Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F11792g7.354ON51345422180.0
Kpol_530.277.354ON50843420600.0
SAKL0F11462g7.354ON49843420580.0
Suva_10.2937.354ON50543520580.0
TDEL0C019407.354ON51043420590.0
YLR197W (NOP56)7.354ON50443520570.0
Smik_12.2577.354ON50843520540.0
Skud_12.2627.354ON50543520510.0
KLTH0H01166g7.354ON50743420470.0
NDAI0A018807.354ON50343420460.0
TPHA0F030107.354ON50943420330.0
Kwal_56.246547.354ON50743420320.0
NCAS0A141707.354ON51043420320.0
CAGL0A04015g7.354ON50843120170.0
KAFR0L015107.354ON50043420120.0
TBLA0E020807.354ON51343420090.0
KLLA0D12254g7.354ON51343420090.0
KNAG0B025907.354ON49943420070.0
ACL144C7.354ON54943420100.0
Ecym_47197.354ON51343419800.0
ZYRO0F12518g8.787ON5194138371e-105
KNAG0J006508.787ON5244138361e-105
KLTH0H15334g8.787ON5114138351e-105
KNAG0G031908.787ON5234138311e-104
TDEL0B011108.787ON5044138191e-103
TBLA0B028308.787ON5174138191e-103
KAFR0B035408.787ON4994138171e-103
KAFR0D015808.787ON5014148171e-103
Smik_15.4918.787ON5164138121e-102
TPHA0I006508.787ON5404168141e-102
TPHA0G011608.787ON5144138121e-102
Skud_15.4788.787ON5124118111e-102
YOR310C (NOP58)8.787ON5114138111e-102
Suva_8.3618.787ON5054138101e-102
SAKL0B05874g8.787ON5134148101e-101
NDAI0E005508.787ON5234138101e-101
Kpol_1010.58.787ON5144138081e-101
NCAS0B008708.787ON5154138041e-100
KLLA0F08613g8.787ON5114137991e-100
Kwal_34.158948.787ON5124137771e-96
Ecym_14898.787ON5144137761e-96
AFR328C8.787ON5134137733e-96
CAGL0I09790g8.787ON5134137692e-95
KNAG0B011403.429ON4922091705e-12
TDEL0F031103.429ON4342401686e-12
ZYRO0C12386g3.429ON4442261571e-10
TPHA0D039303.429ON4712431544e-10
KAFR0K015303.429ON5061141535e-10
ADR032W3.429ON4392031491e-09
YGR091W (PRP31)3.429ON4942011482e-09
TBLA0C023203.429ON5112151464e-09
NDAI0G012903.429ON4961141421e-08
Kwal_23.39953.429ON4741511411e-08
Suva_7.3743.429ON5132011374e-08
Kpol_1018.1383.429ON4932401331e-07
Skud_7.3903.429ON4952211331e-07
Smik_6.1773.429ON4822091331e-07
NCAS0E011603.429ON4792581322e-07
Ecym_44493.429ON4621381312e-07
SAKL0F06050g3.429ON4732211214e-06
KLLA0D14883g3.429ON4672201171e-05
KLTH0F12034g3.429ON5242401081e-04
CAGL0G03025g3.429ON4791241082e-04
Kwal_33.149202.627ON65575714.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F11792g
         (513 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F11792g Chr6 complement(962314..963855) [1542 bp, 513 aa] {...   858   0.0  
Kpol_530.27 s530 (71285..72811) [1527 bp, 508 aa] {ON} (71285..7...   798   0.0  
SAKL0F11462g Chr6 complement(889390..890886) [1497 bp, 498 aa] {...   797   0.0  
Suva_10.293 Chr10 (518873..520390) [1518 bp, 505 aa] {ON} YLR197...   797   0.0  
TDEL0C01940 Chr3 (340658..342190) [1533 bp, 510 aa] {ON} Anc_7.3...   797   0.0  
YLR197W Chr12 (546097..547611) [1515 bp, 504 aa] {ON}  NOP56Esse...   796   0.0  
Smik_12.257 Chr12 (493092..494618) [1527 bp, 508 aa] {ON} YLR197...   795   0.0  
Skud_12.262 Chr12 (492745..494262) [1518 bp, 505 aa] {ON} YLR197...   794   0.0  
KLTH0H01166g Chr8 (116579..118102) [1524 bp, 507 aa] {ON} highly...   793   0.0  
NDAI0A01880 Chr1 (422978..424489) [1512 bp, 503 aa] {ON} Anc_7.354    792   0.0  
TPHA0F03010 Chr6 complement(658541..660070) [1530 bp, 509 aa] {O...   787   0.0  
Kwal_56.24654 s56 complement(1090443..1091966) [1524 bp, 507 aa]...   787   0.0  
NCAS0A14170 Chr1 complement(2783782..2785314) [1533 bp, 510 aa] ...   787   0.0  
CAGL0A04015g Chr1 complement(402070..403596) [1527 bp, 508 aa] {...   781   0.0  
KAFR0L01510 Chr12 complement(276894..278396) [1503 bp, 500 aa] {...   779   0.0  
TBLA0E02080 Chr5 complement(505617..507158) [1542 bp, 513 aa] {O...   778   0.0  
KLLA0D12254g Chr4 (1045077..1046618) [1542 bp, 513 aa] {ON} high...   778   0.0  
KNAG0B02590 Chr2 (503498..504997) [1500 bp, 499 aa] {ON} Anc_7.3...   777   0.0  
ACL144C Chr3 complement(94809..96458) [1650 bp, 549 aa] {ON} Syn...   778   0.0  
Ecym_4719 Chr4 (1410528..1412069) [1542 bp, 513 aa] {ON} similar...   767   0.0  
ZYRO0F12518g Chr6 complement(1017206..1018765) [1560 bp, 519 aa]...   327   e-105
KNAG0J00650 Chr10 (110685..112259) [1575 bp, 524 aa] {ON} Anc_8....   326   e-105
KLTH0H15334g Chr8 complement(1329504..1331039) [1536 bp, 511 aa]...   326   e-105
KNAG0G03190 Chr7 complement(687362..688933) [1572 bp, 523 aa] {O...   324   e-104
TDEL0B01110 Chr2 (204471..205985) [1515 bp, 504 aa] {ON} Anc_8.7...   320   e-103
TBLA0B02830 Chr2 (653081..654634) [1554 bp, 517 aa] {ON} Anc_8.7...   320   e-103
KAFR0B03540 Chr2 complement(735790..737289) [1500 bp, 499 aa] {O...   319   e-103
KAFR0D01580 Chr4 complement(313631..315136) [1506 bp, 501 aa] {O...   319   e-103
Smik_15.491 Chr15 complement(846605..848155) [1551 bp, 516 aa] {...   317   e-102
TPHA0I00650 Chr9 (135050..136672) [1623 bp, 540 aa] {ON} Anc_8.7...   318   e-102
TPHA0G01160 Chr7 (234712..236256) [1545 bp, 514 aa] {ON} Anc_8.7...   317   e-102
Skud_15.478 Chr15 complement(836937..837160,837194..838505) [153...   317   e-102
YOR310C Chr15 complement(896825..898360) [1536 bp, 511 aa] {ON} ...   317   e-102
Suva_8.361 Chr8 complement(637602..637804,637835..639149) [1518 ...   316   e-102
SAKL0B05874g Chr2 complement(499332..500873) [1542 bp, 513 aa] {...   316   e-101
NDAI0E00550 Chr5 (108986..110557) [1572 bp, 523 aa] {ON} Anc_8.787    316   e-101
Kpol_1010.5 s1010 (13325..14869) [1545 bp, 514 aa] {ON} (13325.....   315   e-101
NCAS0B00870 Chr2 complement(133660..135207) [1548 bp, 515 aa] {O...   314   e-100
KLLA0F08613g Chr6 complement(801623..803158) [1536 bp, 511 aa] {...   312   e-100
Kwal_34.15894 s34 (102368..103906) [1539 bp, 512 aa] {ON} YOR310...   303   1e-96
Ecym_1489 Chr1 complement(1006523..1008067) [1545 bp, 514 aa] {O...   303   1e-96
AFR328C Chr6 complement(1032025..1033566) [1542 bp, 513 aa] {ON}...   302   3e-96
CAGL0I09790g Chr9 complement(935016..936557) [1542 bp, 513 aa] {...   300   2e-95
KNAG0B01140 Chr2 complement(210529..212007) [1479 bp, 492 aa] {O...    70   5e-12
TDEL0F03110 Chr6 (568933..570237) [1305 bp, 434 aa] {ON} Anc_3.4...    69   6e-12
ZYRO0C12386g Chr3 (978158..979492) [1335 bp, 444 aa] {ON} simila...    65   1e-10
TPHA0D03930 Chr4 (823320..824735) [1416 bp, 471 aa] {ON} Anc_3.4...    64   4e-10
KAFR0K01530 Chr11 (319205..320725) [1521 bp, 506 aa] {ON} Anc_3....    64   5e-10
ADR032W Chr4 (763161..764480) [1320 bp, 439 aa] {ON} Syntenic ho...    62   1e-09
YGR091W Chr7 (666341..667825) [1485 bp, 494 aa] {ON}  PRP31Splic...    62   2e-09
TBLA0C02320 Chr3 complement(549057..550592) [1536 bp, 511 aa] {O...    61   4e-09
NDAI0G01290 Chr7 complement(284145..285635) [1491 bp, 496 aa] {O...    59   1e-08
Kwal_23.3995 s23 complement(517426..518850) [1425 bp, 474 aa] {O...    59   1e-08
Suva_7.374 Chr7 (641967..643508) [1542 bp, 513 aa] {ON} YGR091W ...    57   4e-08
Kpol_1018.138 s1018 complement(368322..369803) [1482 bp, 493 aa]...    56   1e-07
Skud_7.390 Chr7 (650643..652130) [1488 bp, 495 aa] {ON} YGR091W ...    56   1e-07
Smik_6.177 Chr6 (289760..291208) [1449 bp, 482 aa] {ON} YGR091W ...    56   1e-07
NCAS0E01160 Chr5 complement(219669..221108) [1440 bp, 479 aa] {O...    55   2e-07
Ecym_4449 Chr4 complement(919492..920880) [1389 bp, 462 aa] {ON}...    55   2e-07
SAKL0F06050g Chr6 (454404..455825) [1422 bp, 473 aa] {ON} simila...    51   4e-06
KLLA0D14883g Chr4 (1254381..1255784) [1404 bp, 467 aa] {ON} weak...    50   1e-05
KLTH0F12034g Chr6 complement(1015072..1016646) [1575 bp, 524 aa]...    46   1e-04
CAGL0G03025g Chr7 (280230..281669) [1440 bp, 479 aa] {ON} simila...    46   2e-04
Kwal_33.14920 s33 complement(871727..873694) [1968 bp, 655 aa] {...    32   4.2  

>ZYRO0F11792g Chr6 complement(962314..963855) [1542 bp, 513 aa] {ON}
           highly similar to uniprot|Q12460 Saccharomyces
           cerevisiae YLR197W SIK1 Component of the small
           (ribosomal) subunit (SSU) processosome that contains U3
           snoRNA
          Length = 513

 Score =  858 bits (2218), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/454 (92%), Positives = 422/454 (92%)

Query: 1   MAPIEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLELVSFSPFKGAA 60
           MAPIEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLELVSFSPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLELVSFSPFKGAA 60

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
           EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN
Sbjct: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSE          
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEDSLHDLAALL 240

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                IAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP
Sbjct: 241 NDDAAIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSDEPTNIFGTVLKKQVEQRLEFYTTGHPT 420
           GFISKAAAKNKGRISRYLANKCTMASRIDNYSDEPTNIFGTVLKKQVEQRLEFYTTGHPT
Sbjct: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSDEPTNIFGTVLKKQVEQRLEFYTTGHPT 420

Query: 421 LKNELAIQEAIELYXXXXXXXXXXXXXXXXXHTS 454
           LKNELAIQEAIELY                 HTS
Sbjct: 421 LKNELAIQEAIELYNENKPEEEPKQESKKRKHTS 454

>Kpol_530.27 s530 (71285..72811) [1527 bp, 508 aa] {ON}
           (71285..72811) [1527 nt, 509 aa]
          Length = 508

 Score =  798 bits (2060), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/434 (87%), Positives = 407/434 (93%)

Query: 1   MAPIEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLELVSFSPFKGAA 60
           MAPIEYLLFEEPTGYA+FKVKLQQD+IGSRL+EVQ+QIN+FGSFTKL+ELVSF+PFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
           EALENANDISEGL+S+SLKAVLDLNLPKGS+K+SV + ISDKNLGPSIKEVFPYVDC SN
Sbjct: 61  EALENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISN 120

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           EL+QDLIRGVRLHGEKL KGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDK SL+E          
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAIL 240

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                +AERV+DNARISMGQDLS  DM+NVCIFAQRVV+LADYR+QLYDYLCEKMHTVAP
Sbjct: 241 DNDAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSDEPTNIFGTVLKKQVEQRLEFYTTGHPT 420
           GFISKA+AKNKGRISRYLANKC+MASRIDNYSDEPT++FG VLKKQVEQRLEFY TG PT
Sbjct: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFYATGTPT 420

Query: 421 LKNELAIQEAIELY 434
           LKNE+AI EA+ELY
Sbjct: 421 LKNEVAIHEAMELY 434

>SAKL0F11462g Chr6 complement(889390..890886) [1497 bp, 498 aa] {ON}
           highly similar to uniprot|Q12460 Saccharomyces
           cerevisiae YLR197W SIK1 Component of the small
           (ribosomal) subunit (SSU) processosome that contains U3
           snoRNA
          Length = 498

 Score =  797 bits (2058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/434 (88%), Positives = 404/434 (93%)

