Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F11704g7.350ON38238218700.0
TDEL0C019807.350ON38537816170.0
NCAS0A141607.350ON45137815870.0
SAKL0F11374g7.350ON38337915760.0
Kwal_56.246427.350ON38137715740.0
Kpol_530.317.350ON38038015630.0
KLTH0H01254g7.350ON38137915620.0
Suva_4.787.350ON38537915600.0
YDL168W (SFA1)7.350ON38637715570.0
Smik_4.707.350ON38638115570.0
Skud_4.897.350ON38538115500.0
TBLA0E00390singletonON38337715400.0
KLLA0D12342g7.350ON38438115340.0
ACL148C7.350ON38137715210.0
CAGL0L01111g7.350ON38137915130.0
Ecym_47237.350ON38137814890.0
TPHA0F029707.350ON38137914650.0
KAFR0B008807.350ON38137914200.0
KNAG0C037907.350ON38238613260.0
NDAI0A018907.350ON42238012771e-175
SAKL0A00880gsingletonON38838010371e-139
SAKL0C10164g3.118ON3512902531e-23
YBR145W (ADH5)3.118ON3512902513e-23
TBLA0I011402.480ON3772642496e-23
Suva_4.3943.118ON3512902478e-23
CAGL0J01441g2.480ON3722882461e-22
Smik_2.2843.118ON3512902442e-22
AER032W3.118ON3512902434e-22
Skud_2.2723.118ON3512902434e-22
KLLA0D19929gsingletonON3863392427e-22
NCAS0I023503.118ON3512932407e-22
KLLA0F21010g3.118ON3502642407e-22
SAKL0F06270gna 1ON3512902408e-22
CAGL0I07843g3.118ON3522842408e-22
SAKL0B00814g8.16ON3543932391e-21
KLTH0G15686g3.118ON3512902381e-21
KLLA0B00451gsingletonON3863742401e-21
Ecym_53313.118ON3482642382e-21
KAFR0G014203.118ON3512902363e-21
TBLA0E03430singletonON3512902337e-21
KLTH0D05588g2.480ON3892642339e-21
Skud_13.2402.480ON3752692321e-20
TBLA0E034403.118ON3512902311e-20
NCAS0I01720singletonON3512932311e-20
NDAI0A069303.118ON3512702302e-20
KAFR0A007902.480ON3772692302e-20
NDAI0H021602.480ON3812642303e-20
KNAG0K020003.118ON3502842274e-20
Skud_15.683.118ON3482842266e-20
YOL086C (ADH1)3.118ON3482842266e-20
Smik_15.713.118ON3482842257e-20
KLLA0B09064gna 2ON3742642269e-20
KLLA0F18260gsingletonON3482642241e-19
KLLA0F13530g2.480ON3752642241e-19
Kwal_26.77992.480ON3872642241e-19
Ecym_73912.480ON3752692242e-19
TPHA0G032102.480ON3772692242e-19
SAKL0B08184gna 2ON3732702232e-19
Suva_15.813.118ON3482842222e-19
AAR084WsingletonON3852902223e-19
Smik_13.520na 3ON3482842204e-19
KLTH0G18986g8.16ON3542742195e-19
Suva_13.494na 3ON3482842195e-19
Skud_13.477na 3ON3482872186e-19
YMR303C (ADH2)na 3ON3482842186e-19
KLTH0E05588gna 1ON3482842151e-18
Suva_13.2612.480ON3752692161e-18
Kwal_56.231983.118ON3512902152e-18
TDEL0D050503.118ON3512902152e-18
YMR083W (ADH3)2.480ON3752692153e-18
SAKL0E02838g2.480ON3772642134e-18
ZYRO0G03388g2.480ON3702882134e-18
Smik_13.2662.480ON3752692135e-18
ZYRO0B05940g3.118ON3792872119e-18
KAFR0L02010singletonON3512702091e-17
NCAS0A077802.480ON3732692091e-17
TDEL0C003908.16ON3533852091e-17
KAFR0L02000singletonON3612702045e-17
TPHA0M007303.118ON3502902037e-17
KLTH0D00616g7.3ON3823042038e-17
Kpol_431.82.480ON3802492038e-17
CAGL0D00198g7.3ON3832942021e-16
TDEL0A025602.480ON3732642021e-16
Kwal_55.19574singletonON3562532011e-16
Kpol_1036.193.118ON3532842001e-16
Suva_12.260singletonON3573762002e-16
YLR070C (XYL2)8.16ON3563821983e-16
TDEL0F03190na 1ON3512881949e-16
ZYRO0C12562gna 1ON3482871941e-15
Kpol_1058.118.16ON3532591941e-15
ABL033C2.480ON3732771941e-15
Suva_10.1548.16ON3563831941e-15
KLTH0A00418gsingletonON3562611931e-15
Skud_1.37.3ON3822801932e-15
ABR229C8.16ON3532811913e-15
Kwal_26.6684singletonON3562531913e-15
Kwal_55.20564singletonON2162351853e-15
YAL060W (BDH1)7.3ON3822631896e-15
TBLA0A042907.3ON3952401896e-15
Smik_48.1singletonON3573691887e-15
NCAS0J003008.16ON3572621878e-15
Kpol_1049.187.2ON3862421889e-15
Skud_20.2singletonON3573931879e-15
Skud_4.2singletonON3573931879e-15
KNAG0E025902.480ON3742691861e-14
YJR159W (SOR1)na 4ON3573991861e-14
Smik_1.67.3ON3822801842e-14
KLLA0F00506g7.3ON3852281842e-14
YDL246C (SOR2)singletonON3573991833e-14
ZYRO0G03410gsingletonON3732631816e-14
Suva_1.77.3ON3822651791e-13
TDEL0H044607.3ON3822791782e-13
KNAG0K01040singletonON3912381772e-13
Kwal_26.67397.3ON3822211762e-13
SAKL0D14872g7.3ON3832461711e-12
ZYRO0F02552g8.16ON3512631701e-12
NCAS0A076707.2ON4392381613e-11
SAKL0D14894g7.2ON3852411603e-11
KAFR0I001607.2ON3853101594e-11
YAL061W (BDH2)7.2ON4172691542e-10
NDAI0H020507.3ON3852771542e-10
Suva_1.67.2ON4172281523e-10
KLLA0D05511g8.16ON3542611487e-10
KAFR0I001707.3ON3812291452e-09
YBR046C (ZTA1)3.253ON3342571433e-09
KNAG0I00120singletonON3812331433e-09
Smik_1.57.2ON4172301425e-09
Skud_1.27.2ON4172301425e-09
KLLA0F00528g7.2ON3812951408e-09
NCAS0A076607.3ON3862291381e-08
TPHA0H03100singletonON3922821372e-08
KAFR0C005803.253ON3342461292e-07
KLLA0A10549g3.253ON3532381283e-07
KNAG0D00110singletonON3622111274e-07
Kwal_47.17532na 5ON3733801256e-07
NDAI0A063203.253ON3492661256e-07
NCAS0C03020singletonON3623571231e-06
TDEL0D037203.253ON3352511212e-06
NDAI0H020607.2ON3992771203e-06
Smik_2.1703.253ON3342631193e-06
KNAG0E042007.2ON3852801193e-06
KAFR0A08730singletonON3602471167e-06
NDAI0H02950singletonON3633531151e-05
KLTH0E07964gna 5ON3742951122e-05
SAKL0H22088gna 5ON3763081105e-05
Skud_2.1623.253ON3342431096e-05
NCAS0D01220na 6ON362961096e-05
NDAI0G04880singletonON3613921061e-04
TPHA0J00170singletonON3613431024e-04
NDAI0A08470singletonON3631231016e-04
CAGL0M14047gna 7ON359367998e-04
KLTH0C07854g3.253ON358345970.002
CAGL0H06853gsingletonON360379950.003
Kwal_26.9050singletonON36494950.003
KLTH0B04972gna 8ON360371940.004
Smik_26.3singletonON12593890.004
KLLA0E19889gna 8ON366121930.006
KLLA0F00638gna 9ON382218920.007
NDAI0H02940na 6ON361130910.008
ZYRO0A03366g3.253ON349143910.009
SAKL0H00374gsingletonON428102900.015
TDEL0A00140singletonON405151890.015
SAKL0C00264gsingletonON35993890.016
Ecym_1093singletonON383130880.019
Suva_6.13singletonON6859800.021
Smik_13.535na 7ON36085870.030
Skud_13.494na 7ON36085860.036
SAKL0D14938gsingletonON378183860.041
Suva_13.513na 7ON36094860.042
KNAG0B06990singletonON35890840.062
KNAG0K02680singletonON35987830.080
CAGL0H09944g3.253ON333247830.093
TPHA0A00140singletonON36295820.12
KAFR0C01550singletonON35993810.14
Kpol_1057.24na 10ON36093810.15
ZYRO0G10318gna 5ON37692810.18
TDEL0F02300na 5ON37990810.18
Kpol_526.18singletonON36198800.23
SAKL0D03872g3.253ON34886800.23
KAFR0H03770singletonON36596800.23
YMR318C (ADH6)na 7ON36085790.25
TPHA0E007307.413ON97860760.70
NCAS0I017303.253ON34991750.88
ABL090W3.253ON334107741.2
SAKL0A10560gsingletonON40979703.4
SAKL0F12958g7.413ON102743704.2
Skud_86.1singletonON8959644.7
Kpol_1018.1077.413ON112733704.8
CAGL0C01881g7.413ON99943695.1
YKL027W2.527ON44761685.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F11704g
         (382 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {...   724   0.0  
TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.3...   627   0.0  
NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa] ...   615   0.0  
SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {...   611   0.0  
Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]...   610   0.0  
Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON} (77132..7...   606   0.0  
KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly...   606   0.0  
Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W (...   605   0.0  
YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}  SFA1Bifunc...   604   0.0  
Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W (...   604   0.0  
Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W (...   601   0.0  
TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON}      597   0.0  
KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} high...   595   0.0  
ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON} Syn...   590   0.0  
CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highl...   587   0.0  
Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar...   578   0.0  
TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {O...   568   0.0  
KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {O...   551   0.0  
KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {O...   515   0.0  
NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350    496   e-175
SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON...   404   e-139
SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {...   102   1e-23
YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcoho...   101   3e-23
TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.4...   100   6e-23
Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W ...   100   8e-23
CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa] ...    99   1e-22
Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W ...    99   2e-22
AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic ho...    98   4e-22
Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W ...    98   4e-22
KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weak...    98   7e-22
NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118     97   7e-22
KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON} unip...    97   7e-22
SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} simila...    97   8e-22
CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {...    97   8e-22
SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar ...    97   1e-21
KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]...    96   1e-21
KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON...    97   1e-21
Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar t...    96   2e-21
KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {O...    96   3e-21
TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON}               94   7e-21
KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {...    94   9e-21
Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083...    94   1e-20
TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.1...    94   1e-20
NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON}               94   1e-20
NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON} Anc_3...    93   2e-20
KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {O...    93   2e-20
NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480     93   3e-20
KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3....    92   4e-20
Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {O...    92   6e-20
YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON} ...    92   6e-20
Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {O...    91   7e-20
KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {...    92   9e-20
KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]...    91   1e-19
KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON} unip...    91   1e-19
Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {O...    91   1e-19
Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar t...    91   2e-19
TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {O...    91   2e-19
SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON} unipro...    91   2e-19
Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {O...    90   2e-19
AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-synteni...    90   3e-19
Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {...    89   4e-19
KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]...    89   5e-19
Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {...    89   5e-19
Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {...    89   6e-19
YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON} ...    89   6e-19
KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {...    87   1e-18
Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083...    88   1e-18
Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086...    87   2e-18
TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.1...    87   2e-18
YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}  ADH3Mitoc...    87   3e-18
SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON} unipro...    87   4e-18
ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {...    87   4e-18
Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083...    87   5e-18
ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly...    86   9e-18
KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON}              85   1e-17
NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON} Anc_2...    85   1e-17
TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16 ...    85   1e-17
KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON}              83   5e-17
TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {...    83   7e-17
KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar ...    83   8e-17
Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON} (21043..22...    83   8e-17
CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar ...    82   1e-16
TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {O...    82   1e-16
Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON...    82   1e-16
Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON} (51276....    82   1e-16
Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159...    82   2e-16
YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON} ...    81   3e-16
TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possib...    79   9e-16
ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly...    79   1e-15
Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON} (41165....    79   1e-15
ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON} S...    79   1e-15
Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {...    79   1e-15
KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON...    79   1e-15
Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)     79   2e-15
ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON} S...    78   3e-15
Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W (...    78   3e-15
Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {O...    76   3e-15
YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}  BDH1NAD-depe...    77   6e-15
TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7...    77   6e-15
Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR15...    77   7e-15
NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16       77   8e-15
Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {O...    77   9e-15
Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)     77   9e-15
Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR1...    77   9e-15
KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {O...    76   1e-14
YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbi...    76   1e-14
Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)     75   2e-14
KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON...    75   2e-14
YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}  SOR2...    75   3e-14
ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {...    74   6e-14
Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)     74   1e-13
TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {O...    73   2e-13
KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {...    73   2e-13
Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W (...    72   2e-13
SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]...    70   1e-12
ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} simila...    70   1e-12
NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa] ...    67   3e-11
SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]...    66   3e-11
KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2 Y...    66   4e-11
YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative...    64   2e-10
NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {O...    64   2e-10
Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)     63   3e-10
KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {...    62   7e-10
KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3 Y...    60   2e-09
YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}  ...    60   3e-09
KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON}                  60   3e-09
Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)     59   5e-09
Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)      59   5e-09
KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON...    59   8e-09
NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa] ...    58   1e-08
TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {O...    57   2e-08
KAFR0C00580 Chr3 (113544..114548) [1005 bp, 334 aa] {ON} Anc_3.2...    54   2e-07
KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly...    54   3e-07
KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON}                   54   4e-07
Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318...    53   6e-07
NDAI0A06320 Chr1 (1438393..1439442) [1050 bp, 349 aa] {ON} Anc_3...    53   6e-07
NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {O...    52   1e-06
TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.2...    51   2e-06
NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {O...    51   3e-06
Smik_2.170 Chr2 complement(312211..313215) [1005 bp, 334 aa] {ON...    50   3e-06
KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {O...    50   3e-06
KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa] ...    49   7e-06
NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {O...    49   1e-05
KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} simila...    48   2e-05
SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} simi...    47   5e-05
Skud_2.162 Chr2 complement(299642..300646) [1005 bp, 334 aa] {ON...    47   6e-05
NCAS0D01220 Chr4 (223821..224909) [1089 bp, 362 aa] {ON}               47   6e-05
NDAI0G04880 Chr7 complement(1175518..1176603) [1086 bp, 361 aa] ...    45   1e-04
TPHA0J00170 Chr10 (40911..41996) [1086 bp, 361 aa] {ON}                44   4e-04
NDAI0A08470 Chr1 (1954035..1955126) [1092 bp, 363 aa] {ON}             44   6e-04
CAGL0M14047g Chr13 complement(1386775..1387854) [1080 bp, 359 aa...    43   8e-04
KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} simila...    42   0.002
CAGL0H06853g Chr8 complement(680184..681266) [1083 bp, 360 aa] {...    41   0.003
Kwal_26.9050 s26 (1055019..1056113) [1095 bp, 364 aa] {ON} YCR10...    41   0.003
KLTH0B04972g Chr2 (408153..409235) [1083 bp, 360 aa] {ON} highly...    41   0.004
Smik_26.3 Chr26 (2136..2513) [378 bp, 125 aa] {ON} YMR318C (REAL)      39   0.004
KLLA0E19889g Chr5 (1770061..1771161) [1101 bp, 366 aa] {ON} simi...    40   0.006
KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly s...    40   0.007
NDAI0H02940 Chr8 complement(717073..718158) [1086 bp, 361 aa] {O...    40   0.008
ZYRO0A03366g Chr1 (271779..272828) [1050 bp, 349 aa] {ON} highly...    40   0.009
SAKL0H00374g Chr8 (45725..47011) [1287 bp, 428 aa] {ON} weakly s...    39   0.015
TDEL0A00140 Chr1 (23016..24233) [1218 bp, 405 aa] {ON}                 39   0.015
SAKL0C00264g Chr3 complement(17429..18508) [1080 bp, 359 aa] {ON...    39   0.016
Ecym_1093 Chr1 complement(195854..197005) [1152 bp, 383 aa] {ON}...    39   0.019
Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON} ...    35   0.021
Smik_13.535 Chr13 complement(893727..894809) [1083 bp, 360 aa] {...    38   0.030
Skud_13.494 Chr13 complement(884038..885120) [1083 bp, 360 aa] {...    38   0.036
SAKL0D14938g Chr4 complement(1235542..1236678) [1137 bp, 378 aa]...    38   0.041
Suva_13.513 Chr13 complement(894394..895476) [1083 bp, 360 aa] {...    38   0.042
KNAG0B06990 Chr2 (1393058..1394134) [1077 bp, 358 aa] {ON}             37   0.062
KNAG0K02680 Chr11 complement(531173..532252) [1080 bp, 359 aa] {...    37   0.080
CAGL0H09944g Chr8 complement(971519..972520) [1002 bp, 333 aa] {...    37   0.093
TPHA0A00140 Chr1 (14857..15945) [1089 bp, 362 aa] {ON}                 36   0.12 
KAFR0C01550 Chr3 complement(318350..319429) [1080 bp, 359 aa] {O...    36   0.14 
Kpol_1057.24 s1057 (53467..54549) [1083 bp, 360 aa] {ON} (53467....    36   0.15 
ZYRO0G10318g Chr7 (831554..832684) [1131 bp, 376 aa] {ON} simila...    36   0.18 
TDEL0F02300 Chr6 complement(421372..422511) [1140 bp, 379 aa] {O...    36   0.18 
Kpol_526.18 s526 (51360..52445) [1086 bp, 361 aa] {ON} (51360..5...    35   0.23 
SAKL0D03872g Chr4 (316127..317173) [1047 bp, 348 aa] {ON} highly...    35   0.23 
KAFR0H03770 Chr8 complement(715399..716496) [1098 bp, 365 aa] {O...    35   0.23 
YMR318C Chr13 complement(911061..912143) [1083 bp, 360 aa] {ON} ...    35   0.25 
TPHA0E00730 Chr5 (139190..142126) [2937 bp, 978 aa] {ON} Anc_7.4...    34   0.70 
NCAS0I01730 Chr9 (319449..320498) [1050 bp, 349 aa] {ON} Anc_3.253     33   0.88 
ABL090W Chr2 (230699..231703) [1005 bp, 334 aa] {ON} Syntenic ho...    33   1.2  
SAKL0A10560g Chr1 (928213..929442) [1230 bp, 409 aa] {ON} simila...    32   3.4  
SAKL0F12958g Chr6 complement(1019015..1022098) [3084 bp, 1027 aa...    32   4.2  
Skud_86.1 Chr86 complement(469..738) [270 bp, 89 aa] {ON} YJR159...    29   4.7  
Kpol_1018.107 s1018 complement(282640..286023) [3384 bp, 1127 aa...    32   4.8  
CAGL0C01881g Chr3 (196299..199298) [3000 bp, 999 aa] {ON} simila...    31   5.1  
YKL027W Chr11 (387562..388905) [1344 bp, 447 aa] {ON} Protein of...    31   5.6  

>ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 382

 Score =  724 bits (1870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/382 (93%), Positives = 357/382 (93%)

Query: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPE 60
           MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPE
Sbjct: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPE 60

Query: 61  GAFPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQ 120
           GAFPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQ
Sbjct: 61  GAFPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQ 120

Query: 121 GKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVT 180
           GKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYT           PKAPLESACLLGCGVT
Sbjct: 121 GKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTVVADVSVVAVDPKAPLESACLLGCGVT 180

Query: 181 TGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGA 240
           TGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGA
Sbjct: 181 TGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGA 240

Query: 241 TDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKXXXXXXXXXX 300
           TDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHK          
Sbjct: 241 TDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKGWGVSVVIGV 300

Query: 301 XXXXQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQ 360
               QEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQ
Sbjct: 301 AASGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQ 360

Query: 361 INEAFEDLHAGDSLRTVLNYTD 382
           INEAFEDLHAGDSLRTVLNYTD
Sbjct: 361 INEAFEDLHAGDSLRTVLNYTD 382

>TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.350
           YDL168W
          Length = 385

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/378 (80%), Positives = 330/378 (87%)

Query: 2   STEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEG 61
           +TEGK +T +AAVAYEAGKPL+VEEITV+ P+AHEVRI+++ TAVCHTDAYTLSG DPEG
Sbjct: 5   ATEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEG 64

Query: 62  AFPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQG 121
           AFPSILGHEGAGIVESVGEGVT+VKPGDHV+ALYTAEC KCKFCKSGKTNLC SVRATQG
Sbjct: 65  AFPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQG 124

