTWLNTSAIAAAKSCSGGTDGHTC 356

Query: 359 GLNWFKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNV 418
           GLNWF G+WD  YGLGEQM+ALEV+ NT   +   PY    GGSS GD AAG     TN+
Sbjct: 357 GLNWFNGTWDGMYGLGEQMAALEVMVNTRALDKPAPYTADEGGSSAGDGAAGTQAQPTNL 416

Query: 419 LQKKLKIQSKDRAGAAIITXXXXXXXXXXXXWMLF 453
               L I    +AGA IIT            W++F
Sbjct: 417 --APLNITKGSKAGAGIITAVIGISIVACALWLVF 449

>KAFR0A02170 Chr1 (454336..455685) [1350 bp, 449 aa] {ON} Anc_2.570
           YKL046C
          Length = 449

 Score =  454 bits (1168), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 222/427 (51%), Positives = 292/427 (68%), Gaps = 10/427 (2%)

Query: 2   LLHNILVWLVFSLSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPY 61
           L+ + L+W   SL      +L + D  S+ +ATAL+  G++DYY G KYGG +GMF  PY
Sbjct: 10  LILSTLIWRSQSL------ELDLDDYQSLQNATALVAWGLMDYYEGTKYGGTVGMFSSPY 63

Query: 62  YWWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWG 121
           YWW+AG AFG ++D W+F  N+T+ + I  AM+ QAG  +DY+P NQ+  EGNDDQ  WG
Sbjct: 64  YWWEAGGAFGTLLDFWYFMDNDTYNDEILAAMVYQAGNDWDYIPLNQSTTEGNDDQAFWG 123

Query: 122 LTVMEAVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKN 181
           +  M A ERNFT+P   +P WL +AQAVFN +  RWD  SC GG+RWQIFTWNSGY+YKN
Sbjct: 124 IAAMTAAERNFTNPASDEPQWLYLAQAVFNTMALRWDTDSCGGGLRWQIFTWNSGYDYKN 183

Query: 182 TISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQ 241
           ++SNG  F LAARL RYT N +Y++ AEKV++W+ D GF+   +   V+DGA T+DNC+ 
Sbjct: 184 SVSNGALFHLAARLARYTGNDSYVDWAEKVYNWMEDTGFITTGNTLYVYDGASTEDNCSS 243

Query: 242 VTELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGD 301
           VT+ +WTYN G+IL G+AY+YN +  SS W  R    L+ +S  F  +++M E+ CQ   
Sbjct: 244 VTKYQWTYNQGLILSGAAYLYNYSE-SSLWYNRTMTALS-SSGVFLNNSIMCEAACQ--P 299

Query: 302 SSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLN 361
           +  C+ DQRSFK+ F+R LG+T+ LVPS   ++   +NASA   A+SCSGG DGHTCGLN
Sbjct: 300 AGTCDTDQRSFKAYFARFLGVTAQLVPSTRTQIMTWMNASAYAVAESCSGGTDGHTCGLN 359

Query: 362 WFKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQK 421
           WF GSWD  YGLGEQMSALEV+ NT   +   PY  + GGSS+GD AAG  TT TN+   
Sbjct: 360 WFLGSWDGYYGLGEQMSALEVLVNTRALDKPGPYNSTNGGSSQGDGAAGTETTATNLAPL 419

Query: 422 KLKIQSK 428
            +   SK
Sbjct: 420 NITGGSK 426

>CAGL0L01727g Chr12 complement(184249..185589) [1341 bp, 446 aa]
           {ON} highly similar to uniprot|P36091 Saccharomyces
           cerevisiae YKL046c
          Length = 446

 Score =  451 bits (1160), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 219/418 (52%), Positives = 288/418 (68%), Gaps = 5/418 (1%)

Query: 1   MLLHNILVWLVFSLSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPP 60
           M L  +L  LV SL  ++ ++L + D  S+ +ATAL+  G++DYY GD+YG  +GMF  P
Sbjct: 1   MRLVTLLSGLV-SLVSVFGLELDLDDYASLQNATALVAYGLMDYYTGDQYGKTVGMFSDP 59

Query: 61  YYWWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVW 120
           YYWWQAG A+G M+D W+F +N+T+ + I  A+L Q G + DY+P NQ+  EGNDDQ  W
Sbjct: 60  YYWWQAGGAWGCMLDYWYFMQNDTYNDKIMAALLHQTGDNNDYVPLNQSTTEGNDDQAFW 119

Query: 121 GLTVMEAVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYK 180
           G+ VM+A ER F +P D KP WL + QAVFN +  RWD ++C GG+RWQIF WNSGY+YK
Sbjct: 120 GIAVMQAAERKFPNPPDDKPQWLYLTQAVFNTMALRWDSETCGGGLRWQIFVWNSGYDYK 179

Query: 181 NTISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCT 240
           NT+SNG  F +AARL RYT NQ+Y++ AE+V+DW+ DV  +       V+DG   +DNCT
Sbjct: 180 NTVSNGALFHIAARLARYTGNQSYVDWAERVYDWMEDVHLIDNGTYRYVYDGVSINDNCT 239

Query: 241 QVTELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHG 300
            VT+ +WTYN G++L GSAY++N T GS  W ER +  LN AS  FF ++++YE+ CQ  
Sbjct: 240 TVTKYQWTYNQGLMLSGSAYLFNMT-GSDLWHERTHAFLN-ASRVFFNNSILYEAACQGP 297

Query: 301 DSSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGL 360
           ++  CN DQRSFK+ F+R LG T+ LVP    ++   LN SA  AAKSCSGG DGHTCGL
Sbjct: 298 NT--CNTDQRSFKAYFARFLGSTAELVPETRQQIMTWLNTSALAAAKSCSGGTDGHTCGL 355