Query: 1   MAPIEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLELVSFSPFKGAA 60
           MAPIEYLLFEEPTGY IFKVKLQQD+IGSRL+EVQ+QINDFGSFTKL+ELVSF+PFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
           +ALENANDISEGL+SE LKA+LDLNLPKGS K +VTL ISDKNLGPSIKE FPYVDC SN
Sbjct: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISN 120

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           EL+QDLIRGVRLHG+KL K LQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDK SL E          
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASIL 240

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                IAERV+DNARISMGQDLS  DMENVCIFA+RVV+LADYRRQLYDYLCEKMHTVAP
Sbjct: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSDEPTNIFGTVLKKQVEQRLEFYTTGHPT 420
           GFI+KA+AKNKGRISRYLANKC+MASRIDNYSDEPTN+FG+VLKKQVEQRLEFY+TG PT
Sbjct: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYSTGAPT 420

Query: 421 LKNELAIQEAIELY 434
           LKNELAIQEAIELY
Sbjct: 421 LKNELAIQEAIELY 434

>Suva_10.293 Chr10 (518873..520390) [1518 bp, 505 aa] {ON} YLR197W
           (REAL)
          Length = 505

 Score =  797 bits (2058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/435 (88%), Positives = 407/435 (93%), Gaps = 1/435 (0%)

Query: 1   MAPIEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLELVSFSPFKGAA 60
           MAPIEYLLFEEPTGYA+FKVKLQQD+IGSRL+EVQ+QINDFG+FTKL+EL SF+PFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELASFAPFKGAA 60

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGS-KKQSVTLGISDKNLGPSIKEVFPYVDCFS 119
           EALENANDISEGL+SE LKA+LDLNLPK S KK+++TL ISDKNLGPSIKE FPYVDC S
Sbjct: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120

Query: 120 NELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179
           NEL+QDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180

Query: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXX 239
           LDQLDKD+NTFAMRVKEWYGWHFPELAKLVPDNY+FAKLVLFIKDK SL+E         
Sbjct: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240

Query: 240 XXXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVA 299
                 IA+RV+DNARISMGQDLS  DMENVCIFAQRV +LADYRRQLYDYLCEKMHTVA
Sbjct: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300

Query: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360

Query: 360 SGFISKAAAKNKGRISRYLANKCTMASRIDNYSDEPTNIFGTVLKKQVEQRLEFYTTGHP 419
           SGFISKA+AKNKGRISRYLANKC+MASRIDNYSDEP+N+FGTVLKKQVEQRLEFY TG P
Sbjct: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGTVLKKQVEQRLEFYNTGKP 420

Query: 420 TLKNELAIQEAIELY 434
           TLKNELAIQEA+ELY
Sbjct: 421 TLKNELAIQEAMELY 435

>TDEL0C01940 Chr3 (340658..342190) [1533 bp, 510 aa] {ON} Anc_7.354
           YLR197W
          Length = 510

 Score =  797 bits (2059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/434 (87%), Positives = 408/434 (94%)

Query: 1   MAPIEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLELVSFSPFKGAA 60
           MAPI+YLLFEEPTGYAIFKVKLQQDNIGSRL EVQ+QINDFGSFTKL+ELVSF+PFKGAA
Sbjct: 1   MAPIQYLLFEEPTGYAIFKVKLQQDNIGSRLGEVQEQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
           EALENANDISEGL+SESLKA+LDLNLPKGSKK++VTLGISD+NLGPSIKE FPYVD  SN
Sbjct: 61  EALENANDISEGLVSESLKAILDLNLPKGSKKETVTLGISDRNLGPSIKEEFPYVDSVSN 120

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           EL+QDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLF+KDK SL++          
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFVKDKASLNDESLHDLAAIL 240

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                IA+RV+DNARISMGQDLS  DMENVC+FA+RV +LADYRRQLY+YLCEKMHTVAP
Sbjct: 241 NDDAAIAQRVIDNARISMGQDLSETDMENVCVFAERVASLADYRRQLYEYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSDEPTNIFGTVLKKQVEQRLEFYTTGHPT 420
           GFI+KAA KNKGRISRYLANKC+MASRIDNYSDEPTN+FGTVL+KQVEQRLEFY+TG PT
Sbjct: 361 GFIAKAATKNKGRISRYLANKCSMASRIDNYSDEPTNVFGTVLRKQVEQRLEFYSTGQPT 420

Query: 421 LKNELAIQEAIELY 434
           LKNELAI+EA++LY
Sbjct: 421 LKNELAIKEAMDLY 434

>YLR197W Chr12 (546097..547611) [1515 bp, 504 aa] {ON}
           NOP56Essential evolutionarily-conserved nucleolar
           protein component of the box C/D snoRNP complexes that
           direct 2'-O-methylation of pre-rRNA during its
           maturation; overexpression causes spindle orientation
           defects
          Length = 504

 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/435 (87%), Positives = 408/435 (93%), Gaps = 1/435 (0%)

Query: 1   MAPIEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLELVSFSPFKGAA 60
           MAPIEYLLFEEPTGYA+FKVKLQQD+IGSRL+EVQ+QINDFG+FTKL+ELVSF+PFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELVSFAPFKGAA 60

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGS-KKQSVTLGISDKNLGPSIKEVFPYVDCFS 119
           EALENANDISEGL+SESLKA+LDLNLPK S KK+++TL ISDKNLGPSIKE FPYVDC S
Sbjct: 61  EALENANDISEGLVSESLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEEFPYVDCIS 120

Query: 120 NELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179
           NEL+QDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180

Query: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXX 239
           LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FAKLVLFIKDK SL++         
Sbjct: 181 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLVLFIKDKASLNDDSLHDLAAL 240

Query: 240 XXXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVA 299
                 IA+RV+DNARISMGQD+S  DMENVC+FAQRV +LADYRRQLYDYLCEKMHTVA
Sbjct: 241 LNEDSGIAQRVIDNARISMGQDISETDMENVCVFAQRVASLADYRRQLYDYLCEKMHTVA 300

Query: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360

Query: 360 SGFISKAAAKNKGRISRYLANKCTMASRIDNYSDEPTNIFGTVLKKQVEQRLEFYTTGHP 419
           SGFISKA+AKNKGRISRYLANKC+MASRIDNYS+EP+N+FG+VLKKQVEQRLEFY TG P
Sbjct: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSEEPSNVFGSVLKKQVEQRLEFYNTGKP 420

Query: 420 TLKNELAIQEAIELY 434
           TLKNELAIQEA+ELY
Sbjct: 421 TLKNELAIQEAMELY 435

>Smik_12.257 Chr12 (493092..494618) [1527 bp, 508 aa] {ON} YLR197W
           (REAL)
          Length = 508

 Score =  795 bits (2054), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/435 (87%), Positives = 406/435 (93%), Gaps = 1/435 (0%)

Query: 1   MAPIEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLELVSFSPFKGAA 60
           MAPIEYLLFEEPTGYA+FKVKLQQD+IGSRL+EVQ+QINDFG+FTKL+EL SF+PFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLVELASFAPFKGAA 60

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGS-KKQSVTLGISDKNLGPSIKEVFPYVDCFS 119
           EALENANDISEGL+SESLKA+LDLNLPK S K ++VTL ISDKNLGPSIKE FPYVDC S
Sbjct: 61  EALENANDISEGLVSESLKAILDLNLPKASSKNKNVTLAISDKNLGPSIKEEFPYVDCIS 120

Query: 120 NELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179
           NEL+QDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180

Query: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXX 239
           LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FAKLVLFIKDK SL++         
Sbjct: 181 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLVLFIKDKASLNDDSLHDLAAL 240

Query: 240 XXXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVA 299
                 IA+RV+DNARISMGQD+S  DMENVC+FAQRV +LADYRRQLYDYLCEKMHTVA
Sbjct: 241 LNEDSGIAQRVIDNARISMGQDISETDMENVCVFAQRVASLADYRRQLYDYLCEKMHTVA 300

Query: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360

Query: 360 SGFISKAAAKNKGRISRYLANKCTMASRIDNYSDEPTNIFGTVLKKQVEQRLEFYTTGHP 419
           SGFISKA+AKNKGRISRYLANKC+MASRIDNYSDEP+N+FG+VLKKQVEQRLEFY TG P
Sbjct: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGSVLKKQVEQRLEFYNTGKP 420

Query: 420 TLKNELAIQEAIELY 434
           TLKNELAIQEA+ELY
Sbjct: 421 TLKNELAIQEAMELY 435

>Skud_12.262 Chr12 (492745..494262) [1518 bp, 505 aa] {ON} YLR197W
           (REAL)
          Length = 505

 Score =  794 bits (2051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/435 (87%), Positives = 407/435 (93%), Gaps = 1/435 (0%)

Query: 1   MAPIEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLELVSFSPFKGAA 60
           MAPIEYLLFEEPTGYA+FKVKLQQD+IGSRL+EVQ+QINDFG+FTKL+EL SF+PFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLVELASFAPFKGAA 60

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGS-KKQSVTLGISDKNLGPSIKEVFPYVDCFS 119
           EALENANDISEGL+SESLKA+LDLNLPK S KK+++TL ISDKNLGPSIKE FPYVDC S
Sbjct: 61  EALENANDISEGLVSESLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEDFPYVDCIS 120

Query: 120 NELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179
           NEL+QDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180

Query: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXX 239
           LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FAKLVLFIKDK SL++         
Sbjct: 181 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYAFAKLVLFIKDKASLNDDSLHDLAAL 240

Query: 240 XXXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVA 299
                 IA+RV+DNARISMGQD+S  DMENVC+FAQRV +LADYRRQLYDYLCEKMHTVA
Sbjct: 241 LNEDSGIAQRVIDNARISMGQDISETDMENVCVFAQRVASLADYRRQLYDYLCEKMHTVA 300

Query: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360

Query: 360 SGFISKAAAKNKGRISRYLANKCTMASRIDNYSDEPTNIFGTVLKKQVEQRLEFYTTGHP 419
           SGFISKA+AKNKGRISRYLANKC+MASRIDNYSDEP+N+FG+VLKKQVEQRLEFY TG P
Sbjct: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGSVLKKQVEQRLEFYNTGTP 420

Query: 420 TLKNELAIQEAIELY 434
           T+KNELAIQEA+ELY
Sbjct: 421 TMKNELAIQEAMELY 435

>KLTH0H01166g Chr8 (116579..118102) [1524 bp, 507 aa] {ON} highly
           similar to uniprot|Q12460 Saccharomyces cerevisiae
           YLR197W SIK1 Component of the small (ribosomal) subunit
           (SSU) processosome that contains U3 snoRNA
          Length = 507

 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/434 (87%), Positives = 402/434 (92%)

Query: 1   MAPIEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLELVSFSPFKGAA 60
           MAPIEYLLFEEPTGY IFKVKLQQD+IGSRL+EVQ QINDFGSFTKL+ELVSF+PFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
           +ALENANDISEGL+SE LKAVLD+NLPKGS K++VTL ISDKNLGPSIKEVFPY+DC SN
Sbjct: 61  QALENANDISEGLVSEYLKAVLDMNLPKGSNKKTVTLAISDKNLGPSIKEVFPYIDCMSN 120

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           EL+QDLIRGVRLHG+KL K LQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGDKLLKDLQQGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FAKLVLFIKDK SL+E          
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIKDKASLTEDSLHDLTAIL 240

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                IAERV+DNARISMGQDLS  DMENVC+FA+RV +LADYRRQLYDYLC KMHTVAP
Sbjct: 241 DDDAGIAERVIDNARISMGQDLSETDMENVCVFAERVTSLADYRRQLYDYLCSKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSDEPTNIFGTVLKKQVEQRLEFYTTGHPT 420
           GFI KA+AKNKGRISRYLANKC++ASRIDNYSDEP+N+FGTVLKKQVEQRLEFY+TG PT
Sbjct: 361 GFIGKASAKNKGRISRYLANKCSIASRIDNYSDEPSNVFGTVLKKQVEQRLEFYSTGAPT 420

Query: 421 LKNELAIQEAIELY 434
           LKNELAIQEAIELY
Sbjct: 421 LKNELAIQEAIELY 434

>NDAI0A01880 Chr1 (422978..424489) [1512 bp, 503 aa] {ON} Anc_7.354
          Length = 503

 Score =  792 bits (2046), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/434 (87%), Positives = 407/434 (93%)

Query: 1   MAPIEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLELVSFSPFKGAA 60
           MAPIEYLLFEEPTGYAIFKVKLQQD+IGSRL+EVQ+QINDFGSFTKL+ELVSF+PFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAIFKVKLQQDDIGSRLKEVQEQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
           EALENAND+SEGL+SESLKA+LDLNLPKGSK ++VTL ISDKNLGPSIKE FPYVDC +N
Sbjct: 61  EALENANDVSEGLVSESLKAILDLNLPKGSKGKTVTLAISDKNLGPSIKEEFPYVDCLAN 120

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           EL+QDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDK SL++          
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNDESLHDLAAIL 240

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                IA+RV+DNARISMGQD+S  DMENV IFAQRVV+L +YR+QL+DYLCEKMHTVAP
Sbjct: 241 GDDAGIAQRVIDNARISMGQDISETDMENVSIFAQRVVSLVEYRKQLFDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSDEPTNIFGTVLKKQVEQRLEFYTTGHPT 420
           GFI+KA+AKNKGRISRYLANKC+MASRIDNYSDEPTN+FG+VLKKQVEQRLEFY TG PT
Sbjct: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYNTGKPT 420

Query: 421 LKNELAIQEAIELY 434
           LKNELAIQEA++LY
Sbjct: 421 LKNELAIQEAMDLY 434

>TPHA0F03010 Chr6 complement(658541..660070) [1530 bp, 509 aa] {ON}
           Anc_7.354 YLR197W
          Length = 509

 Score =  787 bits (2033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/434 (85%), Positives = 408/434 (94%)