Query: 122 KGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTT 181
           KGVMPDGTSRFKN+KGE L HFMGCSTFS+YT           P APLES CLLGCGVTT
Sbjct: 125 KGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTVVADVSVVAVDPSAPLESICLLGCGVTT 184

Query: 182 GYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGAT 241
           GYGAA KTANVQKGDTVA+FGAGTVGLSV QGAK RGAS+IILVDIND K+KY +EFGAT
Sbjct: 185 GYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGAT 244

Query: 242 DFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKXXXXXXXXXXX 301
           DFINP +DL++GQTIVEKLIEMTDGGLD+TFDCTGN KVMRDALEACHK           
Sbjct: 245 DFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVA 304

Query: 302 XXXQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQI 361
              +EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLI+DY+ G LKVDEFITN RPF +I
Sbjct: 305 AAEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEI 364

Query: 362 NEAFEDLHAGDSLRTVLN 379
           N+AFEDLHAGD LRTVL+
Sbjct: 365 NKAFEDLHAGDCLRTVLD 382

>NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa]
           {ON} Anc_7.350
          Length = 451

 Score =  615 bits (1587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/378 (78%), Positives = 330/378 (87%)

Query: 2   STEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEG 61
           ST+GKP+T  AAVAY AGKPL+VE+I VDPPKAHEVRI+++ TAVCHTDAYTLSG DPEG
Sbjct: 71  STQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPEG 130

Query: 62  AFPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQG 121
           AFPSILGHEG+GIVESVGEGVT+VK GDHV+ALYTAECGKCKFCKSGKTNLCGSVRATQG
Sbjct: 131 AFPSILGHEGSGIVESVGEGVTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRATQG 190

Query: 122 KGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTT 181
           KGVMPDGTSRF N+KGE LLHFMGCSTFS+YT           PKAPL+S  LLGCGVTT
Sbjct: 191 KGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTVVADVSVVAVDPKAPLDSISLLGCGVTT 250

Query: 182 GYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGAT 241
           GYGAA+KTANVQKGDTVA+FGAGTVGLSV QGAK+RGAS+II+VDIN+ KK++  +FGAT
Sbjct: 251 GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGAT 310

Query: 242 DFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKXXXXXXXXXXX 301
           DF+NP  DL+ G+TIV+KLIEMTDGGL++TFDCTGNVKVMRDALEACHK           
Sbjct: 311 DFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWGESIIIGVA 370

Query: 302 XXXQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQI 361
              +EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLI+DYQ G LKVDEFIT+RRPF +I
Sbjct: 371 GAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFTEI 430

Query: 362 NEAFEDLHAGDSLRTVLN 379
           N+AFEDLH GD LRTVL+
Sbjct: 431 NDAFEDLHHGDCLRTVLD 448

>SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 383

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/379 (77%), Positives = 324/379 (85%)

Query: 3   TEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEGA 62
           T GKP+T LAAVAYEAGKPL+VEEI V+PPKAHEVRIR+  TAVCHTDAYTLSG DPEGA
Sbjct: 4   TVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGA 63

Query: 63  FPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQGK 122
           FPSILGHEGAG+VESVG+GVT+VKPGDHVVALYTAEC KCKFC SGKTNLCGSVRATQGK
Sbjct: 64  FPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRATQGK 123

Query: 123 GVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTG 182
           GVMPDGTSRF+ K GE++LHFMGCSTFS+YT            +APL+  CLLGCGVTTG
Sbjct: 124 GVMPDGTSRFRTKNGESILHFMGCSTFSQYTVVADVSVVAVDSQAPLDRICLLGCGVTTG 183

Query: 183 YGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATD 242
           YGAA+KTANVQKGDTVA+FGAGTVGLSV QGAKARGAS+II+VDIND KK++  +FGATD
Sbjct: 184 YGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATD 243

Query: 243 FINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKXXXXXXXXXXXX 302
           F+NP+ DL+ G+TIV KLIE+TDGGLDFTFDCTGN KVMRDALEACHK            
Sbjct: 244 FVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303

Query: 303 XXQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQIN 362
             QEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY  G LKVDEFIT+RRPF +IN
Sbjct: 304 AGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTEIN 363

Query: 363 EAFEDLHAGDSLRTVLNYT 381
            AF+DLH GD LRTVL+ +
Sbjct: 364 AAFDDLHHGDCLRTVLDLS 382

>Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]
           {ON} YDL168W (SFA1) - Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
           [contig 161] FULL
          Length = 381

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/377 (77%), Positives = 323/377 (85%)

Query: 3   TEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEGA 62
           +EGKP+T LAAVAYEAGKPL++EEI VDPPKAHEVR+++  TAVCHTDAYTLSG DPEGA
Sbjct: 2   SEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA 61

Query: 63  FPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQGK 122
           FPSILGHEGAGIVES+GEGVT+VKPGDHV+ALYTAEC +CKFCKSGKTNLCGSVRATQGK
Sbjct: 62  FPSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGK 121

Query: 123 GVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTG 182
           GVMPDGT+RF NKKGE +LHFMGCSTFS+YT           PKAPL+  CLLGCGVTTG
Sbjct: 122 GVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTG 181

Query: 183 YGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATD 242
           YGAAVKTANVQKGDTVA+FGAGTVGLSV QGAK RGAS+II+VDIND KK++ +EFGATD
Sbjct: 182 YGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATD 241

Query: 243 FINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKXXXXXXXXXXXX 302
           F+NP+ DL++G+TIV+ L+EMTDGGLD+TFDCTGN  VMR ALEACHK            
Sbjct: 242 FVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAA 301

Query: 303 XXQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQIN 362
             +EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLI DY  G LKVDEFIT+RR F  IN
Sbjct: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDIN 361

Query: 363 EAFEDLHAGDSLRTVLN 379
            AFEDLH GD LRTVL+
Sbjct: 362 SAFEDLHHGDCLRTVLD 378

>Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON}
           (77132..78274) [1143 nt, 381 aa]
          Length = 380

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/380 (77%), Positives = 322/380 (84%), Gaps = 1/380 (0%)

Query: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPE 60
           MST GKP+T  AAVAYEA KPL VEEI VDPPKAHEVRI++  TAVCHTDAYTLSG DPE
Sbjct: 1   MSTVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPE 60

Query: 61  GAFPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQ 120
           G FP +LGHEG+GIVESVG+ VT+VKPGDHVVALYTAECGKCKFC SGKTNLCGSVRATQ
Sbjct: 61  GLFPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQ 120

Query: 121 GKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVT 180
           GKGVMPDGT RF NKKGE L HFMGCSTFSEYT           P APL+S CLLGCGVT
Sbjct: 121 GKGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVT 180

Query: 181 TGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGA 240
           TGYGAA+KTANVQKGDTVA+FGAGTVGLSV QGAK+RGAS+II+VDIN+ KK++  EFGA
Sbjct: 181 TGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGA 240

Query: 241 TDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKXXXXXXXXXX 300
           TDF+NP ++L  GQ IV KL+EMTDGGLDFTFDCTGNV VMRDALEACHK          
Sbjct: 241 TDFVNP-SELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGV 299

Query: 301 XXXXQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQ 360
               +EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ G+LKVDEFITNRRPF +
Sbjct: 300 AAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVE 359

Query: 361 INEAFEDLHAGDSLRTVLNY 380
           IN+AFE+LH G+ LRTVL++
Sbjct: 360 INDAFEELHHGNCLRTVLSF 379

>KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 381

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/379 (77%), Positives = 321/379 (84%)

Query: 3   TEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEGA 62
           +EGKP+T  AAVAYEAGKPL+VEEI VDPPKAHEVRI+V+ TAVCHTDAYTLSG DPEGA
Sbjct: 2   SEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA 61

Query: 63  FPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQGK 122
           FPSILGHEGAG+VESVGEGVT+VK GDHV+ALYTAEC +CKFCKSGKTNLCGSVRATQGK
Sbjct: 62  FPSILGHEGAGVVESVGEGVTNVKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGK 121

Query: 123 GVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTG 182
           GVMPDGTSRF NKKGE LLHFMGCSTFS+YT           PKAPL+  CLLGCGVTTG
Sbjct: 122 GVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTG 181

Query: 183 YGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATD 242
           YGAAVKTA+VQKGDTVAIFGAGTVGLSV QGA  RGAS+II+VDIND KK++  +FGATD
Sbjct: 182 YGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATD 241

Query: 243 FINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKXXXXXXXXXXXX 302
           F+NP+  L++GQTIV+KL+EMTDGGLDFTFDCTGN  VMR ALEACHK            
Sbjct: 242 FVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAA 301

Query: 303 XXQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQIN 362
             +EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY  G LKVDEFIT+RR F  IN
Sbjct: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDIN 361

Query: 363 EAFEDLHAGDSLRTVLNYT 381
            AFEDLH GD LRTVL+ +
Sbjct: 362 SAFEDLHHGDCLRTVLDLS 380

>Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/379 (76%), Positives = 322/379 (84%)

Query: 2   STEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEG 61
           ST GKP+  +AA+AY+A KPLSVEEITVDPPKAHEVRI+++ TAVCHTDAYTLSG+DPEG
Sbjct: 4   STVGKPIQCIAAIAYDAKKPLSVEEITVDPPKAHEVRIKIEYTAVCHTDAYTLSGSDPEG 63

Query: 62  AFPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQG 121
            FP ILGHEGAGIVESVG+ VT+VKPGDHV+ALYTAECGKCKFC SGKTNLC +VRATQG
Sbjct: 64  LFPCILGHEGAGIVESVGDDVTTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQG 123

Query: 122 KGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTT 181
           +G+MPD T+RF N KGE + HFMGCSTFSEYT           PKAPL++A LLGCGVTT
Sbjct: 124 RGIMPDETTRFHNGKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAASLLGCGVTT 183

Query: 182 GYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGAT 241
           GYGAAVKTANVQKGDTVA+FG GTVGLSV QGAKARGAS+II +DIN+ KK+Y  +FGAT
Sbjct: 184 GYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKARGASKIIGIDINNKKKQYCFDFGAT 243

Query: 242 DFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKXXXXXXXXXXX 301
           DFINP  DL  GQTIVEKLIE TDGGLDFTFDCTGN K+MRDALEACHK           
Sbjct: 244 DFINPKEDLAKGQTIVEKLIETTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGVA 303

Query: 302 XXXQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQI 361
              +EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ GALKV+EFIT+RRPFK+I
Sbjct: 304 AAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGALKVEEFITHRRPFKEI 363

Query: 362 NEAFEDLHAGDSLRTVLNY 380
           N+AFEDLH GD LRTVL +
Sbjct: 364 NQAFEDLHQGDCLRTVLKF 382

>YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}
           SFA1Bifunctional enzyme containing both alcohol
           dehydrogenase and glutathione-dependent formaldehyde
           dehydrogenase activities, functions in formaldehyde
           detoxification and formation of long chain and complex
           alcohols, regulated by Hog1p-Sko1p
          Length = 386

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/377 (76%), Positives = 321/377 (85%)

Query: 2   STEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEG 61
           +T GKP+  +AAVAY+A KPLSVEEITVD PKAHEVRI+++ TAVCHTDAYTLSG+DPEG
Sbjct: 4   ATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEG 63

Query: 62  AFPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQG 121
            FP +LGHEGAGIVESVG+ V +VKPGDHV+ALYTAECGKCKFC SGKTNLCG+VRATQG
Sbjct: 64  LFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQG 123

Query: 122 KGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTT 181
           KGVMPDGT+RF N KGE + HFMGCSTFSEYT           PKAPL++ACLLGCGVTT
Sbjct: 124 KGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTT 183

Query: 182 GYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGAT 241
           G+GAA+KTANVQKGDTVA+FG GTVGLSV QGAK RGAS+II +DIN+ KK+Y  +FGAT
Sbjct: 184 GFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAIDINNKKKQYCSQFGAT 243

Query: 242 DFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKXXXXXXXXXXX 301
           DF+NP  DL   QTIVEKLIEMTDGGLDFTFDCTGN K+MRDALEACHK           
Sbjct: 244 DFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGVA 303

Query: 302 XXXQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQI 361
              +EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ GALKV+EFIT+RRPFK+I
Sbjct: 304 AAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKEI 363

Query: 362 NEAFEDLHAGDSLRTVL 378
           N+AFEDLH GD LRTVL
Sbjct: 364 NQAFEDLHNGDCLRTVL 380

>Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W
           (REAL)
          Length = 386

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/381 (76%), Positives = 320/381 (83%)

Query: 2   STEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEG 61
           +T GKP+  +AAVAY+A KP SVEEITVD PKAHEVRI+++ TAVCHTDAYTLSG+DPEG
Sbjct: 4   ATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEG 63

Query: 62  AFPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQG 121
            FP ILGHEGAGIVESVG+GV +VKPGDHV+ALYTAECGKCKFC SGKTNLC +VRATQG
Sbjct: 64  LFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQG 123

Query: 122 KGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTT 181
           KGVMPDGT+RF N KG+ + HFMGCSTFSEYT           PKAPL+++CLLGCGVTT
Sbjct: 124 KGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTT 183

Query: 182 GYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGAT 241
           GYGAAVKTANVQKGDTVA+FG GTVGLSV QGAK RGAS+II VDIN+ KKKY  +FGAT
Sbjct: 184 GYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGAT 243

Query: 242 DFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKXXXXXXXXXXX 301
           DFINP  DL   QTIVEKL+EMTDGGLDFTFDCTGN K+MRDALEACHK           
Sbjct: 244 DFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGVA 303

Query: 302 XXXQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQI 361
              +EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ G LKV+EFIT+RRPFK+I
Sbjct: 304 AAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKEI 363

Query: 362 NEAFEDLHAGDSLRTVLNYTD 382
           N AFEDLH GD LRTVL + +
Sbjct: 364 NHAFEDLHNGDCLRTVLKFDE 384

>Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/381 (75%), Positives = 320/381 (83%)

Query: 2   STEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEG 61
           +T GKP+  +AAVAY A K LSVEEITVDPPKAHEVRI+++ TAVCHTDAYTLSG+DPEG
Sbjct: 4   ATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEG 63

Query: 62  AFPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQG 121
            FP ILGHEGAGIVESVG+ V +VKPGDHV+ALYTAECGKCKFC SGKTNLC +VRATQG
Sbjct: 64  LFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQG 123

Query: 122 KGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTT 181
           KGVMPDGT+RF N KGE + HFMGCSTFSEYT           PKAPL++ACLLGCGVTT
Sbjct: 124 KGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTT 183

Query: 182 GYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGAT 241
           GYGAA+KTANVQ+GDTVA+FG GTVGLSV QGAK+RGAS+II VDIN+ K++Y   FGAT
Sbjct: 184 GYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGAT 243

Query: 242 DFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKXXXXXXXXXXX 301
           DFINP  DL   QTIVEKLI+MTDGGLDFTFDCTGN  +MRDALEACHK           
Sbjct: 244 DFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSIIIGVA 303

Query: 302 XXXQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQI 361
              +EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ GALKV+EFIT+RRPFK+I
Sbjct: 304 AAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFKEI 363

Query: 362 NEAFEDLHAGDSLRTVLNYTD 382
           N+AFEDLH GD LRTVL + +
Sbjct: 364 NQAFEDLHNGDCLRTVLRFQE 384

>TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON} 
          Length = 383

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/377 (75%), Positives = 318/377 (84%)

Query: 3   TEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEGA 62
           T+GKP+  LAAVAY+A +PL+VEEI V+PP+AHEVRI++  TAVCHTDAYTLSG DPEGA
Sbjct: 4   TQGKPIKCLAAVAYKAAEPLTVEEIIVEPPEAHEVRIKITHTAVCHTDAYTLSGVDPEGA 63

Query: 63  FPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQGK 122
           FP +LGHEG+GIVESVGEGV+SVK GDHV+ALYTAECG CKFCKSGKTNLCGSVR TQGK
Sbjct: 64  FPCVLGHEGSGIVESVGEGVSSVKVGDHVIALYTAECGVCKFCKSGKTNLCGSVRETQGK 123

Query: 123 GVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTG 182
           GVMPDGTSRFKN KGE+LLHFMGCSTFS+YT             APL+S CLLGCGVTTG
Sbjct: 124 GVMPDGTSRFKNLKGESLLHFMGCSTFSQYTVVADVSVVAINKTAPLQSVCLLGCGVTTG 183

Query: 183 YGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATD 242
           YGAA+KTANVQK DTVA+FGAGTVGLSV QGA+ARGAS+II+VD+N  K+ Y  +FGATD
Sbjct: 184 YGAAIKTANVQKNDTVAVFGAGTVGLSVVQGAQARGASKIIMVDVNSKKETYSRQFGATD 243

Query: 243 FINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKXXXXXXXXXXXX 302
           FINP TDL+ G+TIV KL+EMTDGGLD TFDCTGNVKVMRDALE CHK            
Sbjct: 244 FINPMTDLKPGETIVSKLVEMTDGGLDHTFDCTGNVKVMRDALECCHKGWGQSIIIGVAA 303

Query: 303 XXQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQIN 362
             QEISTRPFQLVTGRVWKGSAFGG+KGRSEMGGLI+ YQ G LKVD+FITN+RPF +IN
Sbjct: 304 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMGGLIESYQKGDLKVDQFITNKRPFTEIN 363

Query: 363 EAFEDLHAGDSLRTVLN 379
            AFEDLH GD LRTVL+
Sbjct: 364 AAFEDLHHGDCLRTVLD 380

>KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 384

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/381 (75%), Positives = 319/381 (83%)

Query: 2   STEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEG 61
           +T GKP+  +AAVAYEAGKPL+VE+I VD PKAHEVR++V  TAVCHTDAYTLSG DPEG
Sbjct: 4   ATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEG 63

Query: 62  AFPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQG 121
           AFPSILGHEGAGIVESVG+GVT+VK GDHVV LYTAECGKCKFCKS KTNLCGSVRATQG
Sbjct: 64  AFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQG 123

Query: 122 KGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTT 181
           KGVMPDGT+RF N KGE LLHFMGCSTFS+YT           P APL S CLLGCGVTT
Sbjct: 124 KGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTT 183

Query: 182 GYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGAT 241
           GYGAAVKTANVQ+GDTVA+FGAGTVGLSV QGAK+RGAS+II+VD+ND KK++  +FGAT
Sbjct: 184 GYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGAT 243

Query: 242 DFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKXXXXXXXXXXX 301
            F+NP  DL+ G+TIV KLI+MTDGGLDFTFDCTGNVKVMRDALEACHK           
Sbjct: 244 GFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSIIIGVA 303

Query: 302 XXXQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQI 361
              +EISTRPFQL+TGRVWKGSAFGGIKGRSEMG L+  YQ G LKVD+FIT++RPF +I
Sbjct: 304 AAGEEISTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTEI 363

Query: 362 NEAFEDLHAGDSLRTVLNYTD 382
           N AFEDLH GD LRTVL+  +
Sbjct: 364 NNAFEDLHHGDCLRTVLDLAN 384

>ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL168W
           (SFA1)
          Length = 381

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/377 (74%), Positives = 319/377 (84%)

Query: 3   TEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEGA 62
           T+GKP+   AAVAY AG+PL +E++TVDPPKAHEVRI++  +A+CHTDAYTLSG+DPEG 
Sbjct: 4   TQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL 63

Query: 63  FPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQGK 122
           FP ILGHEG+GIVESVGEGVT+VKPGDHVV LYTAEC +CKFC SGKTNLCG+VRATQGK
Sbjct: 64  FPCILGHEGSGIVESVGEGVTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRATQGK 123

Query: 123 GVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTG 182
           GVMPDGTSRF+N KGETL HFMGCSTFSEYT            +APLE+ CLLGCGVTTG
Sbjct: 124 GVMPDGTSRFRNGKGETLYHFMGCSTFSEYTVVADVSVVAVDQQAPLETVCLLGCGVTTG 183

Query: 183 YGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATD 242
           YGAAVKTA+VQ+GDTVA+FGAGTVGLSV QGAKAR AS+II+VDINDAK+++  +FGATD
Sbjct: 184 YGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATD 243

Query: 243 FINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKXXXXXXXXXXXX 302
           FINP TDL+ G+TIV +LIEMTDGGLD TFDCTGN KVMRDALEACHK            
Sbjct: 244 FINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303

Query: 303 XXQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQIN 362
             QEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL++DY  G LKV EF+T++RPF++IN
Sbjct: 304 AGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEIN 363

Query: 363 EAFEDLHAGDSLRTVLN 379
             FEDLH GD LRTVL+
Sbjct: 364 SGFEDLHHGDCLRTVLS 380

>CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168w SFA1 long-chain alcohol dehydrogenase
          Length = 381

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/379 (75%), Positives = 311/379 (82%)

Query: 3   TEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEGA 62
           TEGKP+  LAAVAYEAGKP  VE+I VDPPKAHEVRI++  TAVCHTDAYTLSGADPEG 
Sbjct: 2   TEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL 61