Query: 361 NWFKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNV 418
           NWF+  WD  YGLGEQM+ALEV+ NT      PPY  + GG+S GD AAG     TN+
Sbjct: 356 NWFRDDWDGMYGLGEQMAALEVMVNTQALKRAPPYNATNGGNSTGDGAAGTKPHPTNL 413

>NCAS0H02900 Chr8 (566940..568301) [1362 bp, 453 aa] {ON} Anc_2.570
          Length = 453

 Score =  449 bits (1155), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 221/458 (48%), Positives = 296/458 (64%), Gaps = 11/458 (2%)

Query: 1   MLLHNILVWLVFSLSPIW-----AVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIG 55
           ++  +I  +L+ SL+ I      A+ L + D +S+ +AT+L+  G++DYY G++YG  +G
Sbjct: 2   LVSKSISTFLLLSLASILPSQVSALTLDLNDTESLQNATSLVAYGLMDYYTGNQYGKTVG 61

Query: 56  MFQPPYYWWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGND 115
           MF  PYYWWQAG A+G M+D W++  N+T+ + I  A+L Q G   DY+P NQ+  EGND
Sbjct: 62  MFSDPYYWWQAGGAWGSMLDYWYYMNNDTYNDDIMAALLHQTGDDNDYVPLNQSTTEGND 121

Query: 116 DQGVWGLTVMEAVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNS 175
           DQ  WG+ VM A ERNFT+P + +P WL +AQAVFN +  RWD  +C GG+RWQIF WNS
Sbjct: 122 DQAFWGIAVMTAAERNFTNPPEDQPQWLYLAQAVFNTMAMRWDSDTCGGGLRWQIFIWNS 181

Query: 176 GYNYKNTISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVT 235
           GY+YKNT+SNG  F +A+RL RYT NQ+Y++ AEKV+DW+ DV  +       V+DG   
Sbjct: 182 GYDYKNTVSNGALFHIASRLARYTGNQSYVDWAEKVYDWMYDVHLISNGSYMYVYDGVNI 241

Query: 236 DDNCTQVTELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYES 295
            DNCT VT  +WTYN G++L G AY+YN T G   W  R   +L  A+  FF ++++YE+
Sbjct: 242 GDNCTTVTPYQWTYNQGLLLSGCAYLYNFT-GEELWHNRTKNLLT-AAGVFFNNSILYEA 299

Query: 296 GCQHGDSSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDG 355
            CQ  ++  CN DQRSFK+ FSR LG T+ LVP   +++   +N SA  AA+SCSGG DG
Sbjct: 300 ACQGHNT--CNTDQRSFKAYFSRFLGTTAQLVPETRNQIMHWINTSAVAAAQSCSGGTDG 357

Query: 356 HTCGLNWFKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTT 415
           HTCG+NWF   WD  YGLGEQM+ALE++ NT   +   PY  S GGSS GD AAG     
Sbjct: 358 HTCGINWFADGWDGMYGLGEQMAALEIMVNTKALSKAAPYTSSNGGSSVGDGAAGTEPHP 417

Query: 416 TNVLQKKLKIQSKDRAGAAIITXXXXXXXXXXXXWMLF 453
           TN+    L I    RAGA IIT            W++F
Sbjct: 418 TNL--APLHITKGSRAGAGIITAVIGISIVTCALWLVF 453

>NDAI0B01510 Chr2 complement(354643..355986) [1344 bp, 447 aa] {ON}
           Anc_2.570
          Length = 447

 Score =  448 bits (1153), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 220/451 (48%), Positives = 292/451 (64%), Gaps = 7/451 (1%)

Query: 3   LHNILVWLVFSLSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYY 62
           + NIL  L F+     A+ L + +  S+ + TAL+  G++DYY GD+YG  +GMF  PYY
Sbjct: 4   VFNILFLLTFTHRAN-ALSLDLNNYQSLENDTALVAYGLMDYYNGDQYGQTVGMFSNPYY 62

Query: 63  WWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGL 122
           WW+AG A+G M+D W F +N+T+ +LI  A+L Q G + DY+P NQ+  EGNDDQ  WG+
Sbjct: 63  WWEAGGAWGTMLDYWFFMENDTYNDLIMSALLHQTGENNDYIPLNQSTTEGNDDQAFWGI 122

Query: 123 TVMEAVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKNT 182
             M A ERNFT+P +  P WL +AQAVFN +  RWD ++C GG+RWQIF WNSGY+YKN+
Sbjct: 123 AAMTAAERNFTNPPESSPQWLYLAQAVFNTMALRWDAQNCGGGLRWQIFVWNSGYDYKNS 182

Query: 183 ISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQV 242
           +SNG  F LAARL RYT NQ+Y++ AEK +DW++DVG +    +  V+DG   + NCT +
Sbjct: 183 VSNGALFHLAARLARYTGNQSYVDWAEKTYDWMSDVGLISNGTQKYVYDGTSIETNCTTI 242

Query: 243 TELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGDS 302
           T  +W+YN G++L G+AY+YN T GS+ W  R   +L+ A+  FF +++MYE  CQ   +
Sbjct: 243 TSYQWSYNQGLMLAGAAYLYNFT-GSTIWLNRTMDLLD-ATSVFFNNSIMYEVACQ--PT 298

Query: 303 SNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLNW 362
             CNNDQRSFKS  +R LGLT+ LV     ++   LN SA   A SCSGG DGHTCGLNW
Sbjct: 299 GTCNNDQRSFKSYLARFLGLTAQLVTITQSRIMNWLNTSAIAVAHSCSGGTDGHTCGLNW 358

Query: 363 FKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQKK 422
           F   WD  YGLGEQMSAL+V+ NT + +   PY  + GGSS GD AAG   T TN+    
Sbjct: 359 FDNGWDGYYGLGEQMSALDVLVNTRVLDRPAPYNSTNGGSSIGDGAAGTEATPTNL--AP 416