Query: 1   MAPIEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLELVSFSPFKGAA 60
           MAPIEYLL+EEPTGYAIFKVKLQQD+IGSRL EVQ+QINDFGSFTKL+ELVSF+PFKGAA
Sbjct: 1   MAPIEYLLYEEPTGYAIFKVKLQQDDIGSRLGEVQQQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
           EALENANDISEGL+SE+LKA+LDLNLPKGS+K+SV LGISDKNLGPSIKE FPYVDC +N
Sbjct: 61  EALENANDISEGLVSENLKALLDLNLPKGSEKKSVVLGISDKNLGPSIKEDFPYVDCMAN 120

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           EL+QDL+RG+RLHGEKLFK LQ+GDL+RAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLLRGIRLHGEKLFKDLQTGDLDRAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY+FA+LVLFIKDK SL++          
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYSFARLVLFIKDKASLNDESLHDLTAIL 240

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                I++RV+DNARISMGQDLS  DM+N+C+FA+RVV+L +YRRQLYDYLCEKMHTVAP
Sbjct: 241 NDDAGISQRVIDNARISMGQDLSETDMDNICVFAKRVVSLVEYRRQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSDEPTNIFGTVLKKQVEQRLEFYTTGHPT 420
           GFI+KAAAKNKGRISRYLANKC+MASRIDNYSDEPTN+FG+VLKKQVEQRLEFY TG PT
Sbjct: 361 GFIAKAAAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYATGSPT 420

Query: 421 LKNELAIQEAIELY 434
           LKNELAIQEA++LY
Sbjct: 421 LKNELAIQEAMKLY 434

>Kwal_56.24654 s56 complement(1090443..1091966) [1524 bp, 507 aa]
           {ON} YLR197W (SIK1) - homology to microtubule binding
           proteins and to X90565_5.cds [contig 161] FULL
          Length = 507

 Score =  787 bits (2032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/434 (86%), Positives = 401/434 (92%)

Query: 1   MAPIEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLELVSFSPFKGAA 60
           MAPIEYLLFEEPTGY IFKVKLQQD+IGSRL+EVQ QIN+FGSFTKL+ELVSF+PFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
           +ALENANDISEGL+S+ LKAVLD+NLPKGS K++VTL ISDKNLGPSIKE FPYVDC SN
Sbjct: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           EL+QDLIRGVRLHG+KL K LQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGDKLLKDLQQGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDK SLSE          
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL 240

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                IAERV+DNARISMGQDLS  DM+NVC+FA+RV +LADYRRQLY+YLC KMHTVAP
Sbjct: 241 DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSDEPTNIFGTVLKKQVEQRLEFYTTGHPT 420
           GFI KAAAKNKGRISRYLANKC++ASRIDNYSDEPTN+FGTVLKKQVEQRLEFY+TG PT
Sbjct: 361 GFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNVFGTVLKKQVEQRLEFYSTGSPT 420

Query: 421 LKNELAIQEAIELY 434
           LKNELAIQEAIELY
Sbjct: 421 LKNELAIQEAIELY 434

>NCAS0A14170 Chr1 complement(2783782..2785314) [1533 bp, 510 aa]
           {ON} Anc_7.354
          Length = 510

 Score =  787 bits (2032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/434 (86%), Positives = 406/434 (93%)

Query: 1   MAPIEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLELVSFSPFKGAA 60
           MAPIEYLLFEEPTGYAIFKVKLQQD+IGSRL+EVQ+QINDFGSFTKL+ELVSF+PFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAIFKVKLQQDDIGSRLKEVQEQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
           EALENANDISEGL+SESLKAVLDLNLPK SK +++TL ISDKNLGPSIKE FPYVDC +N
Sbjct: 61  EALENANDISEGLVSESLKAVLDLNLPKASKSKTITLAISDKNLGPSIKEDFPYVDCIAN 120

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           EL+QDLIRGVRLHG+KLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGDKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDK SL++          
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNDESLHDLAAIL 240

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                IAERV+DNARISMGQD+S  DMENV +FAQRVV+L +YR+QLYDYLCEKMHTVAP
Sbjct: 241 NDDAGIAERVIDNARISMGQDISETDMENVGVFAQRVVSLVEYRKQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSDEPTNIFGTVLKKQVEQRLEFYTTGHPT 420
           GFI+KA+AKNKGRISRYLANKC+MASRIDNYSDEPT++FG VLKKQVEQRLEFY+TG PT
Sbjct: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFYSTGTPT 420

Query: 421 LKNELAIQEAIELY 434
           LKNELAI+EA++LY
Sbjct: 421 LKNELAIKEAMDLY 434

>CAGL0A04015g Chr1 complement(402070..403596) [1527 bp, 508 aa] {ON}
           similar to uniprot|Q12460 Saccharomyces cerevisiae
           YLR197w SIK1 involved in pre-rRNA processing
          Length = 508

 Score =  781 bits (2017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/431 (86%), Positives = 398/431 (92%)

Query: 4   IEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLELVSFSPFKGAAEAL 63
           IEYLLFEEPTGYA+FKVKL QDNIGS+L+EVQ+QINDFG FTKL+ELVSF+PFKGAAEAL
Sbjct: 3   IEYLLFEEPTGYAVFKVKLNQDNIGSKLKEVQEQINDFGGFTKLVELVSFAPFKGAAEAL 62

Query: 64  ENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSNELS 123
           ENANDISEGL+SESLK VL+LNLPKGS K +VTL ISDKNLGPSIKE FPYVDC +NEL+
Sbjct: 63  ENANDISEGLVSESLKNVLELNLPKGSAKSTVTLAISDKNLGPSIKEAFPYVDCIANELA 122

Query: 124 QDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 183
           QDLIRGVRLHGEKL KGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL
Sbjct: 123 QDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 182

Query: 184 DKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXXXXX 243
           DKDINTFAMRVKEWYGWHFPELAKLVPDNY FAKLVLFIKDK SL+E             
Sbjct: 183 DKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLVLFIKDKASLNEESLHDLAAVVNED 242

Query: 244 XXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAPNLS 303
             IAER++DNARISMGQDLS  DMENVC+FAQRVV+L DYR+QLYDYLCEKMHTVAPNLS
Sbjct: 243 AGIAERIIDNARISMGQDLSETDMENVCVFAQRVVSLVDYRKQLYDYLCEKMHTVAPNLS 302

Query: 304 ELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 363
            LIGEVIGARLISHAGSLT+LSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI
Sbjct: 303 GLIGEVIGARLISHAGSLTSLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 362

Query: 364 SKAAAKNKGRISRYLANKCTMASRIDNYSDEPTNIFGTVLKKQVEQRLEFYTTGHPTLKN 423
           +KA+AKNKGRISRYLANKC+MASRIDNYSDEPTN+FG+VLKKQVEQRLEFY TG PTLKN
Sbjct: 363 AKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYATGKPTLKN 422

Query: 424 ELAIQEAIELY 434
           ELAI EA+EL+
Sbjct: 423 ELAIHEAMELF 433

>KAFR0L01510 Chr12 complement(276894..278396) [1503 bp, 500 aa] {ON}
           Anc_7.354 YLR197W
          Length = 500

 Score =  779 bits (2012), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/434 (85%), Positives = 403/434 (92%)

Query: 1   MAPIEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLELVSFSPFKGAA 60
           MAPIEYLLFEEPTGYA+FKVKLQQD+I SRL EVQ+QIN+FGSFTKL+ELVSF+PFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIASRLAEVQQQINEFGSFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
           +ALENANDISEGLLS+SLK++L+LNLPK SK ++VTLGISDKNLGPSIKE FPYVDC SN
Sbjct: 61  DALENANDISEGLLSDSLKSILELNLPKASKSKTVTLGISDKNLGPSIKEQFPYVDCISN 120

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           EL+QDL+RGVR HGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL+
Sbjct: 121 ELAQDLLRGVRQHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALV 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FAKLVLFIKDK SL++          
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLVLFIKDKASLNDESLHELAGHL 240

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                IA+RV+DNARISMGQDLS  DM+NVC+FA+RVV+L DYRR LYDYLCEKMHTVAP
Sbjct: 241 NEDAGIAQRVIDNARISMGQDLSEIDMQNVCVFAERVVSLVDYRRGLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSDEPTNIFGTVLKKQVEQRLEFYTTGHPT 420
           GFI+KA+AKNKGRISRYLANKC++ASRIDNYSDEP+N+FG+VLKKQVEQRLEFY  G PT
Sbjct: 361 GFIAKASAKNKGRISRYLANKCSIASRIDNYSDEPSNVFGSVLKKQVEQRLEFYNIGKPT 420

Query: 421 LKNELAIQEAIELY 434
           LKNELAIQEA+ELY
Sbjct: 421 LKNELAIQEAMELY 434

>TBLA0E02080 Chr5 complement(505617..507158) [1542 bp, 513 aa] {ON}
           Anc_7.354 YLR197W
          Length = 513

 Score =  778 bits (2009), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/434 (85%), Positives = 403/434 (92%)

Query: 1   MAPIEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLELVSFSPFKGAA 60
           M+ I+YLLFEEPTGYA+F+VKLQQDNIGS+L EVQKQINDF SFTKL+ELVSF+PFKGAA
Sbjct: 1   MSAIQYLLFEEPTGYAVFQVKLQQDNIGSKLAEVQKQINDFASFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
           EALENANDISEGL+SE+LK++L+LNLPKGS+K++V LGISDKNLGPSIKE FPYVDC SN
Sbjct: 61  EALENANDISEGLVSENLKSLLELNLPKGSEKKTVILGISDKNLGPSIKEEFPYVDCISN 120

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           EL QDL+RG+R HGEKLFKGLQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELVQDLLRGIRQHGEKLFKGLQQGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDK SL+E          
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEESLHDLTAIL 240

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                IAERV+DNARISMGQDLS  DMENVC+FA+RVV++ADYR+QLYDYLCEKMHTVAP
Sbjct: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCVFAKRVVSIADYRKQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSDEPTNIFGTVLKKQVEQRLEFYTTGHPT 420
           GFISKA+AKNKGRISRYLANKC+MASRIDNYSDEP+++FG V+KKQVEQRLEFY+TG PT
Sbjct: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSSVFGAVMKKQVEQRLEFYSTGKPT 420

Query: 421 LKNELAIQEAIELY 434
           LKNE+AI EA+ELY
Sbjct: 421 LKNEVAIHEAMELY 434

>KLLA0D12254g Chr4 (1045077..1046618) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|Q12460 Saccharomyces cerevisiae
           YLR197W SIK1 Component of the small (ribosomal) subunit
           (SSU) processosome that contains U3 snoRNA
          Length = 513

 Score =  778 bits (2009), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/434 (85%), Positives = 401/434 (92%)

Query: 1   MAPIEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLELVSFSPFKGAA 60
           MAPIEYLLFEEPTGY IFKVKLQQD+IGSRL+EVQ+QINDFGSFTKL+ELVSF+PFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
           +ALENANDISEGL+SE LKA+LDLNLPKGS K++VTL ISDKNLGPSIKEVFP+VDC SN
Sbjct: 61  QALENANDISEGLVSEHLKALLDLNLPKGSSKKTVTLAISDKNLGPSIKEVFPFVDCISN 120

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           EL+QDLIRGVRLHG+KL K LQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGDKLLKDLQPGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FAKLVLFIKDK SL+E          
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIKDKASLNEESLHDLSEIL 240

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                I+ERV+DNARISMGQDLS  DMENV IFA+RVV+L +YR+QLYDYLCEKMHTVAP
Sbjct: 241 DNDAGISERVIDNARISMGQDLSETDMENVTIFAKRVVSLVEYRKQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISH+GSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHSGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSDEPTNIFGTVLKKQVEQRLEFYTTGHPT 420
           GFI+KA+AKNKGRISRYLANKC+MASRIDNYSDEP+N+FG VLKKQVEQRLEFY +G PT
Sbjct: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGQVLKKQVEQRLEFYASGTPT 420

Query: 421 LKNELAIQEAIELY 434
           LKNE AI+EAIELY
Sbjct: 421 LKNESAIKEAIELY 434

>KNAG0B02590 Chr2 (503498..504997) [1500 bp, 499 aa] {ON} Anc_7.354
           YLR197W
          Length = 499

 Score =  777 bits (2007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/434 (85%), Positives = 401/434 (92%)

Query: 1   MAPIEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLELVSFSPFKGAA 60
           MA IEYLLFEEPTGYA+FKVKLQQD+IGSRL EVQ+QINDFGSFTK++ELVSF+PFKGAA
Sbjct: 1   MAAIEYLLFEEPTGYAVFKVKLQQDDIGSRLAEVQEQINDFGSFTKMVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
           EALENAN+ISEGL+SESLK+VLDLNLPK SKK+S+ LGISDKNLGPSIKE FPYVD  SN
Sbjct: 61  EALENANEISEGLVSESLKSVLDLNLPKPSKKKSIALGISDKNLGPSIKETFPYVDSVSN 120

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           EL QD++RG+RLHGEKLFKGLQSGDL+RA LGLGHAYSRAKVKFSVQKNDNHIIQAIAL+
Sbjct: 121 ELVQDMLRGIRLHGEKLFKGLQSGDLDRAHLGLGHAYSRAKVKFSVQKNDNHIIQAIALV 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDK SL++          
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNDESLHDLAALL 240

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                IA+RV+DNARISMGQDLS  DMENV +FAQRVV+L +YRRQLYDYLCEKMHTVAP
Sbjct: 241 NDDAGIAQRVIDNARISMGQDLSETDMENVGVFAQRVVSLVEYRRQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSDEPTNIFGTVLKKQVEQRLEFYTTGHPT 420
           GFI+KAAAKNKGRISRYLANKC++ASRIDNYSDEP+N+FGTVLKKQVEQRLEFY TG PT
Sbjct: 361 GFIAKAAAKNKGRISRYLANKCSIASRIDNYSDEPSNVFGTVLKKQVEQRLEFYATGKPT 420