Query: 63  FPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQGK 122
           FP +LGHEGAGIVESVG+GVT+VKPGDHV+ALYTAEC KCKFC SGKTNLCG+VRATQGK
Sbjct: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGK 121

Query: 123 GVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTG 182
           GVMPDGTSRF NKKGE+L HFMGCSTFSEYT             APLES CLLGCGVTTG
Sbjct: 122 GVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTG 181

Query: 183 YGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATD 242
           YGAAVKTANVQKGDTVA+FG GTVGLSV QGA  RGAS+II +D ND KK +  +FGATD
Sbjct: 182 YGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATD 241

Query: 243 FINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKXXXXXXXXXXXX 302
           FINP  DL+  +TIV KLIEMTDGGLD TFDCTGNV VMR ALEACHK            
Sbjct: 242 FINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAA 301

Query: 303 XXQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQIN 362
             QEISTRPFQLVTGRVWKGSAFGG+KGRSEM GLI+ Y+ G LKVDEFIT+RR F +IN
Sbjct: 302 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEIN 361

Query: 363 EAFEDLHAGDSLRTVLNYT 381
           EAF+DLH G  LRTVL+++
Sbjct: 362 EAFDDLHNGLCLRTVLSFS 380

>Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar to
           Ashbya gossypii ACL148C
          Length = 381

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/378 (73%), Positives = 307/378 (81%)

Query: 3   TEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEGA 62
           T GK +   AA+AY AG PL +E ITVDPPKAHEVRI++  TA+CHTDAYTLSG DPEG 
Sbjct: 4   TAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI 63

Query: 63  FPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQGK 122
           FPSILGHEG+GIVESVG GVT+VK GDHV+ LYTAEC +CKFC SGKTNLCGSVRATQGK
Sbjct: 64  FPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRATQGK 123

Query: 123 GVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTG 182
           G+MPDGTSRFKN KGE + HFMGCSTFSEYT            KAPL+  CLLGCGVTTG
Sbjct: 124 GLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTG 183

Query: 183 YGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATD 242
           YGAAVKTA+VQKGDTVA+FGAGTVGLSV QGA++RGAS+II+VDIND KKK+  +FGATD
Sbjct: 184 YGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATD 243

Query: 243 FINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKXXXXXXXXXXXX 302
           FINP  DL +G+TIV KLI+MTDGGLD TFDCTGN KVMRDALEACHK            
Sbjct: 244 FINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303

Query: 303 XXQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQIN 362
             QEISTRPFQLVTGRVWKGSAFGGIKGRSEMG LI DY  G LKVDEF+T+ RPF +IN
Sbjct: 304 AGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSEIN 363

Query: 363 EAFEDLHAGDSLRTVLNY 380
           +   DLH GD LRTVLN+
Sbjct: 364 DGLTDLHHGDCLRTVLNF 381

>TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/379 (72%), Positives = 308/379 (81%), Gaps = 1/379 (0%)

Query: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPE 60
           MS  GKP+T  AA+AYEA KPL+V EI VDPPKAHEVRI++ KTAVCHTDAY+LSG DPE
Sbjct: 1   MSAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPE 60

Query: 61  GAFPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQ 120
           G FP +LGHEG+GIVES+G  VT+VK GDHV+ALYTAECGKCKFC SGKTNLCGSVRATQ
Sbjct: 61  GLFPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQ 120

Query: 121 GKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVT 180
           GKGVMPDGT+RF +K G+ + HFMGCSTFS+YT                E   LLGCGVT
Sbjct: 121 GKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVT 180

Query: 181 TGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGA 240
           TGYGAA+KTAN+QKGDTVA+FGAGTVGLSV QGAK+RGAS+II+VD+N+ KK +  EFGA
Sbjct: 181 TGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGA 240

Query: 241 TDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKXXXXXXXXXX 300
           TDF+NP  +L++ + IV KLIEMTDGGLDFTFDCTGNV VMR+ALEACHK          
Sbjct: 241 TDFVNPK-ELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGV 299

Query: 301 XXXXQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQ 360
               QEI+TRPFQLVTGRVW+GSAFGGIKGRSEMGGLIKDYQ G LKVDEFIT RRPF +
Sbjct: 300 AAAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTE 359

Query: 361 INEAFEDLHAGDSLRTVLN 379
           IN AFEDLH G  LRTVL+
Sbjct: 360 INAAFEDLHNGSCLRTVLD 378

>KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  551 bits (1420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/379 (69%), Positives = 304/379 (80%)

Query: 2   STEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEG 61
           ST+GK +   AAVAYEA KPL V+++ VD PKAHEVRI++  TA+CHTDAYTLSG DPEG
Sbjct: 3   STQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEG 62

Query: 62  AFPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQG 121
            FP ILGHEG+GIVES+GEGVTSVK GDHV+ LYTAEC KCKFCKSGKTNLCG+VR TQG
Sbjct: 63  LFPCILGHEGSGIVESIGEGVTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRETQG 122

Query: 122 KGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTT 181
           KGVMPDGTSRF   +G+ + HFMGCSTFSEYT            K  LE A LLGCGVTT
Sbjct: 123 KGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTT 182

Query: 182 GYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGAT 241
           G+GAAVK ANVQKGDTVA+FGAGTVGLSV QGA+ RG S++I+VDIND KK++ ++FGAT
Sbjct: 183 GFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGAT 242

Query: 242 DFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKXXXXXXXXXXX 301
           DF+NP TDL++G+TIV KLI MTDGGLD+TFDCTGNV VMR+ALEACHK           
Sbjct: 243 DFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVA 302

Query: 302 XXXQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQI 361
              QEISTRPFQLVTGRVW+G+AFG IKGR++M  L+ DY+ G LK+DEFIT+RR F +I
Sbjct: 303 AAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEI 362

Query: 362 NEAFEDLHAGDSLRTVLNY 380
           N+ FEDLH G  LRTVL +
Sbjct: 363 NDGFEDLHMGTCLRTVLKF 381

>KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {ON}
           Anc_7.350 YDL168W
          Length = 382

 Score =  515 bits (1326), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/386 (67%), Positives = 292/386 (75%), Gaps = 13/386 (3%)

Query: 2   STEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEG 61
           +TEG+ +T  AAVAY AGKPL+VE+ITV+ P         +     H   Y   G     
Sbjct: 3   NTEGQTITCTAAVAYAAGKPLTVEQITVEAPTG------ARGAYQDHQHCYLPHGCVHSV 56

Query: 62  AFPS-------ILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCG 114
            F S         G  GAG+VESVG  VTSVK GDHV+ALYTAEC +CK CKSGKTNLC 
Sbjct: 57  WFGSEVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCS 116

Query: 115 SVRATQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACL 174
           +VRATQGKGVMPDGTSRF+N KGE LLHFMGCSTF+EYT             APLE  CL
Sbjct: 117 AVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCL 176

Query: 175 LGCGVTTGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKY 234
           LGCGVTTGYGAA+KTANVQKGDTVA+FGAGT+GLSV QGAKAR AS+II+VDIND KKK+
Sbjct: 177 LGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKF 236

Query: 235 MHEFGATDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKXXXX 294
             +FGATDF+NP TDL++GQTIVEKL+EMTDGGLDFTFD TGNV+VMRDALEACHK    
Sbjct: 237 AFDFGATDFVNPKTDLKDGQTIVEKLVEMTDGGLDFTFDGTGNVQVMRDALEACHKGWGQ 296

Query: 295 XXXXXXXXXXQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITN 354
                     +EISTRPFQLVTGRVWKGSAFGG+KGRSEMG LI+DY  G LK+DEFITN
Sbjct: 297 SIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITN 356

Query: 355 RRPFKQINEAFEDLHAGDSLRTVLNY 380
           +RPFK+INE FEDLH GD LRTVLNY
Sbjct: 357 KRPFKEINEGFEDLHHGDCLRTVLNY 382

>NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350
          Length = 422

 Score =  496 bits (1277), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 252/380 (66%), Positives = 283/380 (74%), Gaps = 46/380 (12%)

Query: 2   STEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEG 61
           +T+GKP+T  AAVAYEAGKPL+VE+I VDPPKAHEVRI++  TAVCHTDAYTLSG DPEG
Sbjct: 88  TTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPEG 147

Query: 62  AFPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQG 121
           AFPSILGHEG+GIVESVGEGVT+VK GDHV+ALYTAECG+   CK  K+           
Sbjct: 148 AFPSILGHEGSGIVESVGEGVTNVKVGDHVIALYTAECGE---CKFCKSGXXXXXXXAVD 204

Query: 122 KGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTT 181
           K                                            AP++S CLLGCGVTT
Sbjct: 205 K-------------------------------------------NAPMDSICLLGCGVTT 221

Query: 182 GYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGAT 241
           GYGAA+KTANVQKGDTVA+FGAGTVGLSV QGAKARGAS+II+VD+ND KK++  +FGAT
Sbjct: 222 GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGAT 281

Query: 242 DFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKXXXXXXXXXXX 301
           DFINP TDL+ G+TIV KLIEMTDGGL++TFDCTGN KVMRDALEACHK           
Sbjct: 282 DFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWGESIIIGVA 341

Query: 302 XXXQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQI 361
              +EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ G LKVDEFIT+RRPF +I
Sbjct: 342 AAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPFTEI 401

Query: 362 NEAFEDLHAGDSLRTVLNYT 381
           N AFEDLH GD LRTVL+ +
Sbjct: 402 NNAFEDLHHGDCLRTVLDLS 421

>SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON}
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione- dependent formaldehyde dehydrogenase)
          Length = 388

 Score =  404 bits (1037), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 195/380 (51%), Positives = 257/380 (67%), Gaps = 3/380 (0%)

Query: 4   EGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEGAF 63
           EG+P+   AAVAY   KPL +E+I VDPP+ HEVR++V  TA+C TD +TL G +PEG F
Sbjct: 5   EGEPIRCTAAVAYSINKPLVLEQIIVDPPQEHEVRVKVTNTALCRTDLFTLKGLNPEGKF 64

Query: 64  PSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQGKG 123
           P +LGHEG+GIVES G  V +VK GDHV+ LY  ECG C  CKS K+NLC  ++ATQ +G
Sbjct: 65  PCVLGHEGSGIVESCGSKVETVKKGDHVLLLYIPECGHCADCKSEKSNLCSVIKATQAQG 124

Query: 124 VMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGY 183
           VMP G+SR  N + +TL HFMGCS+FS+Y              APL+  CLLGCGVTTG+
Sbjct: 125 VMPQGSSRLHNLENKTLWHFMGCSSFSQYAVVSDISCVKIRDDAPLDKICLLGCGVTTGF 184