Query: 423 LKIQSKDRAGAAIITXXXXXXXXXXXXWMLF 453
           L I    + GAA IT            W++ 
Sbjct: 417 LHITKGSKVGAAFITAAIGLSIVFTSIWIIL 447

>TDEL0B06580 Chr2 (1164804..1166147) [1344 bp, 447 aa] {ON}
           Anc_2.570 YKL046C
          Length = 447

 Score =  448 bits (1152), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 219/453 (48%), Positives = 295/453 (65%), Gaps = 6/453 (1%)

Query: 1   MLLHNILVWLVFSLSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPP 60
           M +  +L  L  + +   AV + + + +S+ +A++L+  G++DYY G +YG  IGMF  P
Sbjct: 1   MFVMRLLAALASTFACANAVWIDLNNTESIHNASSLVAVGLMDYYTGLQYGETIGMFSDP 60

Query: 61  YYWWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVW 120
           YYWW+AG A+G M+D W + +N+T+ ++I +A+L Q G H DY+P NQ+  EGNDDQ  W
Sbjct: 61  YYWWEAGGAWGCMLDYWWYMQNDTYNDIIMQALLYQVGTHNDYVPLNQSTTEGNDDQAFW 120

Query: 121 GLTVMEAVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYK 180
           G+  M A ERNFT+P   +P WL +AQAVFN +  RWD  SC GG+RWQIF WN+GY+YK
Sbjct: 121 GIAAMTAAERNFTNPPSDQPQWLYLAQAVFNTMALRWDTTSCNGGLRWQIFMWNTGYDYK 180

Query: 181 NTISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCT 240
           NT+SNG  F LAARL RYT NQ+Y++ A+KV+DW+  VG +   +   V+DG     NC 
Sbjct: 181 NTVSNGALFNLAARLARYTGNQSYVDWADKVYDWMYGVGLISNGNSRFVYDGVNIAHNCA 240

Query: 241 QVTELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHG 300
            +T  +W+YNHG++L G AY+YN T    KW  R  + LN AS  F+ ++V+YE  CQ  
Sbjct: 241 NITGYQWSYNHGLMLSGCAYLYNMTK-DEKWGNRTFEYLNSAS-IFYNNSVLYEVACQ-- 296

Query: 301 DSSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGL 360
             + CN DQRSFK+ F+R LG+T+ L+P   D+  + +NASA GAA+SCSGG DGHTCG+
Sbjct: 297 TVNKCNTDQRSFKAYFTRFLGVTAELIPQARDQAMKWINASALGAAQSCSGGYDGHTCGI 356

Query: 361 NWFKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQ 420
           NWF   WD  YGLGEQMSALE + NT   N  PPY  + GGSS GD AAG   + TN+  
Sbjct: 357 NWFYDGWDGMYGLGEQMSALEALVNTQALNRPPPYNSTNGGSSTGDGAAGTEESPTNL-- 414

Query: 421 KKLKIQSKDRAGAAIITXXXXXXXXXXXXWMLF 453
             L I +  RAGA IIT            W++ 
Sbjct: 415 SPLDITAGSRAGAGIITCVIGISILSCALWLIL 447

>TBLA0H02590 Chr8 complement(612543..613895) [1353 bp, 450 aa] {ON} 
          Length = 450

 Score =  447 bits (1149), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 222/454 (48%), Positives = 298/454 (65%), Gaps = 12/454 (2%)

Query: 3   LHNILVWLVFSLSPIW--AVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPP 60
           +H++L     SL P++  A+ + + D  S+ +AT+LI  GM+DYY G  YG  IGMF  P
Sbjct: 4   IHSLL--FQISLLPLFTNALKIDLDDFSSLQNATSLIAYGMMDYYNGHDYGQVIGMFAKP 61

Query: 61  YYWWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVW 120
           YYWW+AG A+G ++D W++ +N+T+ +LI EA+L Q G   DY+P NQ+  EGNDDQ  W
Sbjct: 62  YYWWEAGGAWGCLLDYWYYMQNDTYNDLITEALLYQTGDRNDYVPLNQSTTEGNDDQAFW 121

Query: 121 GLTVMEAVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYK 180
           G+  + A ERNFT+P   KP WL +AQAVFN +  RWDD +C GG+RWQIF WNSGY+YK
Sbjct: 122 GIAAITAAERNFTNPPPDKPQWLYLAQAVFNTMALRWDDSTCNGGLRWQIFVWNSGYSYK 181

Query: 181 NTISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVV--LKDKGNVFDGAVTDDN 238
           N++SNG  F +AARL RYT NQ+Y+E A+K++DW+   G +    +    V+DGA  + N
Sbjct: 182 NSVSNGALFHIAARLARYTGNQSYVEWADKIYDWMFGTGIISDEYETYKFVYDGANIETN 241

Query: 239 CTQVTELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQ 298
           CT +T  +WTYN G++L G AY+YN T    KW  R  Q LNG S  FF+DNV+YE+ CQ
Sbjct: 242 CTDITRYQWTYNQGLVLAGCAYLYNHTQ-DEKWLIRTEQFLNG-SVVFFRDNVIYEAACQ 299

Query: 299 HGDSSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTC 358
              + NCNNDQRSFK+ F+R LG+T+ L+PS  D + + +N SA  AA++CSGG DGHTC
Sbjct: 300 --PNKNCNNDQRSFKAYFARFLGVTAQLIPSTRDTIMRWINTSAYAAAQACSGGTDGHTC 357

Query: 359 GLNWFKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNV 418
           G++W    WD  YGLGEQM+ALE + NT   +  PPY    GGSS G  AAG     TN+
Sbjct: 358 GMDWVWKGWDGYYGLGEQMAALEFMVNTRALDMPPPYTSFNGGSSTGSGAAGTERDPTNL 417