Query: 421 LKNELAIQEAIELY 434
           LKNELAI EA+ELY
Sbjct: 421 LKNELAIHEAMELY 434

>ACL144C Chr3 complement(94809..96458) [1650 bp, 549 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR197W
           (SIK1)
          Length = 549

 Score =  778 bits (2010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/434 (86%), Positives = 396/434 (91%)

Query: 1   MAPIEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLELVSFSPFKGAA 60
           MAPIEYLLFEEPTGY IFKVKLQQD+IGSRL+EVQKQINDFGSFTKL+ELVSF+PFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
            ALENANDISEGLLSE LKAVLDLNLPKGS K+SV L +SDKNLGPSIKE FPYVDC SN
Sbjct: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           EL+QDL+RGVRLHG KL K LQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FAKLVLFI+DK SL++          
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAIL 240

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                IAERV+ NARISMGQDLS  DMENV +FA+RVVNL +YRRQLY+YLCEKMHTVAP
Sbjct: 241 GEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSDEPTNIFGTVLKKQVEQRLEFYTTGHPT 420
           GFISKA+AKNKGRISRYLANKC+MASRIDNYSD+PTN+FG VLKKQVEQRLEFY TG PT
Sbjct: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNVFGQVLKKQVEQRLEFYATGSPT 420

Query: 421 LKNELAIQEAIELY 434
           LKNE+AIQEAI L+
Sbjct: 421 LKNEIAIQEAIALF 434

>Ecym_4719 Chr4 (1410528..1412069) [1542 bp, 513 aa] {ON} similar to
           Ashbya gossypii ACL144C
          Length = 513

 Score =  767 bits (1980), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/434 (84%), Positives = 393/434 (90%)

Query: 1   MAPIEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLELVSFSPFKGAA 60
           MAPIEYLLFEEPTGY IFKVKLQQD+IGSRL+EVQKQINDFGSFTKL+EL SF PFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELASFVPFKGAA 60

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
           +ALEN NDISEGLLSE LKAVLDLNLPKGS K++V L ISDKNLGPSIKE FPYVDC ++
Sbjct: 61  QALENCNDISEGLLSEHLKAVLDLNLPKGSSKKAVVLAISDKNLGPSIKEEFPYVDCIAS 120

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           EL+QDLIRGVRLHG KL K LQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGSKLLKDLQPGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FAKLVL I+DKTSL++          
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLHIRDKTSLTDDSLHDLAAIL 240

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                IAERV+ NARISMGQDLS  DM+NVC+FA+RV NL DYR+QLYDYLC KMHTVAP
Sbjct: 241 DDDAGIAERVISNARISMGQDLSEVDMDNVCVFAERVANLVDYRKQLYDYLCAKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSDEPTNIFGTVLKKQVEQRLEFYTTGHPT 420
           GFISKA+AKNKGRISRYLANKC++ASRIDNY+D+PTN FG VLKKQVEQRLEFY TG PT
Sbjct: 361 GFISKASAKNKGRISRYLANKCSIASRIDNYADDPTNAFGQVLKKQVEQRLEFYATGTPT 420

Query: 421 LKNELAIQEAIELY 434
           LKNE+AIQEAI+L+
Sbjct: 421 LKNEVAIQEAIDLF 434

>ZYRO0F12518g Chr6 complement(1017206..1018765) [1560 bp, 519 aa]
           {ON} similar to uniprot|Q12499 Saccharomyces cerevisiae
           YOR310C NOP58 Protein involved in pre-rRNA processing
           18S rRNA synthesis and snoRNA synthesis component of the
           small subunit processome complex which is required for
           processing of pre-18S rRNA
          Length = 519

 Score =  327 bits (837), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 176/413 (42%), Positives = 257/413 (62%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLE---LVSFSPFKGAA 60
           + Y+L E   GYA+ K          ++ +  K I D  S  K+L+   + +FS F  AA
Sbjct: 1   MSYVLTETSAGYALLKAS------DKKIHKSPKLIQDLDSSEKVLDEFKIAAFSKFNSAA 54

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
            ALE AN I+EG ++  L+++LD    +  K +  TL +S+  L  SI ++    +  S+
Sbjct: 55  NALEEANSITEGKVTPQLQSLLD----EVKKDKKSTLIVSETKLANSINKLGLNFNVVSD 110

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            ++ D+ R V+ +  +L  GL   DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGLTDNDLNKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           D LDK+INT++MR KEWYGWHFPELAK+V D   +A+++L +  ++  +E          
Sbjct: 171 DDLDKEINTYSMRCKEWYGWHFPELAKIVTDLVAYARIILTMGVRSKAAETDMSAILPEE 230

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                I ERV   A +SMG +++  D++N+   AQ++V+ A YR QL +YL  +M  +AP
Sbjct: 231 -----IEERVKAAAEVSMGTEITKTDLDNIGALAQQIVDFATYREQLSNYLTARMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLISHAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLISHAGSLVSLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSD--EPTNIFGTVLKKQVEQRL 411
             + +A  KNKG+I+R LA K  ++ R D  ++  + +   G   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDVGLESRSKVENRL 398

>KNAG0J00650 Chr10 (110685..112259) [1575 bp, 524 aa] {ON} Anc_8.787
           YOR310C
          Length = 524

 Score =  326 bits (836), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 177/413 (42%), Positives = 257/413 (62%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLE---LVSFSPFKGAA 60
           + Y+L E   GYA+ K          +L +    I D  S  K+L+   + +FS F  AA
Sbjct: 1   MSYVLTETSAGYALLKAS------DKKLYKSATLIQDLDSSEKVLKEFKIAAFSKFNSAA 54

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
            ALE AN + EG +S  L+ +LD ++ K  K    TL +S+  L  SI ++    +  S+
Sbjct: 55  NALEEANSVIEGKVSPQLQKLLD-DIKKDKK---ATLVVSETKLANSINKLGLNFNVVSD 110

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            ++ D+ R V+ H  +L  GL   DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEHLPELLPGLSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++   E          
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGVRSKAHEIDMSEILPEE 230

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                I ERV   A +SMG +++  D++N+   A ++V+ A YR QL +YL  +M  +AP
Sbjct: 231 -----IEERVKAAAEVSMGTEITQTDLDNIKALADQIVDFAAYREQLSNYLSARMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+HAGSLT+L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHAGSLTSLAKAPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSD--EPTNIFGTVLKKQVEQRL 411
             + +A  KNKG+I+R LA K  ++ R D +++  + +   G  ++ +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDAFAEDRDDSGDVGLDVRAKVENRL 398

>KLTH0H15334g Chr8 complement(1329504..1331039) [1536 bp, 511 aa]
           {ON} highly similar to uniprot|Q12499 Saccharomyces
           cerevisiae YOR310C NOP58 Protein involved in pre-rRNA
           processing 18S rRNA synthesis and snoRNA synthesis
           component of the small subunit processome complex which
           is required for processing of pre-18S rRNA
          Length = 511

 Score =  326 bits (835), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 180/413 (43%), Positives = 256/413 (61%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLE---LVSFSPFKGAA 60
           + Y+L E   GYA+ K   ++    S L      I D  +  K+L+   + +FS F  AA
Sbjct: 1   MAYVLTETSAGYALLKASDKKIYKSSSL------IQDLNTSDKVLKQFKVAAFSKFGSAA 54

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
           EALE AN I EG +S  L+ +LD +  K  KK   TL +S+  L  +I ++    +  S+
Sbjct: 55  EALEEANSIVEGKVSSQLQKLLDES--KADKK--ATLVVSETKLANAINKLGLNFNVVSD 110

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            ++ D+ R V+ H  +L  GL   DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIFRAVKEHLPELLPGLSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  FA+++L +  +++ +E          
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAFARIILTMGVRSNAAETDLSEILPEE 230

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                I ERV   A ISMG +++  D+EN+   A ++   A YR QL +YL  +M  +AP
Sbjct: 231 -----IEERVKAAAEISMGTEITPTDLENIKALATQITEFAAYREQLSNYLSARMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHAGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSD--EPTNIFGTVLKKQVEQRL 411
             + +A  KNKG+I+R LA K  ++ R D  ++  + +   G   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDVGLEARSKVESRL 398

>KNAG0G03190 Chr7 complement(687362..688933) [1572 bp, 523 aa] {ON}
           Anc_8.787 YOR310C
          Length = 523

 Score =  324 bits (831), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 176/413 (42%), Positives = 257/413 (62%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLE---LVSFSPFKGAA 60
           + Y+L E   GYA+ K          ++ +    I D  +  KLL+   + +FS F  AA
Sbjct: 1   MSYVLTETSAGYALLKAS------DKKIYKSPSLIEDLNTSEKLLKEFKIAAFSKFNSAA 54

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
            ALE AN + EG +S  L+ +L+ ++ K  K    TL +S+  L  SI ++    +  S+
Sbjct: 55  NALEEANSVIEGKVSPQLEKLLE-DIKKDKK---ATLVVSETKLANSINKLGLNFNVVSD 110

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            ++ D+ R V+ H  +L  GL   DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEHLPELLPGLSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++   E          
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGVRSKAHETDMSEILPEE 230

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                I ERV   A +SMG +++  D++N+   A ++V+ A YR QL +YL  +M  +AP
Sbjct: 231 -----IEERVKAAAEVSMGTEITQTDLDNIKALADQIVDFAAYREQLSNYLSARMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+HAGSLT+L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHAGSLTSLAKAPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSD--EPTNIFGTVLKKQVEQRL 411
             + +A  KNKG+I+R LA K  ++ R D +S+  + +   G  ++ +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDAFSEDRDDSGDVGLDVRVKVENRL 398

>TDEL0B01110 Chr2 (204471..205985) [1515 bp, 504 aa] {ON} Anc_8.787
           YOR310C
          Length = 504

 Score =  320 bits (819), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 175/413 (42%), Positives = 257/413 (62%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLE---LVSFSPFKGAA 60
           + Y+L E   GYA+ K          ++ +  K I D  S  K+L+   + +FS F  AA
Sbjct: 1   MAYVLTETSAGYALLKAS------DKKIYKSTKLIQDLDSSDKVLKEFKIAAFSKFNSAA 54

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
            ALE A+ I EG +S  L+ +L+ ++ K  K    TL +S+  L  +I ++    +  S+
Sbjct: 55  NALEEASAIIEGKVSPQLQNLLE-DIKKDKKS---TLIVSETKLANAINKLGLNFNVISD 110

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            ++ D+ R V+ +   L  GL  GDL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPDLLPGLTDGDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L I  ++  SE          
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILSIGVRSKASETDMSSILPEE 230

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                I ERV   A +SMG +++  D++N+   A+++V+ A YR QL +YL  +M  +AP
Sbjct: 231 -----IEERVKTAAEVSMGTEITQVDLDNIKCLAEQIVDFASYREQLSNYLSARMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSD--EPTNIFGTVLKKQVEQRL 411
             + +A  KNKG+I+R LA K  ++ R D  ++  + +   G   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLDSRAKVENRL 398

>TBLA0B02830 Chr2 (653081..654634) [1554 bp, 517 aa] {ON} Anc_8.787
           YOR310C
          Length = 517

 Score =  320 bits (819), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 173/413 (41%), Positives = 255/413 (61%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLE---LVSFSPFKGAA 60
           + Y+L E P GYA+ K   ++    S L      + D  +  K+L+   + +FS F  AA
Sbjct: 1   MSYVLTETPAGYALLKASDKKIYKSSSL------LQDLDTTDKVLKEFKIAAFSKFNSAA 54

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
            ALE +  I EG +S  L+ +LD    +  K +  TL +S+  L  +I ++   ++  S+
Sbjct: 55  NALEESTAIIEGKVSPQLEKLLD----EIKKDKKTTLIVSETKLANAINKLGLNLNIVSD 110

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            ++ D+ R V+ +   L  GL   DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPDLLPGLSDSDLNKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+L+L +  ++  SE          
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARLILTMGIRSKASETDMSEILPEE 230

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                I ERV   A +SMG +++  D++N+   A+++V  A YR QL +YL  +M  +AP
Sbjct: 231 -----IEERVKTAAEVSMGTEITPTDLDNIKALAEQIVEFASYREQLSNYLSSRMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSDEPTNI--FGTVLKKQVEQRL 411
             + +A  KNKG+I+R LA K  ++ R D  +++  +    G   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDAGDVGLEARTKVENRL 398

>KAFR0B03540 Chr2 complement(735790..737289) [1500 bp, 499 aa] {ON}
           Anc_8.787 YOR310C
          Length = 499

 Score =  319 bits (817), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 172/413 (41%), Positives = 256/413 (61%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLL---ELVSFSPFKGAA 60
           + Y+L E   GYA+ K   ++    S L      + D  S  K+L   ++ +FS F  AA
Sbjct: 1   MSYILTETSAGYALLKASDKKIYKSSTL------LQDLDSSEKVLRQFKIAAFSKFSSAA 54

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
            ALE AN I EG +S  L+ +LD    +  K +  TL +S+  L  +I ++   +   S+
Sbjct: 55  NALEEANSIVEGKVSTQLEKLLD----EIKKDKKSTLVVSETKLANAINKLGLNLSVVSD 110

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            ++ D+ R V+ +  +L  GL   DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGLDDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++  +E          
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKAAETDMSEILPEE 230

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                + ERV   A +SMG +++ +D++N+   A+++V  A YR QL +YL  +M  +AP
Sbjct: 231 -----VEERVKTAAEVSMGTEITQSDLDNIKSLAEQIVEFAAYREQLSNYLSNRMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHSGSLVSLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSD--EPTNIFGTVLKKQVEQRL 411
             + +A  KNKG+I+R LA K  ++ R D  ++  + +   G   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLECRAKVENRL 398

>KAFR0D01580 Chr4 complement(313631..315136) [1506 bp, 501 aa] {ON}
           Anc_8.787 YOR310C
          Length = 501