Query: 184 GAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDF 243
           GA +    V+ GD VA+FG+GTVGLSV Q        Q+I+VD+ D K+++   FGATDF
Sbjct: 185 GAPI-AKGVKAGDRVAVFGSGTVGLSVVQSCSQLKCFQVIVVDVQDNKREWALGFGATDF 243

Query: 244 INPATDLQNGQTIVEKLIEMTDG-GLDFTFDCTGNVKVMRDALEACHKXXXXXXXXXXXX 302
           INP    +N +++++ LI+ + G G DFTFDCTG+  VMR ALE+C K            
Sbjct: 244 INPQKIPKN-KSLLQTLIDKSGGDGFDFTFDCTGSTSVMRTALESCRKGWGTSVIIGLAG 302

Query: 303 XXQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQIN 362
             +EIST P+ L+ GR W+G AFGG+KGRSE+  L++ Y    +K+DE+ITN+RP K+IN
Sbjct: 303 AGEEISTLPYNLIVGRSWEGCAFGGVKGRSELPTLVERYMNNEIKLDEYITNKRPLKEIN 362

Query: 363 EAFEDLHAGDSLRTVLNYTD 382
           EA ++L  G  L+TVL+  D
Sbjct: 363 EALKELEDGLVLKTVLDTGD 382

>SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {ON}
           uniprot|Q6XQ74 Saccharomyces kluyveri ADH1 Alcohol
           dehydrogenase 1
          Length = 351

 Score =  102 bits (253), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 87/290 (30%), Positives = 125/290 (43%), Gaps = 35/290 (12%)

Query: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP- 59
           MS    P T  A + YE G  L  ++I V  PK++E+ I +K + VCHTD +   G  P 
Sbjct: 1   MSAPQIPETQKAVIFYENGGELQYKDIPVPKPKSNEILINIKYSGVCHTDLHAWKGDWPL 60

Query: 60  EGAFPSILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRA 118
               P + GHEGAGIV  +GE V   K GD+  +      C  C++C+    + C     
Sbjct: 61  PTKLPLVGGHEGAGIVVGMGENVKGWKIGDYAGIKWLNGSCMSCEYCELSNESNC----- 115

Query: 119 TQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCG 178
                  PD         G          +F +Y            P   L     + C 
Sbjct: 116 -------PDADLSGYTHDG----------SFQQYATADAVQAARIAPGTDLAEVAPVLCA 158

Query: 179 VTTGYGAAVKTANVQKGDTVAIFGA-GTVGLSVAQGAKARGASQIILVDINDAKKKYMHE 237
             T Y  A+K+AN++ G+ VAI GA G +G    Q AKA G  +++ +D  D K     E
Sbjct: 159 GITVY-KALKSANLRAGEWVAISGACGGLGSLAIQYAKAMG-YRVLGIDGGDEKAALFKE 216

Query: 238 FGATDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEA 287
            G   FI    D    + +V+ +++ T+GG         NV V   A+EA
Sbjct: 217 LGGEVFI----DFTKTKDVVKAVVDATNGGAHGVI----NVSVSEAAIEA 258

>YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcohol
           dehydrogenase isoenzyme V; involved in ethanol
           production
          Length = 351

 Score =  101 bits (251), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 90/290 (31%), Positives = 124/290 (42%), Gaps = 35/290 (12%)

Query: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP- 59
           M ++  P    A V YE    L  +++TV  PK +E+ + VK + VCH+D +   G  P 
Sbjct: 1   MPSQVIPEKQKAIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPF 60

Query: 60  EGAFPSILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRA 118
           +  FP I GHEGAG+V  +G  V   K GD   +      C  C++C+ G  + C  +  
Sbjct: 61  QLKFPLIGGHEGAGVVVKLGSNVKGWKVGDFAGIKWLNGTCMSCEYCEVGNESQCPYL-- 118

Query: 119 TQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCG 178
             G G   DG                   TF EY            P   L     + C 
Sbjct: 119 -DGTGFTHDG-------------------TFQEYATADAVQAAHIPPNVNLAEVAPILCA 158

Query: 179 VTTGYGAAVKTANVQKGDTVAIFGA-GTVGLSVAQGAKARGASQIILVDINDAKKKYMHE 237
             T Y  A+K ANV  G  V I GA G +G    Q A A G  ++I +D  +AK+K   +
Sbjct: 159 GITVY-KALKRANVIPGQWVTISGACGGLGSLAIQYALAMG-YRVIGIDGGNAKRKLFEQ 216

Query: 238 FGATDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEA 287
            G   FI    D    + IV  +I+ T+GG         NV V   A+EA
Sbjct: 217 LGGEIFI----DFTEEKDIVGAIIKATNGGSHGVI----NVSVSEAAIEA 258

>TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.480
           YMR083W
          Length = 377

 Score =  100 bits (249), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 82/264 (31%), Positives = 115/264 (43%), Gaps = 31/264 (11%)

Query: 7   PVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEGA-FPS 65
           P T  A V YE G PL    I V  PK +E+ I VK + VCHTD +   G  P     P 
Sbjct: 33  PTTQKAVVFYENGGPLKYTTIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLAVKLPL 92

Query: 66  ILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 124
           + GHEGAG+V + G  V + + GD+  +      C  C+ C+ G  + C     +   G 
Sbjct: 93  VGGHEGAGVVVAKGSEVKNFEIGDYAGIKWLNGSCMSCELCEKGFESNCEQADLS---GY 149

Query: 125 MPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYG 184
             DG                   +F +Y                L     + C   T Y 
Sbjct: 150 THDG-------------------SFQQYATADAVQAAHIPKNVDLAEVAPILCAGVTVY- 189

Query: 185 AAVKTANVQKGDTVAIFGA-GTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDF 243
            A+KTA+V+ G  VAI GA G +G    Q AKA G  +++ +D  D KKK  H  G   F
Sbjct: 190 KALKTADVKPGQWVAISGACGGLGSLAVQYAKAMGL-RVVGIDGGDEKKKLFHSLGGDIF 248

Query: 244 INPATDLQNGQTIVEKLIEMTDGG 267
           +    D     +IV+ + ++T+GG
Sbjct: 249 V----DFTKTHSIVKDIQDVTNGG 268

>Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 99.8 bits (247), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 90/290 (31%), Positives = 123/290 (42%), Gaps = 35/290 (12%)

Query: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP- 59
           MS++  P +  A V YE    L  ++I V  PKA+E+ + VK + VCH+D +   G  P 
Sbjct: 1   MSSQAIPESQKAIVFYETNGKLEYKDIAVPEPKANEILVHVKYSGVCHSDLHAWRGDWPF 60

Query: 60  EGAFPSILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRA 118
           +  FP I GHEGAG+V  +G  V   K GD   +      C  C++C+ G  + C  +  
Sbjct: 61  QLKFPLIGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHL-- 118

Query: 119 TQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCG 178
             G G   DG                   TF EY                L     + C 
Sbjct: 119 -DGTGFTHDG-------------------TFQEYATADAVQAAHLPENVDLAEVAPILCA 158

Query: 179 VTTGYGAAVKTANVQKGDTVAIFGA-GTVGLSVAQGAKARGASQIILVDINDAKKKYMHE 237
             T Y  A+K AN+  G  V I GA G +G    Q A A G  ++I +D  + KK+    
Sbjct: 159 GVTVY-KALKRANLIPGQWVTISGACGGLGSLAIQYATAMG-YRVIGIDEGETKKQLFEG 216

Query: 238 FGATDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEA 287
            G   FI    D    + IV  +I+ TDGG         NV V   A+EA
Sbjct: 217 LGGEVFI----DFTKEKDIVGAVIKATDGGSHGVI----NVSVSEAAIEA 258

>CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa]
           {ON} highly similar to uniprot|P07246 Saccharomyces
           cerevisiae YMR083w ADH3 or uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 or uniprot|P00331 Saccharomyces
           cerevisiae YMR303c ADH2
          Length = 372

 Score = 99.4 bits (246), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 80/288 (27%), Positives = 127/288 (44%), Gaps = 31/288 (10%)

Query: 2   STEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEG 61
           ST   P +    + YE G  L  +++ V  PK +E+ I V+ + VCHTD +   G  P G
Sbjct: 23  STLSIPQSQKGVIFYEHGGKLEYKDLPVPKPKPNEILINVRYSGVCHTDLHAWHGDWPLG 82

Query: 62  A-FPSILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRAT 119
           A  P + GHEGAG+V + G  VT+ + GD+  +      C  C+FC+ G  + C     +
Sbjct: 83  AKLPLVGGHEGAGVVVAKGSSVTNFEIGDYAGIKWLNGSCMSCEFCEQGNESNCAKADLS 142

Query: 120 QGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGV 179
              G   DG                   +F +Y                L     + C  
Sbjct: 143 ---GYTHDG-------------------SFQQYATADAIQAAQIPKGTDLAQVAPILCAG 180

Query: 180 TTGYGAAVKTANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEF 238
            T Y  A+K ++V+ G  VAI G AG +G    Q AKA G  +++ +D  D K+K     
Sbjct: 181 VTVY-KALKDSDVKPGQWVAISGAAGGLGSLAVQYAKAMGM-RVLGIDAGDEKRKLFESL 238

Query: 239 GATDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALE 286
           G   F+    D    + +V ++ E+T+GG     + + + K +  ++E
Sbjct: 239 GGNHFV----DFTKTKDLVSEIQEITEGGPHGVINVSVSEKAIGQSVE 282

>Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 98.6 bits (244), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 88/290 (30%), Positives = 124/290 (42%), Gaps = 35/290 (12%)

Query: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP- 59
           MS++  P T  A V YE    L  +++TV  PK +E+ + VK + VCH+D +   G  P 
Sbjct: 1   MSSQAIPKTQKAIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPF 60

Query: 60  EGAFPSILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRA 118
           +  FP I GHEGAG+V  +G  V   K GD   +      C  C++C+ G  + C  +  
Sbjct: 61  QLKFPLIGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHL-- 118

Query: 119 TQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCG 178
             G G   DG                   TF EY                L     + C 
Sbjct: 119 -DGTGFTHDG-------------------TFQEYATADAVQAAHIPQNVNLAEVAPILCA 158

Query: 179 VTTGYGAAVKTANVQKGDTVAIFGA-GTVGLSVAQGAKARGASQIILVDINDAKKKYMHE 237
             T Y  A+K AN+  G  V I GA G +G    Q A A G  ++I +D  +AK+K   +
Sbjct: 159 GITVY-KALKRANLMPGQWVTISGACGGLGSLAIQYALAMG-FRVIGIDGGEAKRKLFEK 216