Query: 419 LQKKLKIQSKDRAGAAIITXXXXXXXXXXXXWML 452
               L I +  +AGA+IIT            W++
Sbjct: 418 --SPLHITAGSKAGASIITCIVSISILTGAMWLV 449

>TBLA0H02580 Chr8 complement(610287..611636) [1350 bp, 449 aa] {ON} 
          Length = 449

 Score =  444 bits (1141), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 222/439 (50%), Positives = 290/439 (66%), Gaps = 14/439 (3%)

Query: 7   LVWLVFSLSPI-------WAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQP 59
           +VWL + +  I        AV L +    S+ +A +L+  G++DYY GD+YG  IGMF  
Sbjct: 1   MVWLRYLIIQISILASFSTAVHLNLNVTSSLQNAASLVAVGLMDYYNGDQYGQTIGMFSN 60

Query: 60  PYYWWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGV 119
           PYYWW+AG A+G MID W+F +N+T+ ++I +A+L Q G   DY+P NQ+  EGNDDQ  
Sbjct: 61  PYYWWEAGGAWGCMIDYWYFMQNDTYNDIISQALLYQTGDRNDYIPLNQSTTEGNDDQAF 120

Query: 120 WGLTVMEAVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNY 179
           WG+TVM A ERNFT+P   KP WL +AQAVFN +  RWDD +C GG+RWQIF WNSGY+Y
Sbjct: 121 WGITVMSAAERNFTNPPPDKPQWLYLAQAVFNTMALRWDDSTCNGGLRWQIFVWNSGYSY 180

Query: 180 KNTISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGN-VFDGAVTDDN 238
           KN++SNG  F +AARL RYT NQ+Y++ A KV+DW+   G +        V+DGA  + N
Sbjct: 181 KNSVSNGALFHMAARLARYTGNQSYVDWAVKVYDWMEKTGLISNDTYFKFVYDGASIETN 240

Query: 239 CTQVTELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQ 298
           CT +T+ +WTYN G+IL G AY+YN T   SKW  R  Q +NG S  FF ++++YE+ CQ
Sbjct: 241 CTDITQFQWTYNQGLILSGCAYLYNHTE-DSKWLTRTEQFVNG-SAVFFNNSIVYEAACQ 298

Query: 299 HGDSSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTC 358
              S  C+NDQRSF++ F+R LG+T+ LVP+  D +   +N SA  AA++CSGG DGHTC
Sbjct: 299 --GSKRCDNDQRSFRAYFARFLGVTAQLVPTTKDIIMDWINTSAYAAAQACSGGTDGHTC 356

Query: 359 GLNWFKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNV 418
           GLNWF   WD  YGLGEQM ALE + NT   +   PY  S GGSS G+ AAG     TN+
Sbjct: 357 GLNWFNIGWDGYYGLGEQMGALEFLVNTRALDMPAPYTSSNGGSSTGNGAAGTEKPPTNL 416

Query: 419 LQKKLKIQSKDRAGAAIIT 437
               L I    +AGA IIT
Sbjct: 417 --GPLHITDGSKAGAGIIT 433

>Kpol_1056.4 s1056 complement(6537..7889) [1353 bp, 450 aa] {ON}
           complement(6537..7889) [1353 nt, 451 aa]
          Length = 450

 Score =  442 bits (1138), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 223/436 (51%), Positives = 289/436 (66%), Gaps = 15/436 (3%)

Query: 1   MLLHNILVWLVFSLSPIW-----AVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIG 55
           ML H +L+ L   L  +W     AV+L + + DS+ +AT+L+  G++DYY G +YG  IG
Sbjct: 1   MLFHKVLISL---LCTVWFRAGHAVELDLNNLDSLRNATSLVAYGLMDYYNGLQYGQTIG 57

Query: 56  MFQPPYYWWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGND 115
           MF  PYYWW+AG A+G MID W++ +N+T+ ++I +A+  Q G + DY+P NQ+  EGND
Sbjct: 58  MFSNPYYWWEAGGAWGTMIDYWYYMQNDTYNDIIMQALQYQTGVNNDYVPLNQSTTEGND 117

Query: 116 DQGVWGLTVMEAVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNS 175
           DQ  WG+ VM A ERNFT+P   +P WL +AQAVFN +  RWDD++C GG+RWQIF WNS
Sbjct: 118 DQAFWGIAVMSAAERNFTNPPADRPQWLYLAQAVFNTMALRWDDQTCNGGLRWQIFVWNS 177

Query: 176 GYNYKNTISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGN-VFDGAV 234
           GY+YKN++SNG  F + ARL R+T N +Y+E AEKV+DW+  V  +    KG  V+DG  
Sbjct: 178 GYDYKNSVSNGALFHIGARLARFTGNDSYVEWAEKVYDWMESVNLIEDDGKGAFVYDGVN 237

Query: 235 TDDNCTQVTELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYE 294
             DNCT+VT L+WTYNHG+IL G AY+YN T G +KW  R  + L  A   FF   VM+E
Sbjct: 238 IGDNCTKVTNLQWTYNHGLILSGCAYLYNYT-GDAKWYNRTERFLEYAY-VFFNRTVMFE 295

Query: 295 SGCQHGDSSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGID 354
           + CQ      C  DQR+FK+ FSR LG+T+ LVP     +   +NASA GAA+SCSGG D
Sbjct: 296 AACQ--GVHTCTTDQRTFKAYFSRFLGMTAQLVPDTQHTIMTYMNASAYGAAQSCSGGYD 353

Query: 355 GHTCGLNWFKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTT 414
           GHTCG+NWF G WD  YGLGEQM ALEV+ NT   +   PY  + GGSS GD AAG    
Sbjct: 354 GHTCGINWFYGGWDGYYGLGEQMCALEVMINTRALHVPGPYNSTNGGSSTGDGAAGTEQH 413

