Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F11748g7.352ON1091095549e-75
TDEL0C019607.352ON1071064038e-52
KAFR0L014907.352ON1071064039e-52
NCAS0E028607.352ON1051043961e-50
Suva_10.2957.352ON1141083961e-50
YLR200W (YKE2)7.352ON1141033901e-49
TBLA0E004407.352ON1151073841e-48
NDAI0E044607.352ON1061033733e-47
Skud_12.2647.352ON1141063734e-47
TPHA0F029907.352ON1071073673e-46
Smik_12.2597.352ON1141063657e-46
KNAG0B026107.352ON1191043641e-45
Kpol_530.297.352ON1071063631e-45
Ecym_47217.352ON1071053603e-45
KLLA0D12298g7.352ON1151033562e-44
CAGL0A03971g7.352ON1061003403e-42
ACL146C7.352ON1071033388e-42
SAKL0F11418g7.352ON1151033362e-41
KLTH0H01210g7.352ON1131003258e-40
Kwal_56.246487.352ON1131003231e-39
KAFR0D004301.46ON45629710.24
TDEL0F049208.368ON187966651.4
TPHA0C006908.346ON76152623.8
KNAG0D035204.113ON103072623.9
Ecym_60033.579ON58860614.3
Skud_11.972.440ON127253606.8
TDEL0F037208.245ON57427607.2
KLLA0A00594g5.702ON174865598.3
KAFR0L005907.150ON51940598.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F11748g
         (109 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa] {O...   218   9e-75
TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.35...   159   8e-52
KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa] {O...   159   9e-52
NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.35...   157   1e-50
Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W...   157   1e-50
YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subuni...   154   1e-49
TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352 ...   152   1e-48
NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON} Anc_7....   148   3e-47
Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W...   148   4e-47
TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON...   145   3e-46
Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W...   145   7e-46
KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.35...   144   1e-45
Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON} (74361..74...   144   1e-45
Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar ...   143   3e-45
KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON} simil...   141   2e-44
CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa] {O...   135   3e-42
ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON} Synt...   134   8e-42
SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {O...   134   2e-41
KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar...   129   8e-40
Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa] ...   129   1e-39
KAFR0D00430 Chr4 complement(62690..64060) [1371 bp, 456 aa] {ON}...    32   0.24 
TDEL0F04920 Chr6 complement(925383..931022) [5640 bp, 1879 aa] {...    30   1.4  
TPHA0C00690 Chr3 (130792..133077) [2286 bp, 761 aa] {ON} Anc_8.3...    28   3.8  
KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {...    28   3.9  
Ecym_6003 Chr6 complement(7616..9382) [1767 bp, 588 aa] {ON} sim...    28   4.3  
Skud_11.97 Chr11 complement(182494..186312) [3819 bp, 1272 aa] {...    28   6.8  
TDEL0F03720 Chr6 complement(681044..682768) [1725 bp, 574 aa] {O...    28   7.2  
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...    27   8.3  
KAFR0L00590 Chr12 complement(108589..110148) [1560 bp, 519 aa] {...    27   8.8  

>ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa] {ON}
           highly similar to uniprot|P52553 Saccharomyces
           cerevisiae YLR200W YKE2 Yeast nuclear gene
          Length = 109

 Score =  218 bits (554), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 109/109 (100%), Positives = 109/109 (100%)

Query: 1   MSELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVE 60
           MSELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVE
Sbjct: 1   MSELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVE 60

Query: 61  QDDARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIKLRSGDTN 109
           QDDARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIKLRSGDTN
Sbjct: 61  QDDARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIKLRSGDTN 109

>TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.352
           YLR200W
          Length = 107

 Score =  159 bits (403), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 77/106 (72%), Positives = 92/106 (86%)

Query: 1   MSELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVE 60
           MS+LAA YQ LQ ELE  ++ARQKLETQLQENKIV +EF+ LK D++VYKLTGNVLLPVE
Sbjct: 1   MSDLAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVE 60

Query: 61  QDDARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIKLRSG 106
           Q +A +NV+KRLEFIQTEI RCENN+K KQ+EQE+++AELIKLR  
Sbjct: 61  QSEANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKLRGA 106

>KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa] {ON}
           Anc_7.352 YLR200W
          Length = 107