Query: 238 FGATDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEA 287
            G   FI    D    + +   +I+ T+GG         NV V   A+EA
Sbjct: 217 LGGEIFI----DFTKERDVAGAVIKATNGGSHGII----NVSVSEAAIEA 258

>AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL086C (ADH1) and
           YBR145W (ADH5)
          Length = 351

 Score = 98.2 bits (243), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 86/290 (29%), Positives = 125/290 (43%), Gaps = 35/290 (12%)

Query: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP- 59
           MS    P T  A + YE G PL   +I V  PKA E+ I VK + VCHTD +   G  P 
Sbjct: 1   MSAPTIPRTQKAVIFYENGGPLQYTDIEVPKPKATELLINVKYSGVCHTDLHAWKGDWPL 60

Query: 60  EGAFPSILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRA 118
               P + GHEGAG+V ++GE V   K GD   +      C  C++C+    + C     
Sbjct: 61  PTKLPLVGGHEGAGVVVAMGENVRGWKIGDLAGIKWLNGSCMACEYCEKSNESNCPEADL 120

Query: 119 TQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCG 178
           +   G   DG                   +F +Y                L     + C 
Sbjct: 121 S---GYTHDG-------------------SFQQYATADAVQAAHIPAGTDLAQVAPILCA 158

Query: 179 VTTGYGAAVKTANVQKGDTVAIFGA-GTVGLSVAQGAKARGASQIILVDINDAKKKYMHE 237
             T Y  A+K+AN++ GD VAI GA G +G    Q A A G  +++ +D  + K++   +
Sbjct: 159 GITVY-KALKSANLRAGDWVAISGACGGLGSLAIQYATAMG-YRVLGIDGGEEKEQLFRQ 216

Query: 238 FGATDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEA 287
            G   FI    D +  + IV  +++ T+GG         NV V   A+E+
Sbjct: 217 LGGEVFI----DFRKSKDIVADVVKATNGGAHGVI----NVSVSEAAIES 258

>Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 98.2 bits (243), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 89/290 (30%), Positives = 123/290 (42%), Gaps = 35/290 (12%)

Query: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP- 59
           MS++  P T  A V YE    L  +++ V  PK +E+ + VK + VCH+D +   G  P 
Sbjct: 1   MSSQVVPKTQKAIVFYETDGKLEYKDVAVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPF 60

Query: 60  EGAFPSILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRA 118
           +  FP I GHEGAG+V  +G  V   K GD   +      C  C++C+ G  + C  +  
Sbjct: 61  QLKFPLIGGHEGAGVVVKLGSNVKGWKVGDIAGIKWLNGTCMSCEYCEVGNESQCPHL-- 118

Query: 119 TQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCG 178
             G G   DG                   TF EY                L     + C 
Sbjct: 119 -DGTGFTHDG-------------------TFQEYATADAVQAAHIPQNVDLAEVAPILCA 158

Query: 179 VTTGYGAAVKTANVQKGDTVAIFGA-GTVGLSVAQGAKARGASQIILVDINDAKKKYMHE 237
             T Y  A+K AN+  G  V I GA G +G    Q A A G  ++I +D  +AK+K   E
Sbjct: 159 GITVY-KALKRANLMPGQWVTISGACGGLGSLAVQYALAMG-YRVIGIDGGEAKQKLFEE 216

Query: 238 FGATDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEA 287
                FI    D    + +V  +I+ TDGG         NV V   A+EA
Sbjct: 217 LHGEIFI----DFTKEKDVVGAVIKATDGGSHGVI----NVSVSEAAIEA 258

>KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weakly
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score = 97.8 bits (242), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 89/339 (26%), Positives = 143/339 (42%), Gaps = 48/339 (14%)

Query: 39  IRVKKTAVCHTDAYTLSGADPE---------GAFP-SILGHEGAGIVESVGEGVTSVKPG 88
           I++  T++C TD     G +PE         G+F   ILGHEG GI++ VG+ V + K G
Sbjct: 60  IKMTHTSICGTDLGIWKGKNPEIEQTAQTKEGSFNGRILGHEGIGIIDEVGDAVHNFKKG 119

Query: 89  DHVVALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFKNKKGETLLHFMGCST 148
           D V+    + CG C+ C     + C     T G G                +L +M   T
Sbjct: 120 DRVIVSCISRCGTCENCAKSLYSHC-----TNGGG---------------WILGYMIDGT 159

Query: 149 FSEYTXXXXXXXXXXXPKAPL--ESACLLGCGVTTGYGAAVKTANVQKGDTVAIFGAGTV 206
            +EY                L  E+A +L   + T +   V+  NV+ GDTVAI GAG V
Sbjct: 160 QAEYVRTPFADTSLYSVPENLSDEAAVMLSDALPTAHEIGVQMGNVKPGDTVAIVGAGPV 219

Query: 207 GLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFINPATDLQNGQTIVEKLIEMTDG 266
           G+     ++    S +I+VDI+D +     E G+T  IN A      +  V K++E T+G
Sbjct: 220 GMGCVLTSQLYSPSLLIVVDIDDNRLAMAKEMGSTHTINSAK-----EDAVSKILEYTNG 274

Query: 267 -GLDFTFDCTGNVKVMRDALEACHKXXXXXXXXXXXXXXQEISTRPFQLVTGRVW--KGS 323
            G+D   +  G     +   + C +                +  +P      ++W    +
Sbjct: 275 RGVDCVMEAVG----AQATWDICQRVIKEGGHLANVG----VHGKPVNFEIDKLWIKNLT 326

Query: 324 AFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQIN 362
              G+   +  G L+K    G LK +  +T+   F +++
Sbjct: 327 ITSGLVNTNTTGMLMKSCCSGKLKSERLVTHHCNFGEMS 365

>NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118
          Length = 351

 Score = 97.1 bits (240), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 87/293 (29%), Positives = 128/293 (43%), Gaps = 35/293 (11%)

Query: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP- 59
           MS    P T  A +    G  L  ++I V  PK++E+ I VK + VCHTD +   G  P 
Sbjct: 1   MSAPVIPKTQKAVIFETNGGKLEYKDIPVPTPKSNEILINVKYSGVCHTDLHAWKGDWPL 60

Query: 60  EGAFPSILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRA 118
               P + GHEGAG+V ++G+ V   K GD+  +      C  C++C+ G  + C     
Sbjct: 61  PTKLPLVGGHEGAGVVVAMGDAVKGWKIGDYAGIKWLNGSCMSCEYCELGNESNCPHADL 120

Query: 119 TQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCG 178
           +   G   DG                   +F +Y            P + L     + C 
Sbjct: 121 S---GYTHDG-------------------SFQQYATADAVQAARIAPGSDLAEVAPVLCA 158

Query: 179 VTTGYGAAVKTANVQKGDTVAIFGA-GTVGLSVAQGAKARGASQIILVDINDAKKKYMHE 237
             T Y  A+K+AN++ G+ VAI GA G +G    Q AKA G  +++ +D  D K K   +
Sbjct: 159 GITVY-KALKSANLRAGEWVAISGACGGLGSLAIQFAKAMG-YRVVGIDGGDEKAKMFKD 216

Query: 238 FGATDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHK 290
            G   FI    D    + IV  +I+ T+GG         NV V   A++A  K
Sbjct: 217 LGGEVFI----DFTKTKDIVGDIIKATNGGAHGVI----NVSVSEQAIDASVK 261

>KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON}
           uniprot|P20369 Kluyveromyces lactis KLLA0F21010g ADH1
           Alcohol dehydrogenase 1
          Length = 350

 Score = 97.1 bits (240), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 81/264 (30%), Positives = 115/264 (43%), Gaps = 31/264 (11%)

Query: 7   PVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP-EGAFPS 65
           P T    + YE G  L  ++I V  PKA+E+ I VK + VCHTD +   G  P     P 
Sbjct: 6   PETQKGVIFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 65

Query: 66  ILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 124
           + GHEGAG+V ++GE V   K GD   +      C  C++C+    + C     +   G 
Sbjct: 66  VGGHEGAGVVVAMGENVKGWKIGDFAGIKWLNGSCMSCEYCELSNESNCPEADLS---GY 122

Query: 125 MPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYG 184
             DG                   +F +Y                L     + C   T Y 
Sbjct: 123 THDG-------------------SFQQYATADAVQAAKIPVGTDLAEVAPVLCAGVTVY- 162

Query: 185 AAVKTANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDF 243
            A+K+AN++ GD VAI G AG +G    Q AKA G  +++ +D  + K K   + G   F
Sbjct: 163 KALKSANLKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDAGEEKAKLFKDLGGEYF 221

Query: 244 INPATDLQNGQTIVEKLIEMTDGG 267
           I    D    + I E++IE T GG
Sbjct: 222 I----DFTKSKNIPEEVIEATKGG 241

>SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} similar
           to uniprot|P00331 Saccharomyces cerevisiae YMR303C ADH2
           Glucose-repressible alcohol dehydrogenase II
          Length = 351

 Score = 97.1 bits (240), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 85/290 (29%), Positives = 126/290 (43%), Gaps = 35/290 (12%)

Query: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP- 59
           MS    P T  A + YE G  L  ++I V  PK++E+ I VK + VCHTD +   G  P 
Sbjct: 1   MSASQIPKTQKAVIFYENGGELQYKDIPVPKPKSNEILINVKYSGVCHTDLHAWKGDWPL 60

Query: 60  EGAFPSILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRA 118
               P + GHEGAG+V ++GE V   K GD+  +      C  C++C+    + C     
Sbjct: 61  PTKLPLVGGHEGAGVVVAIGENVKGWKIGDYAGIKWLNGSCMACEYCELSNESNCPEADL 120

Query: 119 TQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCG 178
           +   G   DG                   +F +Y                L     + C 
Sbjct: 121 S---GYTHDG-------------------SFQQYATADAVQAARIPAGTDLAEVAPVLCA 158

Query: 179 VTTGYGAAVKTANVQKGDTVAIFGA-GTVGLSVAQGAKARGASQIILVDINDAKKKYMHE 237
             T Y  A+K+AN++ G+ VAI GA G +G    Q AKA G  +++ +D  + K     E
Sbjct: 159 GITVY-KALKSANLRAGEWVAISGACGGLGSLAIQYAKAMG-YRVLGIDGGEEKAALFKE 216