Query: 415 TTNVLQKKLKIQSKDR 430
            TN+    L I S  R
Sbjct: 414 PTNL--SPLNITSGSR 427

>KNAG0A07180 Chr1 (1127961..1129352) [1392 bp, 463 aa] {ON} 
          Length = 463

 Score =  439 bits (1128), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 212/405 (52%), Positives = 277/405 (68%), Gaps = 4/405 (0%)

Query: 5   NILVWLVFSLSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYYWW 64
           ++L+ L   +S + A+D+ + + DS+ +AT+LI  G++DYY G++YG  +GMF  PYYWW
Sbjct: 14  SVLLALSAVVSKVAALDIDLDNLDSIRNATSLIAYGLMDYYTGEQYGKTVGMFADPYYWW 73

Query: 65  QAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGLTV 124
           +AG A+G M+D   F  N+T++  I  AML Q G H +Y+P NQ+  EGNDDQ  WG+  
Sbjct: 74  EAGGAWGSMLDYSWFMDNDTYDSQIMSAMLHQTGEHNNYIPLNQSTTEGNDDQAFWGIAA 133

Query: 125 MEAVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKNTIS 184
           M A ERNFT+P + KP WL +AQAVFN +  RWD +SC GG+RWQIF WNSGY+YKNT+S
Sbjct: 134 MTAAERNFTNPPEDKPQWLYLAQAVFNTMALRWDTESCGGGLRWQIFNWNSGYDYKNTVS 193

Query: 185 NGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQVTE 244
           NG  F +A+RL RYT NQ+Y++ AEKV+DW+ DV  +       V+DG   +DNC+ VT+
Sbjct: 194 NGALFHMASRLARYTGNQSYVDWAEKVYDWMWDVHVISNSTYMFVYDGVDANDNCSTVTQ 253

Query: 245 LEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDN-VMYESGCQHGDSS 303
            +WTYNHG++L GSAY+YN T G   W  R  +++  A  +F     +MYE+ CQ   + 
Sbjct: 254 YQWTYNHGLLLAGSAYLYNFT-GDEVWHNRTKKLVTAAQVFFNSTTGIMYEAACQ--AAL 310

Query: 304 NCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLNWF 363
            CNNDQRSFK+ FSR LGLT+ LVP    ++   LN SA  A KSCSGG DGHTCGLNWF
Sbjct: 311 TCNNDQRSFKAYFSRFLGLTAQLVPETRTQIMGWLNTSAVAAGKSCSGGYDGHTCGLNWF 370

Query: 364 KGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSA 408
           K  WD  YGLGEQMSALE I NT       PY  + GGSSKG+S+
Sbjct: 371 KDGWDGMYGLGEQMSALECILNTRALMKPAPYTATNGGSSKGESS 415

>ABR060W Chr2 (504045..505400) [1356 bp, 451 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL046C
          Length = 451

 Score =  426 bits (1096), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 211/436 (48%), Positives = 285/436 (65%), Gaps = 8/436 (1%)

Query: 20  VDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYYWWQAGEAFGGMIDNWHF 79
           ++L V D  S+  AT+L+  G++DYY G  YG  +G F  PYYWW+AG A+G ++D W++
Sbjct: 22  LNLDVDDLQSIREATSLLATGLMDYYHGHDYGETVGKFSDPYYWWEAGGAWGSILDYWYY 81

Query: 80  CKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGLTVMEAVERNFTDPGDGK 139
            +N+T+ +L+ +++L QAG    Y P N+T  EGNDDQ  WG+ VM+A ER   +P   +
Sbjct: 82  MENSTYNDLLTDSLLHQAGEDLSYTPWNETTTEGNDDQFFWGMAVMDAAERKNPNPPADQ 141

Query: 140 PGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKNTISNGCYFQLAARLGRYT 199
           P  LA+AQAVFN +  RWD ++C GG+RWQIF WN GY+YKN++SNG  F +AARL RYT
Sbjct: 142 PQRLALAQAVFNTMALRWDMETCNGGLRWQIFRWNDGYHYKNSVSNGALFHMAARLTRYT 201

Query: 200 NNQTYLEVAEKVFDWLTDVGF--VVLKDKGNVFDGAVTDDNCTQVTELEWTYNHGIILGG 257
            N TYLE AE+V+DW+  VG   +V  +   V+DG   +DNCT + +L+WTYNHG+I+ G
Sbjct: 202 GNATYLEWAERVYDWMYGVGLISIVQPNWHVVYDGTDINDNCTNLNKLQWTYNHGLIMAG 261

Query: 258 SAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGDSSNCNNDQRSFKSIFS 317
            A++YN T     W +R  + L+ A   F  ++ +YE+GCQ GD  NCN DQRSFK+ FS
Sbjct: 262 CAFIYNHTQ-DELWHQRTLRFLDSAR-IFLSNDTLYEAGCQGGD--NCNIDQRSFKAYFS 317

Query: 318 RMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLNWFKGSWDNQYGLGEQM 377
           R LGLT+ LVP   + + + + ASA+GAA SCSGG DGHTCGLNW    WD ++GLGEQM
Sbjct: 318 RFLGLTAQLVPESRETIVRWIRASAQGAAASCSGGRDGHTCGLNWLINGWDGKWGLGEQM 377

Query: 378 SALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQKKLKIQSKDRAGAAIIT 437
           +ALE+IQN        PY    GG+S GD AAG  T   N+    L I++ DRAGA IIT
Sbjct: 378 AALEIIQNLRCLERPAPYTAMNGGTSPGDPAAGTKTKAENL--PPLDIKAGDRAGAGIIT 435

Query: 438 XXXXXXXXXXXXWMLF 453
                       W++ 
Sbjct: 436 ALIGSSFLACTLWLII 451

>Ecym_4577 Chr4 complement(1128622..1129974) [1353 bp, 450 aa] {ON}
           similar to Ashbya gossypii ABR060W
          Length = 450

