Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F11726g7.351ON25125113330.0
TDEL0C019707.351ON2602589051e-123
Kpol_530.307.351ON2602538561e-116
YLR201C (COQ9)7.351ON2602518051e-108
Suva_10.2967.351ON2602537941e-106
KLTH0H01232g7.351ON2572477911e-106
Kwal_56.246447.351ON2582477791e-104
KLLA0D12320g7.351ON2502507781e-104
Skud_12.2657.351ON2602467621e-102
CAGL0A03949g7.351ON2682467611e-101
TPHA0F029807.351ON2642557591e-101
SAKL0F11396g7.351ON2542537427e-99
TBLA0E004507.351ON2792447282e-96
KNAG0B026207.351ON2652537255e-96
ACL147W7.351ON2462517104e-94
KAFR0L014807.351ON2642427064e-93
NCAS0E028707.351ON2612497054e-93
NDAI0E044707.351ON2642486985e-92
Smik_12.2607.351ON2602566872e-90
Ecym_47227.351ON2532416446e-84
Ecym_32514.267ON1109114675.3
TPHA0C027708.188ON97068659.0
TDEL0F042208.295ON490959659.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F11726g
         (251 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar...   518   0.0  
TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON...   353   e-123
Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON} ...   334   e-116
YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}  ...   314   e-108
Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {O...   310   e-106
KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {O...   309   e-106
Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR20...   304   e-104
KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa] ...   304   e-104
Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {O...   298   e-102
CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar...   297   e-101
TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.35...   296   e-101
SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar...   290   7e-99
TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON} ...   285   2e-96
KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON...   283   5e-96
ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homol...   278   4e-94
KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.3...   276   4e-93
NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON...   276   4e-93
NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {...   273   5e-92
Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {O...   269   2e-90
Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON...   252   6e-84
Ecym_3251 Chr3 (476367..479696) [3330 bp, 1109 aa] {ON} similar ...    30   5.3  
TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.1...    30   9.0  
TDEL0F04220 Chr6 complement(778175..792904) [14730 bp, 4909 aa] ...    30   9.7  

>ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 251

 Score =  518 bits (1333), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/251 (100%), Positives = 251/251 (100%)

Query: 1   MFKRLCQVSLRRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIV 60
           MFKRLCQVSLRRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIV
Sbjct: 1   MFKRLCQVSLRRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIV 60

Query: 61  HSLNQLNYPSTMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQDLSSEEKPSLED 120
           HSLNQLNYPSTMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQDLSSEEKPSLED
Sbjct: 61  HSLNQLNYPSTMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQDLSSEEKPSLED 120

Query: 121 LFIKRLELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFAWY 180
           LFIKRLELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFAWY
Sbjct: 121 LFIKRLELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFAWY 180

Query: 181 SKRLGISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLLNS 240
           SKRLGISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLLNS
Sbjct: 181 SKRLGISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLLNS 240

Query: 241 INLAKSQMARG 251
           INLAKSQMARG
Sbjct: 241 INLAKSQMARG 251

>TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON}
           Anc_7.351 YLR201C
          Length = 260

 Score =  353 bits (905), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 175/258 (67%), Positives = 211/258 (81%), Gaps = 10/258 (3%)

Query: 3   KRLC---QVSLRRYHPSKGEHLN--SSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNER 57
           KRL    ++  R Y P+  E++N  +SR GPL YG DSPQY VLSH L  SVP+ GFNER
Sbjct: 4   KRLIAGSRIFARGYRPAGFEYINPINSR-GPLKYGKDSPQYKVLSHTLAKSVPMYGFNER 62

Query: 58  AIVHSLNQLNYPSTMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQDLSSE---- 113
           AIV+SLN+L YPSTMLSVIG+SN PS  HSSPA+MEL+KFHLV KRL L++++S E    
Sbjct: 63  AIVNSLNELGYPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENISLETPVD 122

Query: 114 EKPSLEDLFIKRLELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKD 173
           + PSLE L IKRLE+NVP+A HLSQLLS +S+PGPF VD ++PELHRLSDD+IY+S EKD
Sbjct: 123 QLPSLEHLVIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFSTEKD 182

Query: 174 HHDFAWYSKRLGISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWL 233
           H+DFAWYSKRL +SCAYVSSELFMAQD+S +Y+ETF+FAR+KL R   LGEYYNNTEE+ 
Sbjct: 183 HNDFAWYSKRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTEEFA 242

Query: 234 WYTLLNSINLAKSQMARG 251
           WYTLL++INL KSQ+ARG
Sbjct: 243 WYTLLSTINLVKSQLARG 260

>Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON}
           complement(75011..75793) [783 nt, 261 aa]
          Length = 260

 Score =  334 bits (856), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 159/253 (62%), Positives = 203/253 (80%), Gaps = 4/253 (1%)

Query: 3   KRLCQVSLRRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIVHS 62
           KR      R YHP+  E++    L PL YG DS QY +LSH+L VSVP  GFNERAIV+S
Sbjct: 8   KRTAFGLTRFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNERAIVNS 67

Query: 63  LNQLNYPSTMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQDLS----SEEKPSL 118
           +N L YPS++LSVIG+SN+PS LHSS A+MEL+KF+LV KR QLS+D+      EE PSL
Sbjct: 68  INLLGYPSSILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDIPLDTPVEELPSL 127

Query: 119 EDLFIKRLELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFA 178
           EDL IKRL+++VPI  HLSQL++ +S+PGPF  DT+LPELHRL+DD+IY+S+EKDH DFA
Sbjct: 128 EDLLIKRLKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSEKDHPDFA 187

Query: 179 WYSKRLGISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLL 238
           WY+KR+G+S AY+SS+LFMAQD+S  Y +TF+FA+DKL+R M+LG+YYNN EE+ WY L+
Sbjct: 188 WYAKRMGVSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEEYAWYVLM 247

Query: 239 NSINLAKSQMARG 251
           NSIN+AKS+ ARG
Sbjct: 248 NSINMAKSKAARG 260

>YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}
           COQ9Protein required for ubiquinone (coenzyme Q)
           biosynthesis and respiratory growth; localizes to the
           matrix face of the mitochondrial inner membrane in a
           large complex with ubiquinone biosynthetic enzymes
          Length = 260

 Score =  314 bits (805), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 151/251 (60%), Positives = 194/251 (77%), Gaps = 6/251 (2%)

Query: 6   CQVSLRRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIVHSLNQ 65
           C+   R YH +  EH+    + PL YG +SPQY VLS AL+  VP  GF+ER+IV SLN+
Sbjct: 11  CKF-FRLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSERSIVESLNE 69

Query: 66  LNYPSTMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQ----DLSSEEK-PSLED 120
           L YPS+M+S IGA NSPS  HSS AVMEL+KF LV KR +L++    D++ + K PSLE 
Sbjct: 70  LGYPSSMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTPQYKLPSLEH 129

Query: 121 LFIKRLELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFAWY 180
           L +KRLE++ PI GHLS+L+S +++P  F  +TA+PELHRLSDD+IY+SNEKDHHD AWY
Sbjct: 130 LLLKRLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNEKDHHDSAWY 189

Query: 181 SKRLGISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLLNS 240
           +KRL +S  Y+ S+LFMAQDKSHNY+ETF FA+DKL R M+LGEYYNNTEE+ WYTL+++
Sbjct: 190 AKRLAVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEEFAWYTLMST 249

Query: 241 INLAKSQMARG 251
           +NL KSQ+ RG
Sbjct: 250 VNLIKSQLVRG 260

>Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  310 bits (794), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 148/253 (58%), Positives = 192/253 (75%), Gaps = 5/253 (1%)

Query: 4   RLCQVSLRRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIVHSL 63
           R    SLR YH +  EH+N   + PL YG  SPQY VLS AL+  VP  GF ER+IV SL
Sbjct: 8   RKASASLRLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTERSIVESL 67

Query: 64  NQLNYPSTMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQDLSSE-----EKPSL 118
           N+L YPS+M+S IGASNSPS +HSS AVMEL+KF LV KR +L++ ++ +     + PSL
Sbjct: 68  NKLGYPSSMISSIGASNSPSFVHSSTAVMELLKFQLVDKRYRLTEGINPDVTPHYKLPSL 127