 Score =  319 bits (817), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 170/414 (41%), Positives = 256/414 (61%), Gaps = 22/414 (5%)

Query: 4   IEYLLFEEPTGYAIFKVK----LQQDNIGSRLEEVQKQINDFGSFTKLLELVSFSPFKGA 59
           + Y+L E   GYA+ K       +   + S L+  +K + +F       ++ +FS F  A
Sbjct: 1   MSYVLTETSAGYALLKASDKKIYKSTTLLSDLDSSEKVLKEF-------KIAAFSKFSSA 53

Query: 60  AEALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFS 119
           A ALE AN I EG +S  L+ +L+    +  K +  TL +S+  L  +I ++    +  S
Sbjct: 54  ANALEEANSIIEGKVSSQLEKILE----QIKKDKKSTLIVSETKLANAINKLGLNFNVVS 109

Query: 120 NELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179
           + ++ D+ R V+ H  +L  GL   DL +  LGL H+  R K+KFS  K D  IIQAIAL
Sbjct: 110 DAVTLDIYRAVKEHLPELLPGLNDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIAL 169

Query: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXX 239
           LD LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++  +E         
Sbjct: 170 LDDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKAAETDMSEILPE 229

Query: 240 XXXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVA 299
                 + ERV   A +SMG +++ +D++N+   A+++V  A YR QL +YL  +M  +A
Sbjct: 230 E-----VEERVKTAAEVSMGTEITQSDLDNIKSLAEQIVEFAAYREQLSNYLSNRMKAIA 284

Query: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359
           PNL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH
Sbjct: 285 PNLTQLVGELVGARLIAHSGSLVSLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYH 344

Query: 360 SGFISKAAAKNKGRISRYLANKCTMASRIDNYSD--EPTNIFGTVLKKQVEQRL 411
           +  + +A  KNKG+I+R LA K  ++ R D  ++  + +   G   + +VE RL
Sbjct: 345 ASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLECRAKVENRL 398

>Smik_15.491 Chr15 complement(846605..848155) [1551 bp, 516 aa] {ON}
           YOR310C (REAL)
          Length = 516

 Score =  317 bits (812), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 173/413 (41%), Positives = 255/413 (61%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLE---LVSFSPFKGAA 60
           + Y+L E   GYA+ K   ++    S L      I D  S  K+L+   + +FS F  AA
Sbjct: 1   MAYVLTETSAGYALLKASDKKIYKSSSL------IQDLDSSDKVLKEFKIAAFSKFNSAA 54

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
            ALE AN I EG +S  L+ +L+    +  K +  TL +S+  L  +I ++    +  S+
Sbjct: 55  NALEEANSIIEGKVSSQLEKLLE----EIKKDKKSTLIVSETKLANAINKLGLNFNVVSD 110

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            ++ D+ R V+ +  +L  G+   DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++  SE          
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKASETDLSEILPEE 230

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                I ERV   A +SMG +++  D++N+   A+++V  A YR QL +YL  +M  +AP
Sbjct: 231 -----IEERVKTAAEVSMGTEITQTDLDNINALAEQIVEFAAYREQLSNYLSARMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSD--EPTNIFGTVLKKQVEQRL 411
             + +A  KNKG+I+R LA K  ++ R D  ++  + +   G   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVENRL 398

>TPHA0I00650 Chr9 (135050..136672) [1623 bp, 540 aa] {ON} Anc_8.787
           YOR310C
          Length = 540

 Score =  318 bits (814), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 175/416 (42%), Positives = 257/416 (61%), Gaps = 20/416 (4%)

Query: 1   MAPIEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLE---LVSFSPFK 57
           +  + Y+L E   GYA+ K   ++    S L      I D  +  K+L+   + +FS F 
Sbjct: 30  LCKMAYVLTETSAGYALLKASDKKIYKSSTL------IQDLDTSDKVLKEFKIAAFSKFS 83

Query: 58  GAAEALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDC 117
            AA ALE +N I EG +S  L+ +L+ ++ K  K    TL +S+  L  SI ++    + 
Sbjct: 84  SAANALEESNAIIEGKVSSQLQKLLE-DIKKDKKS---TLVVSETKLANSINKLGLNFNV 139

Query: 118 FSNELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAI 177
            S+ ++ D+ R V+ +  +L  GL   DL +  LGL H+  R K+KFS  K D  IIQAI
Sbjct: 140 VSDAVTLDIYRAVKEYLPELLPGLTDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAI 199

Query: 178 ALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXX 237
           ALLD LDK++NT+AMRVKEWYGWHFPELAK+V D+  +A+++L +  ++  SE       
Sbjct: 200 ALLDDLDKELNTYAMRVKEWYGWHFPELAKIVVDSVAYARIILTMGIRSKASETDMSEIL 259

Query: 238 XXXXXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHT 297
                   I ERV   A +SMG +++  D++N+   A ++V  A YR QL +YL  +M  
Sbjct: 260 PEE-----IEERVKTAAEVSMGTEITPVDLDNIKALADQIVEFAAYREQLSNYLSARMKA 314

Query: 298 VAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLI 357
           +APNL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+
Sbjct: 315 IAPNLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLL 374

Query: 358 YHSGFISKAAAKNKGRISRYLANKCTMASRIDNYSD--EPTNIFGTVLKKQVEQRL 411
           YH+  + +A  KNKG+I+R LA K  ++ R D  ++  + +   G   + +VE RL
Sbjct: 375 YHASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLEARAKVESRL 430

>TPHA0G01160 Chr7 (234712..236256) [1545 bp, 514 aa] {ON} Anc_8.787
           YOR310C
          Length = 514

 Score =  317 bits (812), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 173/413 (41%), Positives = 255/413 (61%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLE---LVSFSPFKGAA 60
           + Y+L E   GYA+ K          ++ +    I D  +  K+L+   + +FS F  AA
Sbjct: 1   MAYVLTETSAGYALLKAS------DKKIYKSTSLIQDLDTSDKVLKEFKIAAFSKFSSAA 54

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
            ALE +N I EG +S  L+ +L+ ++ K  K    TL +S+  L  SI ++    +  S+
Sbjct: 55  NALEESNAIIEGKVSSQLQKLLE-DIKKDKKS---TLVVSETKLANSINKLGLNFNVVSD 110

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            ++ D+ R V+ +  +L  GL   DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGLTDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           D LDK++NT+AMRVKEWYGWHFPELAK+V D+  +A+++L +  ++  SE          
Sbjct: 171 DDLDKELNTYAMRVKEWYGWHFPELAKIVVDSVAYARIILTMGIRSKASETDMSEILPEE 230

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                I ERV   A +SMG +++  D++N+   A ++V  A YR QL +YL  +M  +AP
Sbjct: 231 -----IEERVKTAAEVSMGTEITPVDLDNIKALADQIVEFAAYREQLSNYLSARMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSD--EPTNIFGTVLKKQVEQRL 411
             + +A  KNKG+I+R LA K  ++ R D  ++  + +   G   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLEARAKVENRL 398

>Skud_15.478 Chr15 complement(836937..837160,837194..838505) [1536
           bp, 512 aa] {ON} YOR310C (REAL)
          Length = 512

 Score =  317 bits (811), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 173/411 (42%), Positives = 255/411 (62%), Gaps = 20/411 (4%)

Query: 6   YLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLE---LVSFSPFKGAAEA 62
           Y+L E   GYA+ K   ++    S L      I D  S  K+L+   + +FS F  AA A
Sbjct: 3   YVLTETSAGYALLKASDKKIYKSSSL------IQDLDSSDKVLKEFKIAAFSKFNSAANA 56

Query: 63  LENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSNEL 122
           LE AN I EG +S  L+ +L+    +  K +  TL +S+  L  +I ++    +  S+ +
Sbjct: 57  LEEANSIIEGKVSSQLEKLLE----EIKKDKKSTLIVSETKLANAINKLGLNFNVVSDAV 112

Query: 123 SQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQ 182
           + D+ R V+ +  +L  G+   DL +  LGL H+  R K+KFS  K D  IIQAIALLD 
Sbjct: 113 TLDIYRAVKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDD 172

Query: 183 LDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXXXX 242
           LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++  SE            
Sbjct: 173 LDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKASETDLSEILPEE-- 230

Query: 243 XXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAPNL 302
              I ERV   A +SMG +++  D++N+   A+++V+ A YR QL +YL  +M  +APNL
Sbjct: 231 ---IEERVKTAAEVSMGTEITQTDLDNINALAEQIVDFAAYREQLSNYLSARMKAIAPNL 287

Query: 303 SELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGF 362
           ++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  
Sbjct: 288 TQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASL 347

Query: 363 ISKAAAKNKGRISRYLANKCTMASRIDNYSD--EPTNIFGTVLKKQVEQRL 411
           + +A  KNKG+I+R LA K  ++ R D  ++  + +   G   + +VE RL
Sbjct: 348 VGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVENRL 398

>YOR310C Chr15 complement(896825..898360) [1536 bp, 511 aa] {ON}
           NOP58Protein involved in pre-rRNA processing, 18S rRNA
           synthesis, and snoRNA synthesis; component of the small
           subunit processome complex, which is required for
           processing of pre-18S rRNA
          Length = 511

 Score =  317 bits (811), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 172/413 (41%), Positives = 255/413 (61%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLE---LVSFSPFKGAA 60
           + Y+L E   GYA+ K   ++    S L      I D  S  K+L+   + +FS F  AA
Sbjct: 1   MAYVLTETSAGYALLKASDKKIYKSSSL------IQDLDSSDKVLKEFKIAAFSKFNSAA 54

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
            ALE AN I EG +S  L+ +L+    +  K +  TL +S+  L  +I ++    +  S+
Sbjct: 55  NALEEANSIIEGKVSSQLEKLLE----EIKKDKKSTLIVSETKLANAINKLGLNFNVVSD 110

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            ++ D+ R ++ +  +L  G+   DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAIKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++  SE          
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKASETDLSEILPEE 230

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                I ERV   A +SMG +++  D++N+   A+++V  A YR QL +YL  +M  +AP
Sbjct: 231 -----IEERVKTAAEVSMGTEITQTDLDNINALAEQIVEFAAYREQLSNYLSARMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSD--EPTNIFGTVLKKQVEQRL 411
             + +A  KNKG+I+R LA K  ++ R D  ++  + +   G   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVENRL 398

>Suva_8.361 Chr8 complement(637602..637804,637835..639149) [1518 bp,
           505 aa] {ON} YOR310C (REAL)
          Length = 505

 Score =  316 bits (810), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 172/413 (41%), Positives = 256/413 (61%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLE---LVSFSPFKGAA 60
           + Y+L E   GYA+ K   ++    S L      I D  S  K+L+   + +FS F  AA
Sbjct: 1   MAYVLTETSAGYALLKASDKKIYKSSSL------IQDLDSSDKVLKEFKIAAFSKFNSAA 54

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
            ALE AN I +G +S  L+ +L+    +  K +  TL +S+  L  +I ++    +  S+
Sbjct: 55  NALEEANSIIDGKVSSQLEKLLE----EIKKDKKSTLIVSETKLANAINKLGLNFNVVSD 110

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            ++ D+ R V+ +  +L  G+   DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++  SE          
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKASETDLSEILPEE 230

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                I ERV   A +SMG +++  D++N+   A+++V+ A YR QL +YL  +M  +AP
Sbjct: 231 -----IEERVKTAAEVSMGTEITQTDLDNINALAEQIVDFAAYREQLSNYLSARMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSD--EPTNIFGTVLKKQVEQRL 411
             + +A  KNKG+I+R LA K  ++ R D  ++  + +   G   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVENRL 398

>SAKL0B05874g Chr2 complement(499332..500873) [1542 bp, 513 aa] {ON}
           similar to uniprot|Q12499 Saccharomyces cerevisiae
           YOR310C NOP58 Protein involved in pre-rRNA processing
           18S rRNA synthesis and snoRNA synthesis component of the
           small subunit processome complex which is required for
           processing of pre-18S rRNA
          Length = 513

 Score =  316 bits (810), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 174/414 (42%), Positives = 257/414 (62%), Gaps = 22/414 (5%)

Query: 4   IEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLE---LVSFSPFKGAA 60
           + Y+L E   GYA+ K   ++    S L      I D  S  K+L+   + +FS F  AA
Sbjct: 1   MAYVLTETSAGYALLKASDKKIYKSSTL------IKDLNSSEKVLKEFKIAAFSKFSSAA 54

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSK-KQSVTLGISDKNLGPSIKEVFPYVDCFS 119
           +ALE AN I EG +S  L+     NL K +K  +  TL +S+  L  +I ++    +  S
Sbjct: 55  DALEEANSIIEGKVSTQLE-----NLLKEAKADKKATLVVSETKLANAINKLNLNFNVIS 109

Query: 120 NELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179
           + ++ D+ R V+ +  +L  GL   DL +  LGL H+  R K+KFS  K D  IIQAIAL
Sbjct: 110 DAVTLDIYRAVKEYLPELLPGLSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIAL 169

Query: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXX 239
           LD LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  +++ ++         
Sbjct: 170 LDDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGVRSNAADTDMSEILPE 229

Query: 240 XXXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVA 299
                 I ERV   + +SMG +++  D++N+   A ++V+ A YR QL +YL  +M  +A
Sbjct: 230 E-----IEERVKSASEVSMGTEITQVDLDNIKCLADQIVDFAAYREQLSNYLSSRMKAIA 284

Query: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359
           PNL++L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH
Sbjct: 285 PNLTQLVGELVGARLIAHAGSLISLAKAPASTIQILGAEKALFRALKTKHDTPKYGLLYH 344

Query: 360 SGFISKAAAKNKGRISRYLANKCTMASRIDNYSD--EPTNIFGTVLKKQVEQRL 411
           +  + +A  KNKG+I+R LA K  ++ R D  ++  + +   G   + +VE RL
Sbjct: 345 ASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDVGLESRAKVENRL 398