 Score =  422 bits (1085), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 215/452 (47%), Positives = 290/452 (64%), Gaps = 13/452 (2%)

Query: 8   VWLVFSL------SPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPY 61
           VW++  +      + + A++L V D  S+ SAT+LI  G+LDYY G   G  IGMF  PY
Sbjct: 4   VWVILGVFLNLLGTDVSALELDVDDFSSMQSATSLISTGVLDYYTGLDPGNTIGMFSSPY 63

Query: 62  YWWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWG 121
           YWW+AG A+G +ID W + +N+T+ ++I++A+L Q G + DY+P NQ+  EGNDDQ  WG
Sbjct: 64  YWWEAGAAWGALIDYWFYMENDTYNDIIKQALLYQVGKYEDYVPLNQSTTEGNDDQAFWG 123

Query: 122 LTVMEAVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKN 181
           + VM A E+ F +P   +P WLA+AQAVFN +  RWD  SC GG+RWQIFTWN+GY+YKN
Sbjct: 124 IAVMSAAEKGFPNPDPDQPQWLALAQAVFNTMAYRWDSSSCNGGLRWQIFTWNTGYDYKN 183

Query: 182 TISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFV-VLKDKGNVFDGAVTDDNCT 240
           ++SNG  F LAARL RYT NQ+Y + AEKV+DW+  V  +    D   V+DGA   DNC+
Sbjct: 184 SVSNGALFHLAARLARYTGNQSYADWAEKVYDWMASVQLINQTGDWTFVYDGAFIHDNCS 243

Query: 241 QVTELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHG 300
           + + L+W+YNHG+ILGG AY+ + T GS  W  R  ++L  AS  FF + V+ E  CQ  
Sbjct: 244 RPSVLQWSYNHGLILGGCAYLTDFT-GSDVWHNRTLRLLRSAS-IFFPNGVVTEVACQ-- 299

Query: 301 DSSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGL 360
           ++  CN DQRSFK+ F R LGLT+ L+P   +   + +  SA+GAA SCSGG DGHTCG+
Sbjct: 300 EAGTCNTDQRSFKAYFMRFLGLTAQLIPESREIAMKWIRDSAKGAALSCSGGRDGHTCGM 359

Query: 361 NWFKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQ 420
           N+ +GS+D  YGLGEQ++ALE IQN        P   S GG+S G+  AG N     +  
Sbjct: 360 NYSRGSYDESYGLGEQLAALETIQNLRCLEKGSPLTASEGGTSIGNPGAGGNRNLGTL-- 417

Query: 421 KKLKIQSKDRAGAAIITXXXXXXXXXXXXWML 452
             L I + DRAGA IIT            W++
Sbjct: 418 SPLDISNADRAGAGIITALVGFSLISCIVWLV 449

>ZYRO0E06380g Chr5 (484736..486097) [1362 bp, 453 aa] {ON} similar
           to uniprot|P36091 Saccharomyces cerevisiae YKL046C DCW1
           Mannosidase GPI-anchored membrane protein required for
           cell wall biosynthesis homologous to Dfg5p
          Length = 453

 Score =  418 bits (1075), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 205/437 (46%), Positives = 287/437 (65%), Gaps = 8/437 (1%)

Query: 19  AVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYYWWQAGEAFGGMIDNWH 78
           A+D+ + D  ++ +A+AL+ +G++DYY GD+YG  IGMF  PYYWW+AG A+  +ID W 
Sbjct: 21  ALDIDLNDFKTLQNASALVAKGLMDYYTGDQYGQTIGMFSWPYYWWEAGGAWNTLIDYWF 80

Query: 79  FCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGLTVMEAVERNFTDPGDG 138
           + KN+T+ + + EA+L Q+G ++DY+P NQ+ VEGNDDQ  WG+ V+ A ER F +P D 
Sbjct: 81  YMKNDTYNDKVTEALLYQSGDNHDYVPLNQSTVEGNDDQAFWGIAVLNAAERKFPNPPDD 140

Query: 139 KPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKNTISNGCYFQLAARLGRY 198
           +P WL + QAVFN +  RWD  +C GG+RWQIFTWN+GY+YKNT+SNG  F +AARL  +
Sbjct: 141 QPQWLYLGQAVFNTMALRWDTATCGGGLRWQIFTWNTGYDYKNTVSNGALFHIAARLAYF 200

Query: 199 TNNQTYLEVAEKVFDWLTDVGFVVLKDKGN--VFDGAVTDDNCT-QVTELEWTYNHGIIL 255
           T N +Y++ AE+V+DW+ DV  +  ++  N  V+DG    +NC+  VT + WTYNHG++L
Sbjct: 201 TGNSSYVDWAERVYDWMHDVKLIEPENDDNKYVYDGVDVSNNCSGPVTRIVWTYNHGLVL 260

Query: 256 GGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGDSSNCNNDQRSFKSI 315
            G AY+Y  T G   W  R    L  A+  F+ D+++YE  CQ   S  CN DQRSFKS 
Sbjct: 261 SGCAYLYKET-GDKIWYNRSKAFLETAAKLFYNDSILYEYSCQQ--SKTCNVDQRSFKSY 317

Query: 316 FSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLNWFKGSWDNQYGLGE 375
           +S  L  T+ L+P   +++ +++NA+A  AA++C GG DGHTCG+NW +  WD QYGLGE
Sbjct: 318 YSTFLAATAQLIPDFREQIMKVVNATAYAAAQACVGGYDGHTCGINWNQKGWDGQYGLGE 377

Query: 376 QMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQKKLKIQSKDRAGAAI 435
           QM+ALE +  T   N   PY  + GG+S GD AAG  T  TN+  K L I +  RAGA I
Sbjct: 378 QMAALEALVVTQAMNKPAPYNSTNGGNSTGDGAAGTQTAPTNL--KPLHITAGSRAGAGI 435