Query: 119 EDLFIKRLELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFA 178
           E L +KRLE++ P+   L+ L+S +++P  F  +TA+PELHRLSDD+IY+SNEKDHHD A
Sbjct: 128 EHLLLKRLEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSA 187

Query: 179 WYSKRLGISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLL 238
           WY+KRL +S  Y+ S+LFMAQDKSH++ ETF FA+DKL R M+LGEYYNNTEE+ WYTL+
Sbjct: 188 WYAKRLAVSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEEFAWYTLM 247

Query: 239 NSINLAKSQMARG 251
           +++NL KSQ+ARG
Sbjct: 248 STVNLVKSQLARG 260

>KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {ON}
           similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53
          Length = 257

 Score =  309 bits (791), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 152/247 (61%), Positives = 187/247 (75%), Gaps = 6/247 (2%)

Query: 11  RRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIVHSLNQLNYPS 70
           R YHPS  EH  +    PL YG  S Q+ VL HAL   VP  GFNERA+V SLN L+   
Sbjct: 11  RLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERALVASLNDLDLGP 70

Query: 71  TMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQDL------SSEEKPSLEDLFIK 124
           ++LSVIGASNSPS L++SPAV+EL+KFHLV KR  L+++L      S  E P+LE LF +
Sbjct: 71  SLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPAEPPALETLFHR 130

Query: 125 RLELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFAWYSKRL 184
           RLELN PIA HL+QLLS +S+PG F V TALPELHRLSDD++Y+S E D +DFAWYSKR+
Sbjct: 131 RLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPDANDFAWYSKRI 190

Query: 185 GISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLLNSINLA 244
            +SCA+VSSELFMAQD+S NY +TF+FA +KL    +LG+YYNNTEE++WYTLL S+NLA
Sbjct: 191 ALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYMWYTLLMSVNLA 250

Query: 245 KSQMARG 251
           KSQ+ R 
Sbjct: 251 KSQLTRS 257

>Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR201C
           - Hypothetical ORF [contig 161] FULL
          Length = 258

 Score =  304 bits (779), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 152/247 (61%), Positives = 186/247 (75%), Gaps = 6/247 (2%)

Query: 11  RRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIVHSLNQLNYPS 70
           R Y P+  E+  +++L PL YG  S Q+ VL HALK  VP  GFNERA+V SLN L   S
Sbjct: 12  RFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERALVASLNDLGLGS 71

Query: 71  TMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQDL------SSEEKPSLEDLFIK 124
            +LS IGA NSP LL+SSPAV+ELVKFHLV KR  L++DL      S  E P+LE LF K
Sbjct: 72  QVLSSIGAPNSPPLLNSSPAVLELVKFHLVTKRYALTKDLDIARCASPAEPPALETLFHK 131

Query: 125 RLELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFAWYSKRL 184
           RLELN+PIA H++QLL+ +++PG F + +ALPELHRLSDD+IY+S E D +DFAWYSKR 
Sbjct: 132 RLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEPDANDFAWYSKRA 191

Query: 185 GISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLLNSINLA 244
            ISCA+VSSELFMAQDKS NY +TF+FA DKL    +LG+YY NTEE++WYTLL S+NLA
Sbjct: 192 AISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEYMWYTLLMSVNLA 251

Query: 245 KSQMARG 251
           KSQ+ R 
Sbjct: 252 KSQITRS 258

>KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa]
           {ON} similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53,
          Length = 250

 Score =  304 bits (778), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 153/250 (61%), Positives = 190/250 (76%), Gaps = 3/250 (1%)

Query: 5   LCQVSLRRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIVHSLN 64
           + +V  R YHP+  EH     + PL YG DS Q+ VLS+AL   VP  GFNERAIV SLN
Sbjct: 1   MSRVFTRLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLN 60