>NDAI0E00550 Chr5 (108986..110557) [1572 bp, 523 aa] {ON} Anc_8.787
          Length = 523

 Score =  316 bits (810), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 174/413 (42%), Positives = 254/413 (61%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLE---LVSFSPFKGAA 60
           + Y+L E   GYA+ K   ++    S L      I D  +  K+L+   + +FS F  AA
Sbjct: 1   MSYVLTETSAGYALLKASDKKIYKSSSL------IQDLDTSDKVLKEFKIAAFSKFSSAA 54

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
            ALE +N I EG +S  L+ +L+    +  K +  TL +S+  L  SI ++    +  S+
Sbjct: 55  NALEESNSIIEGKVSPQLEKLLE----EIKKDKKSTLIVSETKLANSINKLGLNFNVVSD 110

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            ++ D+ R V+ +  +L  GL   DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGLNDSDLNKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+L+L +  ++  SE          
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARLILTMGVRSKASETDMSEILPEE 230

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                I ERV   A +SMG +++  D++N+   A ++V  A YR QL +YL  +M  +AP
Sbjct: 231 -----IEERVKTAAEVSMGTEITQIDLDNIKCLADQIVEFAAYREQLSNYLSARMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSD--EPTNIFGTVLKKQVEQRL 411
             + +A  KNKG+I+R LA K  ++ R D  ++  + +   G   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLEARAKVENRL 398

>Kpol_1010.5 s1010 (13325..14869) [1545 bp, 514 aa] {ON}
           (13325..14869) [1545 nt, 515 aa]
          Length = 514

 Score =  315 bits (808), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 171/413 (41%), Positives = 254/413 (61%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLE---LVSFSPFKGAA 60
           + Y+L E   GYA+ K   ++    S L      I D  S  K+L+   + +FS F  AA
Sbjct: 1   MAYVLTETSAGYALLKASDKKIYKSSSL------IQDLDSSDKVLKEFKIAAFSKFNSAA 54

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
            ALE AN I EG +S  L+ +L+    +  K +  TL +S+  L  +I ++    +  S+
Sbjct: 55  NALEEANSIIEGKVSPQLQKLLE----EAKKDKKSTLVVSETKLANAINKLGLNFNVVSD 110

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            ++ D+ R V+ +   L  GL   DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPDLLPGLNDTDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++  ++          
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILAMGVRSKCADTDLSEILPEE 230

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                + ERV   A +SMG +++  D++N+   A ++V+ A YR QL +YL  +M  +AP
Sbjct: 231 -----VEERVKTAAEVSMGTEITETDLDNIKALADQIVDFAAYREQLSNYLSSRMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSD--EPTNIFGTVLKKQVEQRL 411
             + +A  KNKG+I+R LA K  ++ R D  ++  + +   G   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLEARAKVENRL 398

>NCAS0B00870 Chr2 complement(133660..135207) [1548 bp, 515 aa] {ON}
           Anc_8.787
          Length = 515

 Score =  314 bits (804), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 172/413 (41%), Positives = 254/413 (61%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLE---LVSFSPFKGAA 60
           + Y+L E   GYA+ K   ++    S L      I D  +  K+L+   + +FS F  AA
Sbjct: 1   MSYVLTETSAGYALLKASDKKIYKSSSL------IQDLDTSDKVLKEFKIAAFSKFNSAA 54

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
            ALE AN I EG +S  L+ +L+    +  K +  TL +S+  L  +I ++    +  S+
Sbjct: 55  NALEEANSIIEGKVSPQLEKLLE----EIKKDKKSTLIVSETKLANAINKLGLNFNVVSD 110

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            ++ D+ R V+ +  +L  GL   DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGLNDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++  ++          
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKAADTDMSEILPEE 230

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                I ERV   A +SMG +++  D+EN+   A ++V  A YR QL +YL  +M  +AP
Sbjct: 231 -----IEERVKTAAEVSMGTEITQLDLENIKCLADQIVEFAAYREQLSNYLSARMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSDEPTNI--FGTVLKKQVEQRL 411
             + +A  KNKG+I+R LA K  ++ R D  +++  +    G   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSIRYDALAEDRDDAGDIGLESRAKVENRL 398

>KLLA0F08613g Chr6 complement(801623..803158) [1536 bp, 511 aa] {ON}
           similar to uniprot|Q12499 Saccharomyces cerevisiae
           YOR310C NOP58 Protein involved in pre-rRNA processing
           18S rRNA synthesis and snoRNA synthesis component of the
           small subunit processome complex which is required for
           processing of pre-18S rRNA
          Length = 511

 Score =  312 bits (799), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 170/413 (41%), Positives = 254/413 (61%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLL---ELVSFSPFKGAA 60
           + Y+L E   GYA+ K   ++    S L      I D  S  K+L   ++ +FS F  AA
Sbjct: 1   MAYVLTETSAGYALLKASDKKIYKSSSL------IQDLNSSDKVLNQFKIAAFSKFSSAA 54

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
            ALE AN + +G +S  L+ +L+    +    +  TL +S+  L  +I ++    +  S+
Sbjct: 55  NALEEANSVIDGKVSSQLEKLLE----ECKTDKKATLVVSETKLANAINKLGLNFNVVSD 110

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            ++ D+ R V+ +  +L  GL   DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGLNDQDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  + + +E          
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRVNAAETDMSEILPEE 230

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                I ERV   A +SMG +++  D+ N+   A+++V  A YR QL +YL  +M  +AP
Sbjct: 231 -----IEERVKTAAEVSMGTEITPVDLINIKCLAEQIVEFAAYREQLSNYLSSRMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSD--EPTNIFGTVLKKQVEQRL 411
             + +A+ KNKG+I+R LA K  ++ R D  ++  + +   G   + +VE RL
Sbjct: 346 SLVGQASGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVESRL 398

>Kwal_34.15894 s34 (102368..103906) [1539 bp, 512 aa] {ON} YOR310C
           (NOP58) - 57 kDa nucleolar protein [contig 272] FULL
          Length = 512

 Score =  303 bits (777), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 178/413 (43%), Positives = 256/413 (61%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLE---LVSFSPFKGAA 60
           + Y+L E   GYA+ K   ++    S L      I D  S  K+L+   + +FS F  AA
Sbjct: 1   MAYVLTETSAGYALLKASDKKIYKSSSL------IQDLNSSDKVLKQFKIAAFSKFGSAA 54

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
           EALE AN I EG +S  L+ +L  +  K  KK   TL +S+  L  +I ++    +  S+
Sbjct: 55  EALEEANAIVEGKVSNQLQKLL--SESKADKK--ATLVVSETKLANAINKLGLNFNVVSD 110

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            ++ D+ R V+ +  +L  G+   DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIFRAVKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  FA+++L +  +++ +E          
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAFARIILTMGVRSNAAETDLSEILPEE 230

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                I ERV   A ISMG +++S D++N+   A ++   A YR QL +YL  +M  +AP
Sbjct: 231 -----IEERVKSAAEISMGTEITSVDLDNIKSLATQITEFAAYREQLSNYLSARMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHAGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSD--EPTNIFGTVLKKQVEQRL 411
             + +A  KNKG+I+R LA K  ++ R D  ++  + +   G   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRSKVESRL 398

>Ecym_1489 Chr1 complement(1006523..1008067) [1545 bp, 514 aa] {ON}
           similar to Ashbya gossypii AFR328C
          Length = 514

 Score =  303 bits (776), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 171/413 (41%), Positives = 253/413 (61%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLE---LVSFSPFKGAA 60
           + Y+L E   GYA+ K          ++ +    IND  S   +L+   + +FS F  AA
Sbjct: 1   MAYVLTETAAGYALLKAS------DKKIYKSATLINDLKSSESVLKQFKIAAFSKFSSAA 54

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
            ALE AN + EG +S  L+ +LD    +    +  TL +S+  LG +I ++    +   +
Sbjct: 55  NALEEANAVIEGKVSSQLQKLLD----EAKTDKKATLVVSETKLGNAINKLGLNFNVVCD 110

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            ++ D+ R V+ +  +L  GL   DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGLSGDDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  FA+++L +  +++ ++          
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAFARIILTMGVRSNAADTDLSEVLPEE 230

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                + ERV   A +SMG +++  D++N+   A+++V  A YR QL  YL  +M  +AP
Sbjct: 231 -----VEERVKAAAEVSMGTEITPIDLDNIKCLAEQIVEFAAYREQLSSYLSSRMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL+ L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTNLVGELVGARLIAHAGSLISLAKAPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSD--EPTNIFGTVLKKQVEQRL 411
             + +A  KNKG+I+R LA K  ++ R D  ++  + +  FG   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGEFGLESRAKVENRL 398

>AFR328C Chr6 complement(1032025..1033566) [1542 bp, 513 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR310C
           (NOP58)
          Length = 513

 Score =  302 bits (773), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 173/413 (41%), Positives = 254/413 (61%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLE---LVSFSPFKGAA 60
           + Y+L E   GYA+ K   ++    S L      + D  S   +L+   + +FS F  AA
Sbjct: 1   MAYVLTETAAGYALLKASDKKIYKSSSL------VQDLKSSENVLKQFKVAAFSKFASAA 54

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
            ALE AN + EG +S  L+ +L     K  KK   TL +S+  L  +I ++    +   +
Sbjct: 55  NALEEANSVIEGKVSSQLEKLL--AEAKSDKKS--TLVVSETKLANAINKLGLNFNVVCD 110

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            ++ D+ R V+ +  +L  G+  GDL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGMTDGDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  FA+++L +  +++ +E          
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAFARIILTMGVRSNAAETDMSEILPEE 230

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                I ERV   A +SMG +++  D++N+   A+++V  A YR QL +YL  +M  +AP
Sbjct: 231 -----IEERVKSAAEVSMGTEITQVDLDNIKSLAEQIVEFAAYREQLSNYLSSRMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHAGSLVSLAKAPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSD--EPTNIFGTVLKKQVEQRL 411
             + +A  KNKG+I+R LA K  ++ R D  ++  + +   G   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLEARAKVESRL 398

>CAGL0I09790g Chr9 complement(935016..936557) [1542 bp, 513 aa] {ON}
           highly similar to uniprot|Q12499 Saccharomyces
           cerevisiae YOR310c
          Length = 513

 Score =  300 bits (769), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 173/413 (41%), Positives = 255/413 (61%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLE---LVSFSPFKGAA 60
           + Y+L E   GYA+ K   ++    S L      I D  S  K+L+   + +FS F  AA
Sbjct: 1   MSYVLTETSAGYALLKASDKKIYKSSSL------IMDLDSSEKVLKEFKIAAFSKFNSAA 54

Query: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120
            ALE A+ I EG +S  L+ +LD    +  K++  TL +S+  L  +I ++    +  S+
Sbjct: 55  NALEEASAIIEGKVSPQLEKLLD----EIKKEKKATLIVSETKLANAINKLGLNFNVVSD 110

Query: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            ++ D+ R V+ +   L  G+   DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPDLLPGMSDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXX 240
           D LDK++NT++MR KEWYGWHFPELAK+V D+  +A+L+L +  ++  +E          
Sbjct: 171 DDLDKEVNTYSMRCKEWYGWHFPELAKIVTDSVAYARLILTMGVRSKAAETDMSEILPEE 230

Query: 241 XXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300
                I ERV   A +SMG +++  D+ N+   A ++V  A YR QL +YL  +M  +AP
Sbjct: 231 -----IEERVKAAAEVSMGTEITDVDLINIRALADQIVEFAAYREQLSNYLSSRMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHAGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSD--EPTNIFGTVLKKQVEQRL 411
             + +A+ +NKG+I+R LA K  +A R D  ++  + +   G  ++ +VE RL
Sbjct: 346 SLVGQASGRNKGKIARVLAAKAAVALRYDALAEDRDDSGDIGLEVRAKVENRL 398

>KNAG0B01140 Chr2 complement(210529..212007) [1479 bp, 492 aa] {ON}
           Anc_3.429 YGR091W
          Length = 492

 Score = 70.1 bits (170), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 96/209 (45%), Gaps = 4/209 (1%)

Query: 185 KDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXXXXXX 244
           +DI      +   Y   F EL  L+P+  N+A +V  ++     +               
Sbjct: 132 RDIENLHTFMIMQYRKKFLELDSLLPNPVNYADVVFVLETMQDRNSNELATIFESELLLK 191

Query: 245 XIAERVMD-NARISMGQDLSSADMENVCIFAQRVV--NLADYRRQLYDYLCEKMHTVAPN 301
                V+  + + S+ QD++   +  + +F  R +   L+D+R ++   +  K+H +APN
Sbjct: 192 KEQTLVLTLSIKTSLRQDVTLEKLIQIRLFRARAMIRQLSDHRERIVKLVESKIHIIAPN 251

Query: 302 LSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTPKYGLIYHS 360
           L+ L+G    + L+ HAGS+  LS   +  +  +G ++ L   L T      + G IYH 
Sbjct: 252 LTALVGAETCSYLVGHAGSVVALSLIPSCNLSSIGKKRHLSHELHTNISGVRQEGAIYHC 311

Query: 361 GFISKAAAKNKGRISRYLANKCTMASRID 389
             + +    ++ ++ R +  K ++A+R+D
Sbjct: 312 ALVREQPVTHRKQMLRMVCAKVSLAARVD 340

>TDEL0F03110 Chr6 (568933..570237) [1305 bp, 434 aa] {ON} Anc_3.429
           YGR091W
          Length = 434

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 104/240 (43%), Gaps = 9/240 (3%)

Query: 178 ALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXX 237
           AL   L  +I       K  Y   F EL  LVPD   + +++  I++    S        
Sbjct: 76  ALSSILQGEIRLLHDYTKILYRQRFAELESLVPDPVKYVEVISIIEEDEQASSERFERDA 135