Query: 436 ITXXXXXXXXXXXXWML 452
           IT            W++
Sbjct: 436 ITCVVGFSIIASFLWLV 452

>TBLA0H02600 Chr8 complement(614887..616236) [1350 bp, 449 aa] {ON}
           Anc_2.570 YKL046C
          Length = 449

 Score =  413 bits (1062), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 216/451 (47%), Positives = 291/451 (64%), Gaps = 7/451 (1%)

Query: 3   LHNILVWLVFSLSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYY 62
            H++L+ +    +   AV L + D  S+ +A AL+  G++DYY G++YG  IGMF  PYY
Sbjct: 4   FHSLLLKISVITTITNAVSLNLNDSSSLDNAAALVAYGLMDYYNGNQYGQTIGMFSDPYY 63

Query: 63  WWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGL 122
           WW+AG A+G M+D W++ +N+T+ ++I EA+  Q G   DY+P NQ+  EGNDDQ  WG+
Sbjct: 64  WWEAGGAWGCMLDYWYYMQNDTYNDVIYEALQYQTGDDNDYIPLNQSTTEGNDDQAFWGI 123

Query: 123 TVMEAVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKNT 182
             + A ERNFT+P   KP WL +AQAVFN +  RWD  +C GG+RWQIF WNSGY+YKN+
Sbjct: 124 AAITAAERNFTNPPPDKPQWLYLAQAVFNTMALRWDSDTCNGGLRWQIFVWNSGYSYKNS 183

Query: 183 ISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGN-VFDGAVTDDNCTQ 241
           +SNG  F +AARL RYT NQ+Y++ +EKV+DW+   G +        V DG   + NCT 
Sbjct: 184 VSNGALFHIAARLARYTGNQSYVDWSEKVYDWMLGTGLISNGTTYKFVHDGVNIETNCTD 243

Query: 242 VTELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGD 301
           +T  +WTYN G++L G AY+YN T    KW  R NQ LNG S  FF ++V+YE+ CQ   
Sbjct: 244 ITPYQWTYNQGLLLAGCAYLYNFTQ-DEKWLIRTNQFLNG-SGVFFNNSVIYEAACQ--P 299

Query: 302 SSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLN 361
           + NCNNDQRSFK+ F+R LG+T+ L+PS  D + Q ++ SA  AA++CSGG DGHTCG++
Sbjct: 300 NKNCNNDQRSFKAYFARFLGVTAQLLPSTRDTIMQWIDTSAYAAAQACSGGTDGHTCGMD 359

Query: 362 WFKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQK 421
           W    WD  YGLGEQM+ALE + NT   +  PPY  S GGSS G  AAG     TN+   
Sbjct: 360 WNWNGWDGYYGLGEQMAALEFMVNTRALDLPPPYTSSNGGSSTGSGAAGTEQKPTNL--G 417

Query: 422 KLKIQSKDRAGAAIITXXXXXXXXXXXXWML 452
            L I +  +AGA IIT            W++
Sbjct: 418 PLNITAGSKAGAGIITCVVGISILACSMWLV 448

>Suva_10.206 Chr10 (385842..388430) [2589 bp, 862 aa] {ON} YLR115W
           (REAL)
          Length = 862

 Score = 35.4 bits (80), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 60/153 (39%), Gaps = 29/153 (18%)

Query: 192 AARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQVTELEWTYNH 251
           A  +G Y  N+  LE  EK FD +  + +  L D  + FDG                YN 
Sbjct: 108 AGVIGPYDTNKLDLEDIEKSFDHIVPLKYSQLVDLRSRFDGLTL-----------LAYNA 156

Query: 252 GIILGGSAYMYNATNG----SSKWEERVNQILNGAS---------DYFFQDNVMYESGCQ 298
           G+  GGS +  +  +     + +W    + ILN AS             + + +  +  +
Sbjct: 157 GVCPGGSIWCISTYSEKLIYAKRWNHTRDNILNAASILDATGKPLSTLMRPSAIITTLDK 216

Query: 299 HGDSSNCNNDQRSFKSIFSRMLGLT---SVLVP 328
            G S       ++FK    +  GLT   SV++P
Sbjct: 217 FGSSQPFKRRSKTFKDTLRK--GLTSDGSVIIP 247

>AGL182C Chr7 complement(354640..357051) [2412 bp, 803 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR115W
           (CFT2)
          Length = 803

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 66/177 (37%), Gaps = 26/177 (14%)

Query: 167 RWQIFTWNSGYNYKNTISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDK 226
           R Q+++     N     +   Y  L   +G +  N+  +E  +  FD L  V +  L D 
Sbjct: 83  RIQVYSTLPVANLGRVATVDLYASLGI-IGPFDTNRIDIEDIDTAFDHLNTVKYSQLVDL 141

Query: 227 GNVFDGAVTDDNCTQVTELEWTYNHGIILGGSAYMYNATNG----SSKWEERVNQILNGA 282
            + FDG                Y+ G   GG+ +  N  +     + +W    + ILN A
Sbjct: 142 KSRFDGLSL-----------VAYSSGFAPGGTIWCANTYSEKVLYAPRWNHTRDTILNSA 190

Query: 283 ---------SDYFFQDNVMYESGCQHGDSSNCNNDQRSFKSIFSRMLGL-TSVLVPS 329
                    S    + + +  S    G S+      + FK +  + L   TSV++PS
Sbjct: 191 DLLDKGGKPSTALMRPSAVIMSAAHVGPSTPYRKRSQKFKEVIKKALSANTSVILPS 247

>SAKL0F14058g Chr6 (1117019..1120453) [3435 bp, 1144 aa] {ON}
           similar to uniprot|Q755W9 Ashbya gossypii AER399C
           AER399Cp and some similarites with YJR089W
           uniprot|P47134 Saccharomyces cerevisiae YJR089W BIR1
           Protein involved in cell cycle regulation and chromosome
           segregation contains BIR (Baculovirus Inhibitor of
           apoptosis Repeat) domain
          Length = 1144