Query: 65  QLNYPSTMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQDL---SSEEKPSLEDL 121
           +L   S+ LSV+G+SNSPS  + SP+V+ELVKFHLV KR QL  DL   S +  P L+ L
Sbjct: 61  ELGMGSSYLSVLGSSNSPSFFNVSPSVLELVKFHLVSKRNQLITDLPLDSDKPLPDLKTL 120

Query: 122 FIKRLELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFAWYS 181
           F++RL+LN  +A HLSQLLS +SVPG F   TAL ELH+L+DD+I+YSNE+DH+DFAWYS
Sbjct: 121 FLQRLKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYS 180

Query: 182 KRLGISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLLNSI 241
           KR+ +S AYVSSELFMAQDKSHN++ET +FA+ KL +  QLG  YNNTEE+LW+TLL+SI
Sbjct: 181 KRIALSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSI 240

Query: 242 NLAKSQMARG 251
           NLAKSQ+ RG
Sbjct: 241 NLAKSQITRG 250

>Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  298 bits (762), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 146/246 (59%), Positives = 188/246 (76%), Gaps = 5/246 (2%)

Query: 11  RRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIVHSLNQLNYPS 70
           R YH +  EH+    + PL YG  SPQY VLS AL   VP  GF+ER+IV SLN+L YPS
Sbjct: 15  RLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESLNKLGYPS 74

Query: 71  TMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQ----DLSSEEK-PSLEDLFIKR 125
           +M+S IGASNSPS  HSS AVMELVKF LV KR +L++    D++S  K PSLE L +KR
Sbjct: 75  SMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRYKLPSLEHLLLKR 134

Query: 126 LELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFAWYSKRLG 185
           LE++  I G L+ L+S ++VP     +TA+PELHRLSDD+IY+SNE+DHHD AWY+KRL 
Sbjct: 135 LEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSAWYAKRLA 194

Query: 186 ISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLLNSINLAK 245
           +S  Y+ S+LFMAQDKSH+++ETF FA++KL + M+LGEYYNNTEE+ WYTL++++NL K
Sbjct: 195 VSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLMSTVNLVK 254

Query: 246 SQMARG 251
           SQ+ARG
Sbjct: 255 SQLARG 260

>CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201c
          Length = 268

 Score =  297 bits (761), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 134/246 (54%), Positives = 188/246 (76%), Gaps = 4/246 (1%)

Query: 9   SLRRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIVHSLNQLNY 68
           ++RRYHP+  E++N     PL Y  +SP++ +LSH ++ SVP  GF E+AIV+SLN +  
Sbjct: 22  AVRRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQHGFTEKAIVNSLNAMKM 81

Query: 69  PSTMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQDLS----SEEKPSLEDLFIK 124
           PS ML+ IGASNS + LHSSPAVMEL+KF LV+KR ++ + ++    + + PSLE L +K
Sbjct: 82  PSGMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMVEGITEIAEASKLPSLESLLLK 141

Query: 125 RLELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFAWYSKRL 184
           RL+++VPIA HL+Q+ + + VP  F  + +LPEL RL+DD+IYYSNEKDHHDFAWY+KR 
Sbjct: 142 RLKMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAWYTKRA 201

Query: 185 GISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLLNSINLA 244
            ++  Y++S+ FMAQDKSHN+ ET +FA+DKL + M LG+YYNN EE+ W+TL++++NL 
Sbjct: 202 ALATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMSAVNLT 261

Query: 245 KSQMAR 250
           KSQMAR
Sbjct: 262 KSQMAR 267

>TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  296 bits (759), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 146/255 (57%), Positives = 196/255 (76%), Gaps = 7/255 (2%)

Query: 4   RLCQVSLRRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIVHSL 63
           R   V+ R +HP+  E++  ++L P  Y  DSPQ+ +LSHA+  +V   GF+ERAI+ ++
Sbjct: 10  RKSGVNARFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGFSERAIIEAM 69

Query: 64  NQLNYP--STMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQDLS-----SEEKP 116
            +L     STMLS IG+SNSPS LHSSP+VMEL+KF+LV KR ++ + L       EE P
Sbjct: 70  KELKIENQSTMLSAIGSSNSPSFLHSSPSVMELLKFNLVLKRYRMIEGLDPLTMQQEELP 129