Query: 238 XXXXXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLA--DYRRQLYDYLCEKM 295
                   +   +M + + S+ Q+    D E   +   R   LA    R ++  Y+ +++
Sbjct: 136 KLSKEQILV---LMMSMKTSIRQERQITDGERAVLLRARSYMLAIVSVRDKVNGYVVQRV 192

Query: 296 HTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTPKY 354
             +APNL  LIG  I + L+SH G +  LS+  +  +  +G  K L   L T      + 
Sbjct: 193 SHIAPNLCALIGPEITSLLLSHFGGILELSQAPSCNLASIGKNKHLTHELHTSLTGVRQE 252

Query: 355 GLIYHSGFISKAAAKNKGRISRYLANKCTMASRID---NYSDEPTNIFGTVLKKQVEQRL 411
           G IY S  +     +   ++ R +  K ++A+R+D   N S E  ++ G   ++++ +++
Sbjct: 253 GYIYRSQLVQDQPPQYHKQMLRMVCAKISLAARVDAGINSSQESDSLLGDKWRREIMEKV 312

>ZYRO0C12386g Chr3 (978158..979492) [1335 bp, 444 aa] {ON} similar
           to uniprot|P49704 Saccharomyces cerevisiae YGR091W PRP31
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 444

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 54/226 (23%), Positives = 96/226 (42%), Gaps = 13/226 (5%)

Query: 169 NDNHIIQAIALLDQL----DKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKD 224
           ND  + Q + +L+ L      +I      +K  YG  F EL  LVP    FA ++  I+ 
Sbjct: 73  NDEDLAQTLTILNSLTYIAQNEITVLHNLLKLIYGVKFGELESLVPQPQQFADVIRIIET 132

Query: 225 KTSLSEXXXXXXXXXXXXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYR 284
                E                   V++ +  S  Q   + D + V      ++ ++  R
Sbjct: 133 NEGNFETDAQLSKEQVL--------VLNMSMKSSFQAHVNVDKDKVLQLRDLLMTVSRIR 184

Query: 285 RQLYDYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRA 344
            ++  ++  K   VAPNL  LIG  + + L+SH+G +  LS+  +  +  +G  K L   
Sbjct: 185 NEINSFILSKASLVAPNLCLLIGPEVTSLLLSHSGGVLELSQVPSCNLASIGKNKHLSHE 244

Query: 345 LKTK-GNTPKYGLIYHSGFISKAAAKNKGRISRYLANKCTMASRID 389
           L T      + G IY S  + +   + + ++ R +  K  +A+R+D
Sbjct: 245 LHTNLTGVRQEGYIYRSSLVQEQPLEFRKQMLRMVCAKVALAARVD 290

>TPHA0D03930 Chr4 (823320..824735) [1416 bp, 471 aa] {ON} Anc_3.429
           YGR091W
          Length = 471

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 108/243 (44%), Gaps = 35/243 (14%)

Query: 170 DNHIIQAIALLDQLDKDI-----NTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKD 224
           +N I++  ++L++  K I     N FA  +K  Y   FPEL  L+ +  +F +++  +++
Sbjct: 90  ENGIVEVASILNKYSKIIQEESSNVFAY-IKILYKPRFPELETLLTNPIDFIEVLKLLEE 148

Query: 225 KTSLSEXXXXXXXXXXXXXXXIAERVMDNARISMGQDLSSADMENVC-----IFAQ---- 275
             +                  IA  + + + IS  + L        C     IF +    
Sbjct: 149 NIT-----------EISNDDYIATLLENESNISSEKRLVVIMSIKTCFNSSFIFTEDARG 197

Query: 276 ------RVVN-LADYRRQLYDYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQA 328
                  ++N L + + +   YL  K+ T+APNLS LIG  I + LISH GS+  LSK  
Sbjct: 198 KLSSVLELLNILMNSKTEAVQYLSSKIGTIAPNLSTLIGTSIASLLISHTGSILELSKVP 257

Query: 329 ASTVQILGAEKALFRA--LKTKGNTPKYGLIYHSGFISKAAAKNKGRISRYLANKCTMAS 386
           +  +  +G +K    A  + +     + G IY+S  I         ++ R L  K ++A+
Sbjct: 258 SCNLASIGKKKYSSSAQHITSVSGVRQEGYIYNSELIQNMPISTHKQLLRMLCAKVSLAA 317

Query: 387 RID 389
           R+D
Sbjct: 318 RVD 320

>KAFR0K01530 Chr11 (319205..320725) [1521 bp, 506 aa] {ON} Anc_3.429
           YGR091W
          Length = 506

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 61/114 (53%), Gaps = 1/114 (0%)

Query: 277 VVNLADYRRQLYDYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILG 336
           ++ L + R  +  Y+  K++ +APNL  L+G  I A L+SHAG +  LS+     +  +G
Sbjct: 214 IITLDELRHTIASYISSKVYHIAPNLCALLGSEITALLVSHAGDILQLSQVPNCNLASIG 273

Query: 337 AEKALFRALKTKGN-TPKYGLIYHSGFISKAAAKNKGRISRYLANKCTMASRID 389
            +K L   L T  +   + G IY+S  + +    ++ ++ R L  K  +A+R+D
Sbjct: 274 KKKHLSHELHTTASGVRQEGYIYNSELVQETPVGSRKQMLRMLCAKVALAARVD 327

>ADR032W Chr4 (763161..764480) [1320 bp, 439 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR091W (PRP31)
          Length = 439

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/203 (22%), Positives = 87/203 (42%), Gaps = 26/203 (12%)

Query: 202 FPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXXXXXXXIAERVMDNARISMGQD 261
           FPELA+LVP    + +++  ++    L E                A R  D AR      
Sbjct: 93  FPELAELVPSQRTYVRVLRALETGAPLDELLTREQAMLVAMTRPQAPRA-DPAR------ 145

Query: 262 LSSADMENVCIFAQRVVNLADYRRQLYD-------YLCEKMHTVAPNLSELIGEVIGARL 314
                      + + +   AD   QL+        ++  + H +AP ++ L+G V+ A L
Sbjct: 146 -----------WPRELAPHADRHEQLHTAVDAIDAHIVRQAHRLAPTVTALVGPVVAAAL 194

Query: 315 ISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKY-GLIYHSGFISKAAAKNKGR 373
           +SHAGS+  L++  A  +  +GA +    A +T  +  +  G ++ +  + +     + +
Sbjct: 195 LSHAGSVRELAQVPACNLAAIGAPRHAAHARRTDASGVRLRGHVWDTPLVQEQPPALQRQ 254

Query: 374 ISRYLANKCTMASRIDNYSDEPT 396
             R L  +  +A+R+D  + +P 
Sbjct: 255 ALRMLCARLALAARVDASAPDPA 277

>YGR091W Chr7 (666341..667825) [1485 bp, 494 aa] {ON}  PRP31Splicing
           factor, component of the U4/U6-U5 snRNP complex
          Length = 494

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 88/201 (43%), Gaps = 12/201 (5%)

Query: 198 YGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXXXXXXXIAERVMDNARIS 257
           Y   FPEL+ L+P    ++K++  ++++                      E+++    ++
Sbjct: 120 YSRRFPELSSLIPSPLQYSKVISILENENYSKNESDELFFHLENKAKLTREQIL---VLT 176

Query: 258 MGQDLSSADMENVCIFAQRVV--------NLADYRRQLYDYLCEKMHTVAPNLSELIGEV 309
           M    S  + E + I  +  +        NL   +  +  Y+  K+  +APN+  L+G  
Sbjct: 177 MSMKTSFKNKEPLDIKTRTQILEANSILENLWKLQEDIGQYIASKISIIAPNVCFLVGPE 236

Query: 310 IGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKT-KGNTPKYGLIYHSGFISKAAA 368
           I A+LI+HAG +   S+  +  +  +G  K L   L T +    + G ++ S  I K   
Sbjct: 237 IAAQLIAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFASDMIQKFPV 296

Query: 369 KNKGRISRYLANKCTMASRID 389
               ++ R L  K ++A+R+D
Sbjct: 297 SVHKQMLRMLCAKVSLAARVD 317

>TBLA0C02320 Chr3 complement(549057..550592) [1536 bp, 511 aa] {ON}
           Anc_3.429 YGR091W
          Length = 511

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 51/215 (23%), Positives = 96/215 (44%), Gaps = 9/215 (4%)

Query: 183 LDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIK-----DKTSLSEXXXXXXX 237
           +++DI      VK  Y   FPEL  L+ +   F  ++  ++     +K   S+       
Sbjct: 133 INEDIKLLHSYVKANYQKRFPELESLITNPIQFIDVIRLLESLNNPNKNEESQLEIRLEK 192

Query: 238 XXXXXXXXIAERVMDNARISMGQDLS-SADMENVCIFAQRVVN-LADYRRQLYDYLCEKM 295
                   I   +M + + S  ++   S  + N  I A  +++ L  ++ ++  ++ +K+
Sbjct: 193 ETTLQKEQILVIIM-SVKTSFNKEYQFSNTLRNNLIKASNLISQLWQFKEEINSFVTKKI 251

Query: 296 HTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTPKY 354
             +APNL  LIG  I + L++++G L NL    +  +  +G  K L   L +      + 
Sbjct: 252 SDIAPNLCALIGPYITSLLVAYSGGLANLCSVPSCNLASIGKNKHLSHELHSNLSGVRQN 311

Query: 355 GLIYHSGFISKAAAKNKGRISRYLANKCTMASRID 389
           G +Y+S  I    A    ++ R L  K  +ASR+D
Sbjct: 312 GYLYNSELIQSQPANLHKQLLRILCAKVALASRVD 346

>NDAI0G01290 Chr7 complement(284145..285635) [1491 bp, 496 aa] {ON}
           Anc_3.429 YGR091W
          Length = 496

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 57/114 (50%), Gaps = 1/114 (0%)

Query: 277 VVNLADYRRQLYDYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILG 336
           +  L+  +  +  Y+   +  +APNL  LIG  I A LISHAGS+ +LS+  +  +  +G
Sbjct: 213 ITTLSALQELITHYITSNISHIAPNLCALIGSQIAALLISHAGSILDLSQIPSCNLASIG 272

Query: 337 AEKALFRALKTK-GNTPKYGLIYHSGFISKAAAKNKGRISRYLANKCTMASRID 389
             K     L T      + G IY    I    ++N  ++ R +  K ++A+R+D
Sbjct: 273 KSKHQSHELHTSLSGVRQEGYIYDCDLIQDQPSENHKQMLRMVCAKASLAARVD 326

>Kwal_23.3995 s23 complement(517426..518850) [1425 bp, 474 aa] {ON}
           YGR091W (PRP31) - pre-mRNA splicing protein [contig 255]
           FULL
          Length = 474

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 70/151 (46%), Gaps = 1/151 (0%)

Query: 262 LSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAPNLSELIGEVIGARLISHAGSL 321
           L++ D   V   A  ++ L D R ++  Y+   +  VAPNL  L+G  I A LI+ AG L
Sbjct: 174 LTAEDSRLVIQTADVLLELCDIRDKIERYVASLVSDVAPNLCILVGSQIAASLIAVAGGL 233

Query: 322 TNLSKQAASTVQILGAEKALFRALKTKGN-TPKYGLIYHSGFISKAAAKNKGRISRYLAN 380
           + LS+  +  +  +G  K       T  +   + G IY S  +S      + +  R +  
Sbjct: 234 SELSEIPSCNLSSIGKTKNSSHTSDTDASGVRQKGYIYQSDLVSGQPVSFQKQALRMVCA 293

Query: 381 KCTMASRIDNYSDEPTNIFGTVLKKQVEQRL 411
           K ++ +R D     P+   G   K+QV ++L
Sbjct: 294 KVSLCARADRSKSCPSGTLGAKWKEQVLEKL 324

>Suva_7.374 Chr7 (641967..643508) [1542 bp, 513 aa] {ON} YGR091W
           (REAL)
          Length = 513

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/201 (20%), Positives = 91/201 (45%), Gaps = 12/201 (5%)

Query: 198 YGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXXXXXXXIAERVMDNARIS 257
           Y   FPEL+ L+P    ++K+V  ++++                      E+++    ++
Sbjct: 139 YKERFPELSSLIPSPLQYSKVVTILENENWSGNESDKLSIHLENKANLTKEQLL---VLT 195

Query: 258 MGQDLSSADMENVCIFAQRVV--------NLADYRRQLYDYLCEKMHTVAPNLSELIGEV 309
           M    S  + + +    +++V        NL + ++ +  Y+  K+  +APN+  L+G  
Sbjct: 196 MSLKTSFNNQKPLVGDTKKLVFEAGSMLNNLWELQKDVGQYITSKISLIAPNMCFLVGSE 255

Query: 310 IGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKT-KGNTPKYGLIYHSGFISKAAA 368
           + A+L++HAG +   S+  +  +  +G  K L   L T +    + G ++++  I     
Sbjct: 256 VTAQLLAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFNTELIQDFPI 315

Query: 369 KNKGRISRYLANKCTMASRID 389
               ++ R L  K T+A+R+D
Sbjct: 316 AIHRQMLRILCAKVTLAARVD 336

>Kpol_1018.138 s1018 complement(368322..369803) [1482 bp, 493 aa]
           {ON} complement(368322..369803) [1482 nt, 494 aa]
          Length = 493

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/240 (21%), Positives = 95/240 (39%), Gaps = 19/240 (7%)

Query: 183 LDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSE--------XXXX 234
           + ++I+ F    K  Y + F EL  L P    FAK +  I+     S+            
Sbjct: 124 IQEEISCFYEYSKHIYKFKFFELETLAPTAVQFAKTIQLIETMDDFSQHDLLSSKLETEI 183