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 73/197 (37%), Gaps = 38/197 (19%)

Query: 169 QIFTWNSGYNYKN---TISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKD 225
           Q+     G   KN   T S+  +  LAA      N Q      E+    +    +   K 
Sbjct: 617 QLSIRKRGRPRKNDSTTDSDPMFKPLAAEPEDLKNKQAIQNGTEEEHHPVDTKAYYSPKK 676

Query: 226 KGNVFDGAV-----TDDNCTQVTELEWT-YNHGIILGGSAYMYNATNGSSKWEERVNQIL 279
           K  +   +       DD   Q TE + T  N  I+L       N T G+SK E++ N IL
Sbjct: 677 KRRLKKASTQPLLEADDESKQTTENDETGSNKSIVLN----FKNNTLGTSKSEKK-NAIL 731

Query: 280 -----------NGASDYFFQDNVMYESGCQHGDSSNCNNDQRSFKSIFSRMLGLTS-VLV 327
                      NG SD+   +N        H DS+             S   GL + +++
Sbjct: 732 DDSFDAFSFSNNGNSDFIIPENAFLSPSKSHNDSAG------------SEAGGLVNKIVL 779

Query: 328 PSVSDKVDQLLNASAEG 344
           PSVS+ V +  N S  G
Sbjct: 780 PSVSENVHETENVSNSG 796

>TPHA0C00920 Chr3 complement(192829..195297) [2469 bp, 822 aa] {ON}
           Anc_8.308 YLR115W
          Length = 822

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 43/92 (46%), Gaps = 15/92 (16%)

Query: 196 GRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQVTELEWTYNHGIIL 255
           G Y +N+  LE  EK FD +  + +  L D  + FDG       T V      +N G+ +
Sbjct: 112 GPYDSNEIDLEDIEKAFDMIQTIKYSQLVDLKSKFDG------LTFV-----AHNSGVNV 160

Query: 256 GGSAY-MYNATNG---SSKWEERVNQILNGAS 283
           GGS + +   T     + KW    + IL+GAS
Sbjct: 161 GGSIFCLMTYTEKLIYAPKWNHTRDMILSGAS 192

>Skud_12.187 Chr12 (360900..363485) [2586 bp, 861 aa] {ON} YLR115W
           (REAL)
          Length = 861

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 60/153 (39%), Gaps = 29/153 (18%)

Query: 192 AARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQVTELEWTYNH 251
           A  +G Y  N+  LE  +K FD +  + +  L D  + +DG                YN 
Sbjct: 108 AGVIGPYDTNKLDLEDIDKSFDHIVPLKYSQLVDLRSRYDGLTL-----------LAYNA 156

Query: 252 GIILGGSAYMYNATNG----SSKWEERVNQILNGAS---------DYFFQDNVMYESGCQ 298
           G+  GGS +  +  +     + +W    + ILN AS             + + +  +  +
Sbjct: 157 GVCPGGSIWCISTYSEKLIYAKRWNHTRDNILNAASILDSAGKPLSTLMRPSAIITTLDK 216

Query: 299 HGDSSNCNNDQRSFKSIFSRMLGLT---SVLVP 328
            G S       +SFK    R  GL+   SV++P
Sbjct: 217 FGSSQPFKKRSKSFKDTLKR--GLSSDGSVIIP 247

>Skud_4.631 Chr4 (1128086..1129462) [1377 bp, 458 aa] {ON} YDR363W
           (REAL)
          Length = 458

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 43/109 (39%), Gaps = 18/109 (16%)

Query: 250 NHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGDSSNCNN-- 307
           NH   + G +   ++ N S          ++G SD FF +N   E    H D SN  N  
Sbjct: 3   NHAKGITGPSIKLDSDNTS----------ISGDSDDFFMENSFDEDEIDHSDESNRQNVI 52

Query: 308 DQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGH 356
                    SR L L S      SD+ D  +N  ++   +S S  +DG 
Sbjct: 53  VDSKVSVSSSRYLSLGS------SDEEDDDINQRSQSHNRSSSESLDGR 95

>Suva_10.86 Chr10 complement(171011..171517) [507 bp, 168 aa] {ON}
           YLR008C (REAL)
          Length = 168

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%)

Query: 344 GAAKSCSGGIDGHTCGLNWFKGSWDNQYGLGEQMSALEVIQNTL 387
           GA KS S G++G     ++ KG +D +    E +  L + +NTL
Sbjct: 81  GAYKSISKGLNGGKSATSFLKGGFDPKMNSKEALQILNLTENTL 124

>Smik_12.181 Chr12 (359296..361878) [2583 bp, 860 aa] {ON} YLR115W
           (REAL)
          Length = 860

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 40/96 (41%), Gaps = 15/96 (15%)

Query: 192 AARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQVTELEWTYNH 251
           A  +G Y  N+  LE  EK FD +  + +  L D  + +DG                YN 
Sbjct: 108 AGVIGPYDTNKLDLEDIEKSFDHIVPLKYSQLVDLRSRYDGLTL-----------LAYNA 156

Query: 252 GIILGGSAYMYNATNG----SSKWEERVNQILNGAS 283
           G+  GGS +  +  +     + +W    + ILN AS
Sbjct: 157 GVCPGGSIWCISTYSEKLVYAKRWNHTRDNILNAAS 192

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,157,636
Number of extensions: 2275324
Number of successful extensions: 5272
Number of sequences better than 10.0: 70
Number of HSP's gapped: 5251
Number of HSP's successfully gapped: 70
Length of query: 453
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 340
Effective length of database: 40,524,141
Effective search space: 13778207940
Effective search space used: 13778207940
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)