Query: 117 SLEDLFIKRLELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHD 176
           SLE L +KRLE+++PI  H+S  +S + +PGPF +D+ALPELHRL+DD+IY+SNEKDHHD
Sbjct: 130 SLESLLLKRLEMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMIYFSNEKDHHD 189

Query: 177 FAWYSKRLGISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYT 236
           FAWYSKRLG+S AY+SS+LFMAQD S NY+ET QFA+DKL++ M+LG+YYNNTEE+ WY 
Sbjct: 190 FAWYSKRLGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYYNNTEEYAWYV 249

Query: 237 LLNSINLAKSQMARG 251
           LLNS+N+ KS+M+R 
Sbjct: 250 LLNSVNMVKSRMSRA 264

>SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 254

 Score =  290 bits (742), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 153/253 (60%), Positives = 196/253 (77%), Gaps = 3/253 (1%)

Query: 1   MFKR-LCQVSLRRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAI 59
           MFK+   +++ R YHP+  EH +S  L PL Y  DSPQ+ +L++AL   VP  GFNERA+
Sbjct: 1   MFKQAFSKIARRGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERAL 60

Query: 60  VHSLNQLNYPSTMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQDLS--SEEKPS 117
             S + L Y S+ LSV+GASNSPS  +SSPAV+EL+KFHLV KR  L+  ++  + E PS
Sbjct: 61  TSSCSDLGYSSSFLSVLGASNSPSFFNSSPAVLELLKFHLVSKRYSLTDGVADGTLESPS 120

Query: 118 LEDLFIKRLELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDF 177
           LE+LF+KRLE+N PIA HLSQLLS +++PG F  + A+PELHRLSDD++Y+SNE DH+DF
Sbjct: 121 LENLFLKRLEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDF 180

Query: 178 AWYSKRLGISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTL 237
           AWYSKRL IS AYVSSELFMAQDKS +Y++T +FA++KL+   QLGE YNN EE+ WYTL
Sbjct: 181 AWYSKRLAISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTL 240

Query: 238 LNSINLAKSQMAR 250
           L+SI+LAKSQM R
Sbjct: 241 LSSISLAKSQMTR 253

>TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON}
           Anc_7.351 YLR201C
          Length = 279

 Score =  285 bits (728), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 131/244 (53%), Positives = 186/244 (76%), Gaps = 2/244 (0%)

Query: 10  LRRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIVHSLNQLNYP 69
           +R Y+    +   S  L PL YG DS QY +L  A++ SVP  GF ERAI++S+N+L Y 
Sbjct: 36  IRTYYSVSNDVKKSDHLEPLLYGKDSAQYRILEDAVQNSVPTFGFTERAIINSINKLGYN 95

Query: 70  STMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQDLSSEEK--PSLEDLFIKRLE 127
           S+M+SV+G+SN+ ++LHSSPAV+EL+KF+LV KRL+LS+ +  E K  PSLE L +KRL+
Sbjct: 96  SSMISVLGSSNTHNILHSSPAVLELLKFNLVSKRLKLSEGIDPETKDLPSLEYLLLKRLQ 155

Query: 128 LNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFAWYSKRLGIS 187
           ++  I   L+++++ +S+PG F  +T++PEL RLSDD+IY+SNEKDHHD AWYSKRL +S
Sbjct: 156 MDKAIQSRLNEMITKLSIPGTFLAETSIPELFRLSDDMIYFSNEKDHHDMAWYSKRLAVS 215

Query: 188 CAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLLNSINLAKSQ 247
             Y++S++FMAQD S +  +T +FA+DKL + M LGEYYNNTEE+LW+TL+ S+N+ KSQ
Sbjct: 216 TTYIASQIFMAQDTSVDCYKTLEFAQDKLNKVMNLGEYYNNTEEFLWFTLMTSVNIVKSQ 275

Query: 248 MARG 251
           +AR 
Sbjct: 276 LARS 279

>KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON}
           Anc_7.351 YLR201C
          Length = 265