Query: 235 XXXXXXXXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEK 294
                      IA +   N   S    + ++  +    F   ++     ++++  ++   
Sbjct: 184 LLTKEQVLVLIIAMKTSLNKEYSFEGSMKTSLKQ----FTDIIIQHDLLKKEITTFIESN 239

Query: 295 MHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTPK 353
           + T+APNL  L+G  I + LI HAG +  LS+  +  +  +G  K      +T      +
Sbjct: 240 IITIAPNLCALVGSEITSLLIGHAGGILELSQIPSCNLASVGKNKYFSHERQTNLSGVRQ 299

Query: 354 YGLIYHSGFISKAAAKNKGRISRYLANKCTMASRID------NYSDEPTNIFGTVLKKQV 407
            G IY+S  I         ++ R L  K ++A+R+D        S EP    G   ++++
Sbjct: 300 EGYIYNSELIQSQPVDYHKQLLRMLCAKISLAARVDTSVKISTSSTEPAAFLGQKWREEI 359

>Skud_7.390 Chr7 (650643..652130) [1488 bp, 495 aa] {ON} YGR091W
           (REAL)
          Length = 495

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/221 (20%), Positives = 95/221 (42%), Gaps = 12/221 (5%)

Query: 178 ALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXX 237
           A++  +  DI +    +   YG  FPEL+ L+P +  ++K+   ++ +            
Sbjct: 101 AIIPLIKSDIKSLHNFLILLYGKRFPELSSLIPSSLQYSKVASILESEHWSKNESDKLSP 160

Query: 238 XXXXXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVV--------NLADYRRQLYD 289
                     E+V+    ++M    S  + E + I  ++ +        NL   +  +  
Sbjct: 161 LLENEANLTKEQVL---VLTMSMKTSFNNKEPLDIGTRKQISEATAMLKNLWVLQEDVGR 217

Query: 290 YLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKT-K 348
           Y+  K+  +APN+  L+G  + A+L+++AG +   S+  +  +  +G  K L   L T  
Sbjct: 218 YVASKISVIAPNMCLLVGPEVAAQLLAYAGGVLEFSRIPSCNIASIGKNKHLSHELHTLA 277

Query: 349 GNTPKYGLIYHSGFISKAAAKNKGRISRYLANKCTMASRID 389
               + G I+ +  I         ++ R +  K T+A+R+D
Sbjct: 278 SGVRQEGYIFSTDLIQNFPLAIHKQMLRMICAKVTLAARVD 318

>Smik_6.177 Chr6 (289760..291208) [1449 bp, 482 aa] {ON} YGR091W
           (REAL)
          Length = 482

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/209 (22%), Positives = 89/209 (42%), Gaps = 11/209 (5%)

Query: 198 YGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXXXXXXXIAERVMDNARIS 257
           Y   FPEL+ L+P    ++K+++ ++ +                      E+V+    +S
Sbjct: 120 YKERFPELSTLIPSPLQYSKVIILLEGEDWQKSEIDKLFPQLENIAHLSKEQVL-VLTMS 178

Query: 258 MGQDLSSADMENVCIFAQRVV------NLADYRRQLYDYLCEKMHTVAPNLSELIGEVIG 311
           M     S +  N     Q +       NL   +  L  Y+  K+  +APN+  L+G  + 
Sbjct: 179 MRTSFKSKEPLNFQTRTQILETNTILENLWQIQADLEQYIASKISLIAPNMCFLVGSEVT 238

Query: 312 ARLISHAGSLTNLSKQAASTVQILGAEKALFRALKT-KGNTPKYGLIYHSGFISKAAAKN 370
           A+L+++AG +   S+  +  +  +G  K L   L T +    + G ++ +  I       
Sbjct: 239 AQLLAYAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFTTDLIQSFPVAI 298

Query: 371 KGRISRYLANKCTMASRID---NYSDEPT 396
             ++ R L  K T+A+R+D    Y D+ T
Sbjct: 299 HKQMLRMLCAKVTLAARVDAGQRYDDKNT 327

>NCAS0E01160 Chr5 complement(219669..221108) [1440 bp, 479 aa] {ON}
           Anc_3.429 YGR091W
          Length = 479

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/258 (19%), Positives = 104/258 (40%), Gaps = 21/258 (8%)

Query: 179 LLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXX 238
           L  Q+ ++I+      K  Y   F EL  +    Y +AK+       TSL E        
Sbjct: 118 LSHQIRREIDILYQYSKNIYSTRFTELDTIAATPYQYAKV-------TSLIEGTSDDKAG 170

Query: 239 XXXXXXXIAERVMDNARISMGQDLSSADMENVCI----------FAQRVVNLADYRRQLY 288
                  I  ++     + +   + ++ ++N  +              ++ L D +  + 
Sbjct: 171 QLPINIEIEAKLSKEQVLVLRMSMQTSFLKNKPLEKKVKHLLLEACSMIIQLTDLQNVIL 230

Query: 289 DYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK 348
            Y+   +  +APNL  L+G  + + LI+H G +  L++  +  +  +G  + L   L T 
Sbjct: 231 QYISSNVSDIAPNLCVLVGPEVASLLIAHTGGILQLAEIPSCNLASIGKNRHLSHELHTT 290

Query: 349 -GNTPKYGLIYHSGFISKAAAKNKGRISRYLANKCTMASRID--NYSDEPTNIFGTVLKK 405
                + G IY S  +     +N  ++ R +  K  +A+R+D         ++ G   ++
Sbjct: 291 LSGVRQEGYIYSSELVQNQPIQNHKQMLRMVCAKVALAARVDAGQRGAAKNDLLGQRWRE 350

Query: 406 QVEQRLEFYTTGHPTLKN 423
           ++E +++   T  P + N
Sbjct: 351 ELETKIQ-KVTESPNISN 367

>Ecym_4449 Chr4 complement(919492..920880) [1389 bp, 462 aa] {ON}
           similar to Ashbya gossypii ADR032W
          Length = 462

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 67/138 (48%), Gaps = 6/138 (4%)

Query: 290 YLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKAL--FRALKT 347
           Y+ +KMHT+APN+  L+G+ + A L+++ G +  LS+  +  +  +G  K L   + L T
Sbjct: 185 YISKKMHTIAPNVCALVGQEVAAALLTYTGGMKELSEIPSCNLASIGKTKHLSHVQQLDT 244

Query: 348 KGNTPKYGLIYHSGFISKAAAKNKGRISRYLANKCTMASRID--NYSDEPTNIFGTVLKK 405
            G   K G I+    +       + +  R +  K  +ASR+D  ++ +      G   K+
Sbjct: 245 SGVRQK-GYIFDCELVQSQPEALQKQALRMICAKLALASRVDYLHHQENTHGSLGATWKE 303

Query: 406 QVEQRLEFYTTGHPTLKN 423
           ++  +L      HP + N
Sbjct: 304 EILDKLN-KIQDHPNIAN 320

>SAKL0F06050g Chr6 (454404..455825) [1422 bp, 473 aa] {ON} similar
           to uniprot|P49704 Saccharomyces cerevisiae YGR091W PRP31
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 473

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/221 (19%), Positives = 94/221 (42%), Gaps = 9/221 (4%)

Query: 194 VKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXXXXXXXXXXXXXXXIAERVMDN 253
           +K  Y   F EL  LV    +++KL+ F++  TS +                I    M  
Sbjct: 113 IKSLYSKKFSELDSLVNPPRSYSKLIKFLE--TSDARDLSTLEGILSKEQILIVSMSM-- 168

Query: 254 ARISMGQDLSSADMENVCIFA--QRVVNLADYRRQLYDYLCEKMHTVAPNLSELIGEVIG 311
            +    +DL+    E   +      ++ L D + ++  ++  ++  +APN+  ++G  + 
Sbjct: 169 -KTGFKRDLALPSDEKTYLLTAIDMLIQLYDLQDEITSFIASQVINIAPNVCAIVGPQVA 227

Query: 312 ARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTPKYGLIYHSGFISKAAAKN 370
           ++++S AG L  LS+  +  +  +G ++ +   + T      + G +Y    I       
Sbjct: 228 SKILSAAGGLLELSQVPSCNLASIGKDRYMSHEINTDMSGVRQRGYVYSCSLIQDQPPHV 287

Query: 371 KGRISRYLANKCTMASRIDNYSDEPTNIFGTVLKKQVEQRL 411
             +  R +  K ++A+R+D  S+   N  G     ++ ++L
Sbjct: 288 HKQALRMVCAKVSLAARVD-ISNNKDNSLGVKWANEISEKL 327

>KLLA0D14883g Chr4 (1254381..1255784) [1404 bp, 467 aa] {ON} weakly
           similar to uniprot|P49704 Saccharomyces cerevisiae
           YGR091W PRP31 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 467

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/220 (21%), Positives = 96/220 (43%), Gaps = 12/220 (5%)

Query: 172 HIIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLV-LFIKDKTSLSE 230
           ++I+   L+   D +++     + + Y   FP L  +VP+   +  +V +  +D  ++  
Sbjct: 88  NVIKLGQLMPLFDTELSMVFQCIVDTYKAKFPGLETIVPERKQYVDVVKMLQQDIPNVQL 147

Query: 231 XXXXXXXXXXXXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDY 290
                          +     + ARI   +DL S  +    I       L + R  +  Y
Sbjct: 148 DQVLSKEETLVVSMSLKTDFKEGARID--KDLLSKAIHWFDI-------LYNLRDNVSHY 198

Query: 291 LCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALF-RALKTKG 349
           +  ++  VAPNL  L+G    A+L++H GS+  LS   +  +  +G +K L  ++L   G
Sbjct: 199 VETRIQMVAPNLCALLGPDTAAKLVTHCGSVKELSVVPSCNLASIGQDKTLHGKSLDISG 258

Query: 350 NTPKYGLIYHSGFISKAAAKNKGRISRYLANKCTMASRID 389
              K G ++++  +     + + +  R ++ K  +A+R D
Sbjct: 259 VRQK-GYLFYTDVVQTQPPEFQKQALRMVSAKVALAARAD 297

>KLTH0F12034g Chr6 complement(1015072..1016646) [1575 bp, 524 aa]
           {ON} weakly similar to uniprot|P49704 Saccharomyces
           cerevisiae YGR091W PRP31 Splicing factor component of
           the U4/U6-U5 snRNP complex
          Length = 524

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 55/240 (22%), Positives = 95/240 (39%), Gaps = 12/240 (5%)

Query: 173 IIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEXX 232
           I Q ++LL +L          +   Y   FPEL  L+    ++AK+V  ++ K       
Sbjct: 139 IQQEVSLLRKL----------IASIYDQKFPELESLIASANSYAKVVRLLETKGGGKLEL 188

Query: 233 XXXXXXXXXXXXXIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLC 292
                        +    M         +L+  D E +      ++ L D +  +  Y+ 
Sbjct: 189 QELQDTISREQLLVLSMAMHTG-FRQETNLAPKDSELLMDSINVLLELCDLQDSIAQYVA 247

Query: 293 EKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALK-TKGNT 351
             +  VAPNL  L+G    A LI+ AG L  LS+  +  +  +G  K +   L   +   
Sbjct: 248 SLISQVAPNLCALVGPATSAALIAAAGGLLELSEMPSCNLASIGNSKRISSELDFHESGV 307

Query: 352 PKYGLIYHSGFISKAAAKNKGRISRYLANKCTMASRIDNYSDEPTNIFGTVLKKQVEQRL 411
            + G IYHS  +S      + +  R +  K ++  R+D   + P    G   ++ V +RL
Sbjct: 308 RQRGHIYHSSLVSGQPVTIQKQALRMVCAKVSLCVRVDVSKNSPGGELGLKWRQDVLKRL 367

>CAGL0G03025g Chr7 (280230..281669) [1440 bp, 479 aa] {ON} similar
           to uniprot|P49704 Saccharomyces cerevisiae YGR091w PRP31
           pre-mRNA splicing protein
          Length = 479

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 61/124 (49%), Gaps = 4/124 (3%)

Query: 291 LCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGN 350
           +  ++  +APNL  L+G    + L+SH G L  LSK  +  +  +G +      +    N
Sbjct: 229 IANRIGEIAPNLCALLGTNTASLLVSHTGGLLQLSKIPSCNIANIGKKNTKDHNILNFSN 288

Query: 351 TPKYGLIYHSGFISKAAAKNKGRISRYLANKCTMASRIDN--YSDEPTNIFGTVLKKQVE 408
               G I+ +  +     +N  ++ R L++K ++A+R+D    + +  N  G   + ++E
Sbjct: 289 PG--GYIFQNELVQNQPIENHKQMMRMLSSKVSLAARVDAGLKTGDKNNKLGKQWRVEIE 346

Query: 409 QRLE 412
           ++++
Sbjct: 347 EKIK 350

>Kwal_33.14920 s33 complement(871727..873694) [1968 bp, 655 aa] {ON}
           YMR061W (RNA14) - component of the cleavage and
           polyadenylation factor CF I involved in pre-mRNA 3'-end
           processing [contig 396] FULL
          Length = 655

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 33/75 (44%), Gaps = 6/75 (8%)

Query: 84  LNLPKGSKKQSVTLGISDKNLGPSIKEVFP-YVDCFSNELSQDLIRGVRLHGEKLFKGLQ 142
           + L +   KQ    G+ D+     + E FP +   ++ ELS DL R    H E L     
Sbjct: 51  VKLFQSQDKQDEARGVLDE-----LHERFPLFSPLWTAELSYDLERDEFSHAESLLTRCL 105

Query: 143 SGDLERAQLGLGHAY 157
           SG LE   LGL   Y
Sbjct: 106 SGSLENNDLGLWFMY 120

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,522,218
Number of extensions: 1665850
Number of successful extensions: 5004
Number of sequences better than 10.0: 69
Number of HSP's gapped: 5106
Number of HSP's successfully gapped: 69
Length of query: 513
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 399
Effective length of database: 40,409,475
Effective search space: 16123380525
Effective search space used: 16123380525
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)