 Score =  159 bits (403), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 90/106 (84%)

Query: 1   MSELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVE 60
           MSELAAQYQKLQ ELE  IVARQKLETQLQENKIV+DEF  LK +++VYKLTGNVLLP+E
Sbjct: 1   MSELAAQYQKLQSELEELIVARQKLETQLQENKIVNDEFKSLKEETQVYKLTGNVLLPIE 60

Query: 61  QDDARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIKLRSG 106
           QD+AR NV KRLEFI+ EI RCE NIK KQ E E ++ EL+KLRSG
Sbjct: 61  QDEARGNVDKRLEFIEKEITRCEGNIKSKQTEIENIRNELVKLRSG 106

>NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.352
           YLR200W
          Length = 105

 Score =  157 bits (396), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 91/104 (87%)

Query: 1   MSELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVE 60
           M++L AQYQ LQ ELE+FI+ARQKLETQLQENKIV DEF  L  ++KVYKLTGNVLLPVE
Sbjct: 1   MADLPAQYQSLQSELESFIIARQKLETQLQENKIVMDEFEQLVDETKVYKLTGNVLLPVE 60

Query: 61  QDDARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIKLR 104
           QD+AR+NV KRLEFIQ+EI +CE NIK KQEE E+V+AE+IK+R
Sbjct: 61  QDEARSNVEKRLEFIQSEITKCEKNIKQKQEELEKVRAEIIKMR 104

>Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  157 bits (396), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 91/108 (84%)

Query: 1   MSELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVE 60
           MSEL A+YQ LQ ELE FIVARQKLETQLQENKIV++EF+ LK D+ VYKLTGNVLLPVE
Sbjct: 1   MSELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVE 60

Query: 61  QDDARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIKLRSGDT 108
           Q +AR NV KRLEFI+TEI RCE NI+GKQEE E+V+ EL+KL +  T
Sbjct: 61  QSEARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKLNNAAT 108

>YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subunit
           of the heterohexameric Gim/prefoldin protein complex
           involved in the folding of alpha-tubulin, beta-tubulin,
           and actin
          Length = 114

 Score =  154 bits (390), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 77/103 (74%), Positives = 91/103 (88%)

Query: 1   MSELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVE 60
           MSEL A+YQ+LQ ELE FIVARQKLETQLQENKIV++EF+ L+ D+ VYKLTGNVLLPVE
Sbjct: 1   MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVE 60

Query: 61  QDDARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIKL 103
           Q +ARTNV KRLEFI+TEI RCE NI+ KQEE E++++ELIKL
Sbjct: 61  QSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKL 103

>TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352
           YLR200W
          Length = 115

 Score =  152 bits (384), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 87/107 (81%)

Query: 2   SELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVEQ 61
           +ELA +YQ  Q ELE FIV RQKLETQLQENKIV+DEF  LK ++KV+KLTGNVLLP+EQ
Sbjct: 4   NELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLPIEQ 63

Query: 62  DDARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIKLRSGDT 108
           D+AR+N+ KRLEFIQTEIDRCE NIK KQ E E++++EL+      T
Sbjct: 64  DEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELMATAPAPT 110

>NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON} Anc_7.352
           YLR200W
          Length = 106

 Score =  148 bits (373), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 72/103 (69%), Positives = 90/103 (87%)

Query: 2   SELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVEQ 61
           S L ++YQ LQGELE+ I+ARQKLETQLQENKIV +EFN L S+S+VYKLTGNVLLPV+Q
Sbjct: 3   SNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPVDQ 62

Query: 62  DDARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIKLR 104
           ++A +NV KRLEFIQTEI RCENNIK KQ+E + V++E++K+R
Sbjct: 63  EEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKMR 105

>Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  148 bits (373), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 75/106 (70%), Positives = 88/106 (83%)

Query: 1   MSELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVE 60
           MSEL A+YQ LQ ELE FIVARQKLETQLQENKIV++EF+ +  D+ VYKLTGNVLLPVE
Sbjct: 1   MSELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVE 60

Query: 61  QDDARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIKLRSG 106
           Q +AR NV KRLEFI+TEI RCE NI+ KQ+E E+V+ ELIKL + 
Sbjct: 61  QSEARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKLNNA 106

>TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON}
           Anc_7.352 YLR200W
          Length = 107

 Score =  145 bits (367), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 68/107 (63%), Positives = 90/107 (84%)

Query: 1   MSELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVE 60
           MS++AA+YQ +QGELE  I+ARQKLETQLQENKIV+DEFN L  D+ +YKLTGNV+LP+E
Sbjct: 1   MSDVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIE 60

Query: 61  QDDARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIKLRSGD 107
           Q +A++NV KRLEFI+ EI RCE NIK KQ+E ++++ EL+K+R  +
Sbjct: 61  QFEAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMRGAN 107

>Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  145 bits (365), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 73/106 (68%), Positives = 88/106 (83%)

Query: 1   MSELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVE 60
           MSEL  +YQ LQGELE FIVARQKLETQLQENKIV++EF+ L+ ++ VYKLTGNVLLPV+
Sbjct: 1   MSELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVD 60

Query: 61  QDDARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIKLRSG 106
           Q +AR NV KRLEFI+ EI RCE NIK KQE+ E+V+ +LIKL + 
Sbjct: 61  QSEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNNA 106

>KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.352
           YLR200W
          Length = 119

 Score =  144 bits (364), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 86/104 (82%)

Query: 1   MSELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVE 60
           MS  AA+YQK Q  LE  IVARQKLETQLQENKIV +EF+ LK DSKVYKLTG+VLLPV+
Sbjct: 1   MSNPAAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVD 60

Query: 61  QDDARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIKLR 104
           QD+ARTNV KRLEFI  EIDRCE NIK KQE  E +++EL+KL+
Sbjct: 61  QDEARTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKLQ 104

>Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON}
           (74361..74684) [324 nt, 108 aa]
          Length = 107

 Score =  144 bits (363), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 72/106 (67%), Positives = 90/106 (84%)

Query: 1   MSELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVE 60
           MS+LA +YQK+QGELE  IVAR++LETQLQENKIV++EF GLK D++VYKLTGNVLLPVE
Sbjct: 1   MSDLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVE 60

Query: 61  QDDARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIKLRSG 106
           Q +AR+NV KRLEFI+ EI +CE+NIK KQ E  +++ EL+K R G
Sbjct: 61  QFEARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMKGRGG 106

>Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar to
           Ashbya gossypii ACL146C
          Length = 107

 Score =  143 bits (360), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 72/105 (68%), Positives = 86/105 (81%)

Query: 1   MSELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVE 60
           + ++AA+Y +LQGELE  IV RQKLETQLQENKIV++E   LK D +VYKLTG VLLPVE
Sbjct: 3   VEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPVE 62

Query: 61  QDDARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIKLRS 105
            ++A +NVSKRLEFIQ EIDRCE NIK KQ+E E+ + ELIKLRS
Sbjct: 63  HEEANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKLRS 107

>KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON} similar
           to uniprot|P52553 Saccharomyces cerevisiae YLR200W YKE2
           Yeast nuclear gene
          Length = 115

 Score =  141 bits (356), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 72/103 (69%), Positives = 82/103 (79%)

Query: 3   ELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVEQD 62
           E   +Y KLQGELE  IVARQKLETQLQENKIV DEF+ LK D+ VYKLTG VLLPVEQ 
Sbjct: 5   ETTQKYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLPVEQF 64

Query: 63  DARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIKLRS 105
           +A+ NV KRLEFI+ EI RCE NIK KQ+E E  ++EL+KLRS
Sbjct: 65  EAKGNVEKRLEFIEIEIKRCETNIKSKQQELEVARSELMKLRS 107

>CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa] {ON}
           similar to uniprot|P52553 Saccharomyces cerevisiae
           YLR200w YKE2 Gim complex component
          Length = 106

 Score =  135 bits (340), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 80/100 (80%)

Query: 2   SELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVEQ 61
           +EL A+YQ LQ ELE  + ARQKLETQLQENKIV++EF  LK D+ VYKLTGNVLLPVE 
Sbjct: 3   AELGAKYQSLQNELEELVTARQKLETQLQENKIVNEEFATLKEDTVVYKLTGNVLLPVEH 62