 Score =  283 bits (725), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 134/253 (52%), Positives = 185/253 (73%), Gaps = 6/253 (2%)

Query: 4   RLCQVSLRRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIVHSL 63
           R   +S R YHP+  E+ NS+ + PL Y +DSPQ  +L+H L+  VP  GF ERA++ S+
Sbjct: 12  RRALLSTRLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFTERALLKSI 71

Query: 64  NQLNYPSTMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQDLSSE------EKPS 117
             + Y S+M+SV+GASNSPS+ HSSPAVMELVKF+LV+KR  L++ L++         PS
Sbjct: 72  QAVGYDSSMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTESLAAAGLGSPAALPS 131

Query: 118 LEDLFIKRLELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDF 177
           LE L +KRL+++VP++  L  L + +++P  F V+ A+PEL RLSDD+IY+SNEKDH D 
Sbjct: 132 LEHLLVKRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYFSNEKDHFDT 191

Query: 178 AWYSKRLGISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTL 237
           AWYSKRLG+S AY +S+LFMAQD S N ++T +FARDKL R M LGEYYNN EE+ WY++
Sbjct: 192 AWYSKRLGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNNVEEYAWYSI 251

Query: 238 LNSINLAKSQMAR 250
           + ++N AK+  +R
Sbjct: 252 MTTVNRAKAGFSR 264

>ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR201C
          Length = 246

 Score =  278 bits (710), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 141/251 (56%), Positives = 180/251 (71%), Gaps = 5/251 (1%)

Query: 1   MFKRLCQVSLRRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIV 60
           MF R+C+   R YHP+  EH   +RL PL Y  DSPQY VL  AL+  VPV+GFNERAIV
Sbjct: 1   MF-RVCR---RLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIV 56

Query: 61  HSLNQLNYPSTMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQDLSSEEKPSLED 120
            +   L Y S +LS + A NSP+LL+   AV+ELVKFHLV KR+ L+ D +++   S+E 
Sbjct: 57  RAAGDLGYGSAVLSALAAPNSPALLNVPSAVLELVKFHLVTKRVALA-DAAAQGNVSMEQ 115

Query: 121 LFIKRLELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFAWY 180
           LF++R+E + P+AG L+QLLS +S+PG F V+TA+PEL RLSDDLIYYS EKDH D AWY
Sbjct: 116 LFLQRVEADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWY 175

Query: 181 SKRLGISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLLNS 240
           SKR  ++ AYVS+ LFMA+D+S   EET  FAR +LQ+   LG  YNN EE+ WY LL +
Sbjct: 176 SKRAAVAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMA 235

Query: 241 INLAKSQMARG 251
           +NL KSQ+ RG
Sbjct: 236 MNLVKSQLTRG 246

>KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  276 bits (706), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 133/242 (54%), Positives = 185/242 (76%), Gaps = 1/242 (0%)

Query: 10  LRR-YHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIVHSLNQLNY 68
           LRR YHP+  E++N + + PL Y +DS Q  +LSH+LK  VP  GFNE++I+ S+N L Y
Sbjct: 22  LRRLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILKSINDLGY 81

Query: 69  PSTMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQDLSSEEKPSLEDLFIKRLEL 128
            S+M+SVIGASNSPS  HSSPAV+EL+K++LV KR++L++D +     +L++L +KRLE+
Sbjct: 82  SSSMMSVIGASNSPSFAHSSPAVLELIKYNLVSKRIELTKDTNDNTTTTLKELLLKRLEM 141

Query: 129 NVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFAWYSKRLGISC 188
           ++PI+  L  L + ++ PG F  D +LPEL +L+DD+I++SNEKDHHD AWYSKRL +S 
Sbjct: 142 DIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMAWYSKRLAVSM 201

Query: 189 AYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLLNSINLAKSQM 248
           AYV+S++FM QD S+N++ T  FA DK+ R M LGEYYNN EE+ W+TL+NSINL KSQ 
Sbjct: 202 AYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLMNSINLVKSQF 261

Query: 249 AR 250
           +R
Sbjct: 262 SR 263

>NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON}
           Anc_7.351 YLR201C
          Length = 261

 Score =  276 bits (705), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 179/249 (71%), Gaps = 6/249 (2%)

Query: 9   SLRRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIVHSLNQLNY 68
           S R YHPS  E++  + L PL Y  +S QY +LS+AL   VP  GF E+AI  SLN+L +
Sbjct: 13  SYRSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFKEKAITDSLNELGF 72

Query: 69  PSTMLSVIGASNSPSLLHS-SPAVMELVKFHLVQKRLQLSQDLSSEEKPS-----LEDLF 122
            S++LSVIGASNSP++  S SPAVMEL+KF LV KR +L+++L  +  P      LE L 
Sbjct: 73  SSSLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPDTTPKNELPSLESLL 132

Query: 123 IKRLELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFAWYSK 182
           +KRLE++  I   +  L + ++ P  F  D ALPELHRLSDD+IY+SNEKDHHD AWY+K
Sbjct: 133 LKRLEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFSNEKDHHDMAWYTK 192

Query: 183 RLGISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLLNSIN 242
           RLG+SCAYVSS+L+MAQD S ++E+T  FA+DKL R M+LGEYYNNTEE+ WY  + S N
Sbjct: 193 RLGVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNTEEYAWYMFMVSTN 252

Query: 243 LAKSQMARG 251
           L ++++AR 
Sbjct: 253 LVRARLARS 261

>NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {ON}
           Anc_7.351 YLR201C
          Length = 264

 Score =  273 bits (698), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 130/248 (52%), Positives = 179/248 (72%), Gaps = 7/248 (2%)

Query: 11  RRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIVHSLNQLNYPS 70
           R +H +  E+  ++ L PL Y  DS QY +LS+AL   VP  GF + AI  SLN+L+  S
Sbjct: 17  RAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGFTDEAITSSLNELDLSS 76

Query: 71  TMLSVIGASNSPSLLHS-SPAVMELVKFHLVQKRLQLSQDLS------SEEKPSLEDLFI 123
           ++ SV+G+SNSPS+  S SPAVMEL+KF LV KR QL+++++       ++ PSLE L I
Sbjct: 77  SLFSVLGSSNSPSIFRSISPAVMELLKFQLVSKRYQLTENITPYIETAKDKLPSLETLLI 136

Query: 124 KRLELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFAWYSKR 183
           +RL+++ P+   LS L + + +P P   + ALPEL  LSDDLIY+SNEKDHHD AWY+KR
Sbjct: 137 ERLKMDQPLNNQLSSLFNQLIIPSPLLFNVALPELFNLSDDLIYFSNEKDHHDMAWYAKR 196

Query: 184 LGISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLLNSINL 243
           LG+SCAYVSS+L+M ++   N+++T  FA+DKL R M LGEYYNNTEE+ WYTL+ S+NL
Sbjct: 197 LGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNNTEEYAWYTLMVSMNL 256

Query: 244 AKSQMARG 251
            K+++ARG
Sbjct: 257 VKARLARG 264

>Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  269 bits (687), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 150/256 (58%), Positives = 197/256 (76%), Gaps = 6/256 (2%)

Query: 1   MFKRLCQVSLRRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIV 60
           + ++ C  S R YHP+  EH+ S  + PL YG +SPQY VLS AL+  VP  GF+ER+IV
Sbjct: 6   ILRKGC-TSFRLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSERSIV 64

Query: 61  HSLNQLNYPSTMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQ----DLSSEEK- 115
            SLN+L YPS+M+S I ASNSPS  HSS AVMEL+KF LV KR +L++    D++ + K 
Sbjct: 65  ESLNELGYPSSMISSISASNSPSFFHSSTAVMELIKFQLVDKRYRLTEAINPDVTPQYKL 124

Query: 116 PSLEDLFIKRLELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHH 175
           PSLE L ++RLE++ PI G LS+L+S +++P  F  +TA+PELHRLSDD+IY+SNEKDHH
Sbjct: 125 PSLEHLLLRRLEMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHH 184

Query: 176 DFAWYSKRLGISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWY 235
           D AWY+KRL +S  Y+ S+LFMAQDKSHNY++TF FA+ KL R M+LGEYYNNTEE+ WY
Sbjct: 185 DSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTEEFAWY 244