Query: 62  DDARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELI 101
           DDA+ NV KRLEFI  EI RCE+NI+ KQ+E E ++ +LI
Sbjct: 63  DDAKNNVDKRLEFIGEEIKRCEDNIRSKQQELETIRGQLI 102

>ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR200W
           (YKE2)
          Length = 107

 Score =  134 bits (338), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 82/103 (79%)

Query: 3   ELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVEQD 62
           ++A +Y +LQGELE  +V RQKLETQLQENKIV++E   L+ +++VYKLTG VLLPVEQ+
Sbjct: 5   QVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLPVEQE 64

Query: 63  DARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIKLRS 105
           +A  NVSKRLEFI+ EI RCE NIK KQEE E  +A L+KLR 
Sbjct: 65  EAEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKLRG 107

>SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {ON}
           similar to uniprot|P52553 Saccharomyces cerevisiae
           YLR200W YKE2 Yeast nuclear gene
          Length = 115

 Score =  134 bits (336), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 84/103 (81%)

Query: 4   LAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVEQDD 63
           L+ QY  +Q ELE+ ++ARQKLETQLQENKIV DEF+ L+ +S+VYKLTG VLLPVEQ++
Sbjct: 9   LSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGVLLPVEQEE 68

Query: 64  ARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIKLRSG 106
           A+ NV KRL+FI+ EI RCE NIK KQ + ER++ EL++LR+ 
Sbjct: 69  AKGNVEKRLQFIKNEITRCEENIKEKQTQLERLRNELVRLRTA 111

>KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar to
           uniprot|P52553 Saccharomyces cerevisiae YLR200W YKE2
           Yeast nuclear gene
          Length = 113

 Score =  129 bits (325), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 81/100 (81%)

Query: 3   ELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVEQD 62
           +L   Y   Q ELE  ++ARQKLETQLQENKIV DEF+GL+ +++VYKLTGNVLLPVEQ 
Sbjct: 7   DLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVLLPVEQF 66

Query: 63  DARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIK 102
           +A++NVSKRLEFI  EI+RCE NIK KQ   E+++AEL++
Sbjct: 67  EAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQ 106

>Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa]
           {ON} YLR200W (YKE2) - Polypeptide 6 of a Yeast
           Non-native Actin Binding Complex, homolog of a component
           of the bovine NABC complex [contig 161] FULL
          Length = 113

 Score =  129 bits (323), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 79/100 (79%)

Query: 3   ELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVEQD 62
           EL   Y   Q ELE  + ARQ+LETQLQENKIV DEF+ LK +++VYKLTG VLLPVEQ 
Sbjct: 7   ELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPVEQF 66

Query: 63  DARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIK 102
           +A++NVSKRLEFI TEI RCE+NIK KQ   E+++AEL++
Sbjct: 67  EAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQ 106

>KAFR0D00430 Chr4 complement(62690..64060) [1371 bp, 456 aa] {ON}
           Anc_1.46 YCL029C
          Length = 456

 Score = 32.0 bits (71), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 23/29 (79%)

Query: 72  LEFIQTEIDRCENNIKGKQEEQERVKAEL 100
           LE IQ  ID CENNI+  ++E++++KA+L
Sbjct: 211 LEEIQPTIDACENNIREIEQERDQLKAQL 239

>TDEL0F04920 Chr6 complement(925383..931022) [5640 bp, 1879 aa] {ON}
            Anc_8.368 YDR170C
          Length = 1879

 Score = 29.6 bits (65), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 8/66 (12%)

Query: 25   LETQLQENKIVDDEFNGLKSDSKVYKLTGNVL--LPVEQDDARTNVSKRLEFIQTEIDRC 82
            L T+L E ++VD   N LK ++    +  N+L  L +  DD +T +S+RL      I  C
Sbjct: 1745 LRTRLVEARVVDKIPNLLKQETSAAAVLINILFKLYLNDDDKKTELSERL------IHIC 1798

Query: 83   ENNIKG 88
             N + G
Sbjct: 1799 TNVVHG 1804

>TPHA0C00690 Chr3 (130792..133077) [2286 bp, 761 aa] {ON} Anc_8.346
           YLR139C
          Length = 761

 Score = 28.5 bits (62), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 2   SELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTG 53
           S L  + +KLQ    NF+V   K    L++ KI  + FN L S+SK+  L G
Sbjct: 73  SSLERKVRKLQPNKANFVVLNPKQAGLLKQRKI-PNYFNTLNSNSKISILEG 123

>KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {ON}
           Anc_4.113 YGL013C
          Length = 1030

 Score = 28.5 bits (62), Expect = 3.9,   Method: Composition-based stats.
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 3/72 (4%)

Query: 17  NFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVEQDDARTNVSKRLEFIQ 76
           N  V     + Q++E +++    + L + S+VYK    +L PV+Q     +V K L+ + 
Sbjct: 846 NMTVEEFTGQLQVKEPQLIACTRDILDTKSQVYKY---LLTPVQQSGFHISVRKLLKDLG 902

Query: 77  TEIDRCENNIKG 88
               +CE N KG
Sbjct: 903 VVGQQCEENEKG 914

>Ecym_6003 Chr6 complement(7616..9382) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AFR277W
          Length = 588

 Score = 28.1 bits (61), Expect = 4.3,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 7/60 (11%)

Query: 19  IVARQKLETQLQENKIVDDE---FNGLKSDSKVYKLTGNVLLPVEQDDARTNVSKRLEFI 75
           IV +++ E ++Q   + D+     N   SD +V++    VL+ + +DD +T+ S R   I
Sbjct: 506 IVTKERTEKEMQNLSVNDNTSCGVNNQSSDKRVFE----VLVKISRDDLKTSASVRQRII 561

>Skud_11.97 Chr11 complement(182494..186312) [3819 bp, 1272 aa] {ON}
           YKL129C (REAL)
          Length = 1272

 Score = 27.7 bits (60), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 12/53 (22%), Positives = 29/53 (54%)

Query: 6   AQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLP 58
           +Q++   G + N+++ +Q++ +Q++  +     +   K  S VY+ T  V +P
Sbjct: 198 SQFEPCAGNITNYLLEKQRVVSQIKNERNFHIFYQFTKGASDVYRQTFGVQMP 250

>TDEL0F03720 Chr6 complement(681044..682768) [1725 bp, 574 aa] {ON}
           Anc_8.245 YDR101C
          Length = 574

 Score = 27.7 bits (60), Expect = 7.2,   Method: Composition-based stats.
 Identities = 12/27 (44%), Positives = 17/27 (62%)

Query: 25  LETQLQENKIVDDEFNGLKSDSKVYKL 51
           L +Q+  N + D+E N LK D K Y+L
Sbjct: 384 LSSQMPVNGLDDEELNALKQDLKSYRL 410

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
           similar to uniprot|Q02455 Saccharomyces cerevisiae
           YKR095W MLP1 Myosin-like protein associated with the
           nuclear envelope connects the nuclear pore complex with
           the nuclear interior involved in the Tel1p pathway that
           controls telomere length involved in the retention of
           unspliced mRNAs in the nucleus
          Length = 1748

 Score = 27.3 bits (59), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 8/65 (12%)

Query: 22  RQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVEQDDARTNVSKRLEFIQTEIDR 81
            ++LE +L ENK + DE+N  K +     LT  + L     DA   + K +E ++ E+D 
Sbjct: 254 HEQLEQKLSENKEIKDEYNFSKQE-----LTKEMSLKQRMIDA---LEKHMESLKKEMDA 305

Query: 82  CENNI 86
            +NN+
Sbjct: 306 TKNNM 310

>KAFR0L00590 Chr12 complement(108589..110148) [1560 bp, 519 aa] {ON}
           Anc_7.150 YER006W
          Length = 519

 Score = 27.3 bits (59), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 2/40 (5%)

Query: 1   MSELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFN 40
           ++ L A  Q+   E E   V  Q ++TQ+ EN IVD + N
Sbjct: 110 LAALVASAQQAAAEYEG--VPNQAVDTQIDENDIVDYDIN 147

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.129    0.335 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,506,006
Number of extensions: 489082
Number of successful extensions: 2277
Number of sequences better than 10.0: 228
Number of HSP's gapped: 2264
Number of HSP's successfully gapped: 241
Length of query: 109
Length of database: 53,481,399
Length adjustment: 79
Effective length of query: 30
Effective length of database: 44,422,785
Effective search space: 1332683550
Effective search space used: 1332683550
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 59 (27.3 bits)