Query: 236 TLLNSINLAKSQMARG 251
           TL++++NL KSQ+ RG
Sbjct: 245 TLMSTVNLVKSQLVRG 260

>Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii ACL147W
          Length = 253

 Score =  252 bits (644), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 121/241 (50%), Positives = 170/241 (70%), Gaps = 2/241 (0%)

Query: 11  RRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIVHSLNQLNYPS 70
           R YH +  E+   + L PL YG  SPQY VL+ AL+  VP  GF + AIV + N+L Y S
Sbjct: 15  RFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSAIVDAANELGYNS 74

Query: 71  TMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQDLSSEEKPSLEDLFIKRLELNV 130
            +L+ IGA+NSP++ + S +V ELVKFHLV KR  L +D   E   +LE+LF+KRLE N 
Sbjct: 75  AVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGLQED--QEGTKTLEELFLKRLEANK 132

Query: 131 PIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFAWYSKRLGISCAY 190
            +  HL ++LS +++PG F V+T LPEL +L+DD+IYYS EKD +D AWYSKRL +S AY
Sbjct: 133 SLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWYSKRLAVSMAY 192

Query: 191 VSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLLNSINLAKSQMAR 250
           +S+ELFMA+D S N++ T +FA+ ++ +  ++G  YNN EE+ W+ LL ++NLA+SQ+ R
Sbjct: 193 ISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLLTTVNLARSQLVR 252

Query: 251 G 251
           G
Sbjct: 253 G 253

>Ecym_3251 Chr3 (476367..479696) [3330 bp, 1109 aa] {ON} similar to
           Ashbya gossypii AER073C
          Length = 1109

 Score = 30.4 bits (67), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 24/114 (21%), Positives = 48/114 (42%), Gaps = 9/114 (7%)

Query: 137 SQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFAWYSKRLGISCAYVSSELF 196
           S +L   S+P   T+   L  + R+   ++  ++  D  +F  YS  L ++  Y+++ L 
Sbjct: 112 SSMLRQQSMPTVDTISVTLESISRIIT-ILMLTDSTDQREFEIYSHHLLLTVHYITNRLV 170

Query: 197 MAQDKSHNYEETFQFARDKLQRTMQLGEYYNN--------TEEWLWYTLLNSIN 242
               K     +  Q    +++  +   + YNN           + ++ L NSIN
Sbjct: 171 ENSKKRKTISQNTQLPAAQMKAALVFIQAYNNLLRAFMGKVVAYAYFYLPNSIN 224

>TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.188
           YDR069C
          Length = 970

 Score = 29.6 bits (65), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 2/68 (2%)

Query: 123 IKRLELNVPIAGHLSQ--LLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFAWY 180
           IK +E   P +G   +  LL   +   P     +LP+L   SD L  Y+N    +DF+  
Sbjct: 550 IKSIENYKPSSGSTMKPLLLKSATSKPPSQSLPSLPQLPSASDTLKSYTNSDKDYDFSIG 609

Query: 181 SKRLGISC 188
            + +G SC
Sbjct: 610 LENMGNSC 617

>TDEL0F04220 Chr6 complement(778175..792904) [14730 bp, 4909 aa] {ON}
            Anc_8.295 YLR106C
          Length = 4909

 Score = 29.6 bits (65), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 6/59 (10%)

Query: 193  SELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLLNSI--NLAKSQMA 249
            S +F  QD + NYEE F+      +  + + +   NT E    T LN I  +LAKS MA
Sbjct: 3164 SSIFKYQDDTDNYEEDFKKMFPDYEEILSVTDVDGNTAE----TELNEIYFSLAKSYMA 3218

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.132    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 27,587,980
Number of extensions: 1194131
Number of successful extensions: 3504
Number of sequences better than 10.0: 31
Number of HSP's gapped: 3569
Number of HSP's successfully gapped: 31
Length of query: 251
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 144
Effective length of database: 41,212,137
Effective search space: 5934547728
Effective search space used: 5934547728
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)