Query: 238 FGATDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEA 287
            G   FI    D    + +V+ +++ T+GG         NV V   A+EA
Sbjct: 217 LGGEVFI----DFTKTKDVVKAVVDATNGGAHGVI----NVSVSEAAIEA 258

>CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 alcohol dehydrogenase I or
           uniprot|P00331 Saccharomyces cerevisiae YMR303c ADH2
          Length = 352

 Score = 97.1 bits (240), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 83/284 (29%), Positives = 120/284 (42%), Gaps = 35/284 (12%)

Query: 7   PVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEGA-FPS 65
           P T    + YE    L  ++I V  PKA+E+ I VK + VCHTD +   G  P     P 
Sbjct: 8   PETQKGVIFYENNGKLEYKDIPVPKPKANEILINVKYSGVCHTDLHAWHGDWPLATKLPL 67

Query: 66  ILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 124
           + GHEGAG+V  +GE V   K GD+  +      C  C++C+    + C     +   G 
Sbjct: 68  VGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCEKSNESNCPEADLS---GY 124

Query: 125 MPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYG 184
             DG                   +F +Y                L     + C   T Y 
Sbjct: 125 THDG-------------------SFQQYATADYVQAARIPQGTDLAQVAPILCAGITVY- 164

Query: 185 AAVKTANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDF 243
            A+K+AN+  G+ VAI G AG +G    Q AKA G  +I+ +D  D KK   HE G   F
Sbjct: 165 KALKSANLNAGEWVAISGAAGGLGSLAVQYAKAMG-YRILGIDGGDEKKALFHELGGEIF 223

Query: 244 INPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEA 287
           +    D    + + + ++  T+GG         NV V   A+E+
Sbjct: 224 V----DFTKSKNVEQDILVATNGGAHGVI----NVSVSEAAIES 259

>SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar to
           uniprot|P35497 Saccharomyces cerevisiae YJR159W SOR1
           Sorbitol dehydrogenase expression is induced in the
           presence of sorbitol
          Length = 354

 Score = 96.7 bits (239), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 111/393 (28%), Positives = 175/393 (44%), Gaps = 63/393 (16%)

Query: 7   PVTSLAAVAYEAGKPLSVEEITV----DPPKAHEVRIRVKKTAVCHTDA-YTLSGADPEG 61
           P T  A V  + G  ++ E+I V    DP   H V++ +KKT +C +D  Y  +GA   G
Sbjct: 2   PETHKAVVLQKQGL-ITFEDIPVPQIEDP---HYVKLAIKKTGICGSDVHYYKTGAI--G 55

Query: 62  AF----PSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVR 117
            F    P +LGHE +G+V  VG  VTSVK GD V           K  KSG  NLC S+ 
Sbjct: 56  NFVVKDPMVLGHESSGVVVEVGSKVTSVKVGDRVAIEPGVPSRYSKATKSGHYNLCPSMA 115

Query: 118 ATQGKGVMPDGTS-RFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACL-- 174
                 +  DGT  ++     + L+      +F E                    AC+  
Sbjct: 116 FAATPPI--DGTLLKYYLSPEDFLVKLPDSVSFEE-------------------GACVEP 154

Query: 175 LGCGVTTGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKY 234
           L  GV      A K A+V+ G  V +FGAG VGL     ++A GA+ ++ VD+ D K + 
Sbjct: 155 LSVGV-----HANKLADVRFGSKVVVFGAGPVGLLAGAVSRAFGATDVVFVDVFDHKLER 209

Query: 235 MHEFGATDFINPATDLQNGQTIVEKLIEMTDGGL-DFTFDCTGNVKVMRDALEAC----H 289
            +EFGAT  +N ++  ++   +V+++  +  G   +  F+C+G    +R  ++AC     
Sbjct: 210 TNEFGATQTVN-SSKFKSEDDLVKEIQRVLSGEQPEVVFECSGAEVCIRAGIKACKAGGR 268

Query: 290 KXXXXXXXXXXXXXXQEISTRPFQLV-TGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKV 348
                           E+ ++  Q++ T R   G     +K  SE          G + V
Sbjct: 269 YVQVGMGKDNVNFPISEVVSKELQVLGTFRYCFGDYNDSVKLISE----------GKVNV 318

Query: 349 DEFITNRRPFKQINEAFE--DLHAGDSLRTVLN 379
              IT+R  F+   +A+E    H  D ++T+++
Sbjct: 319 KPLITHRFKFQDAIKAYEFNIEHGEDVVKTIID 351

>KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]
           {ON} highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 351

 Score = 96.3 bits (238), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 87/290 (30%), Positives = 127/290 (43%), Gaps = 35/290 (12%)

Query: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPE 60
           MS    P T    + YE G  L  ++I V  PKA+E+ + VK + VCHTD +   G  P 
Sbjct: 1   MSAHEIPKTQKGVIFYETGGKLEYKDIDVPTPKANELLVNVKYSGVCHTDLHAYHGDWPL 60

Query: 61  GA-FPSILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRA 118
               P + GHEGAG+V ++GE V   K GD   +      C  C+ C+ G  + C     
Sbjct: 61  PVKLPLVGGHEGAGVVVAMGENVKGWKVGDLAGIKWLNGSCMSCESCELGNESNCPEADL 120

Query: 119 TQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCG 178
           +   G   DG                   +F +Y              A L     + C 
Sbjct: 121 S---GYTHDG-------------------SFQQYATADAVQAAKIPAGADLAEIAPILCA 158

Query: 179 VTTGYGAAVKTANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHE 237
             T Y  A+K+AN+Q GD VAI G AG +G    Q AKA G  +++ +D  + K++   +
Sbjct: 159 GITVY-KALKSANLQAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEEKEQLFRQ 216

Query: 238 FGATDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEA 287
            G   FI    D +  + I  ++I+ T+GG         NV V   A+E+
Sbjct: 217 LGGEVFI----DFRTCKDIEGEIIKATNGGAHGVI----NVSVSEAAIES 258

>KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON}
           weakly similar to uniprot|P35497 Saccharomyces
           cerevisiae YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score = 97.1 bits (240), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 95/374 (25%), Positives = 155/374 (41%), Gaps = 53/374 (14%)

Query: 11  LAAVAYEAGKPLSVEEITVDPPKAHEVR---IRVKKTAVCHTDAYTLSGADPE------- 60
           + A+ Y     L  E+  +  PK  + R   I++  T++C TD     G  PE       
Sbjct: 31  MKAMVYYGANDLRFEDRAI--PKIIDQRDAIIKMTNTSICGTDVGIWKGKSPEIEEIAVK 88

Query: 61  --GAFP-SILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVR 117
             G+F   +LGHEG GIV  VG+ V ++K GD V+      CG C+ C  G    C    
Sbjct: 89  NEGSFNGRVLGHEGTGIVTEVGDAVRNIKKGDKVIISCITRCGTCENCARGMYAHC---- 144

Query: 118 ATQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPL--ESACLL 175
                  M DG        G  L + +   T +EY                L  E+A LL
Sbjct: 145 -------MNDG--------GWALGYSID-GTQAEYVRTPFADTSLYALPEGLSDENAVLL 188

Query: 176 GCGVTTGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYM 235
              + T +   V+  NV+ GD+VAI GAG VG+     ++    S +I+VD++D + +  
Sbjct: 189 SDALPTAHEIGVQMGNVKPGDSVAILGAGPVGMGCVLTSQLYSPSLLIVVDMDDNRLEMA 248

Query: 236 HEFGATDFINPATDLQNGQTIVEKLIEMTDG-GLDFTFDCTGNVKVMRDALEACHKXXXX 294
            E GAT  IN        +  V K++E+T+G G+D   +  G     +   + C +    
Sbjct: 249 KEMGATHTINSGK-----EDAVAKILEITNGRGVDCAMEAVG----AQPTWDICQQIIKE 299

Query: 295 XXXXXXXXXXQEISTRPFQLVTGRVW--KGSAFGGIKGRSEMGGLIKDYQGGALKVDEFI 352
                       +  +P      ++W    +   G+   +    L+K+   G L+ D+ +
Sbjct: 300 GGHLANVG----VHGKPVDFAIDKLWIKNLTITSGLVNTNTTSMLMKNCCSGKLQSDKLV 355

Query: 353 TNRRPFKQINEAFE 366
           ++   FK +   + 
Sbjct: 356 SHHCNFKDMANNYN 369

>Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar to
           Ashbya gossypii AER032W
          Length = 348

 Score = 96.3 bits (238), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 81/264 (30%), Positives = 115/264 (43%), Gaps = 31/264 (11%)

Query: 7   PVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP-EGAFPS 65
           P T  A + YE G  L   +I V  PK  E+ I VK + VCHTD +   G  P     P 
Sbjct: 4   PETQKAVIFYENGGELKYTDIPVPKPKPSELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 63

Query: 66  ILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 124
           + GHEGAG+V ++GE V   K GD   +      C  C++C+    + C           
Sbjct: 64  VGGHEGAGVVVAMGENVRGWKIGDFAGIKWLNGSCMTCEYCEKSNESNC----------- 112

Query: 125 MPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYG 184
            PD            L  +    +F +Y                L     + C   T Y 
Sbjct: 113 -PDA----------DLSGYTHDGSFQQYATADAVHAAKIPQGTDLAQVAPVLCAGITVY- 160

Query: 185 AAVKTANVQKGDTVAIFGA-GTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDF 243
            A+K+A +Q G+ VAI GA G +G    Q AKA G  +I+ +D  + KKK   E G   F
Sbjct: 161 KALKSARLQAGEWVAISGASGGLGSLAVQYAKAMG-YRILGIDSGEEKKKLFKELGGEYF 219

Query: 244 INPATDLQNGQTIVEKLIEMTDGG 267
           I    D    + +V ++I++T+GG
Sbjct: 220 I----DFAESKDVVAEVIKVTNGG 239

>KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {ON}
           Anc_3.118 YBR145W
          Length = 351

 Score = 95.5 bits (236), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 88/290 (30%), Positives = 123/290 (42%), Gaps = 35/290 (12%)

Query: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP- 59
           MS    P T    + YE G  L  ++I V  PKA+E+ I VK + VCHTD +   G  P 
Sbjct: 1   MSAPVIPKTQKGVIFYENGGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWKGDWPL 60

Query: 60  EGAFPSILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRA 118
           +   P + GHEGAG+V ++GE V   K GD+  +      C  C++C+    + C     
Sbjct: 61  DVKLPLVGGHEGAGVVVAMGENVRGWKIGDYAGIKWLNGSCMSCEYCELSNESNCPEADL 120

Query: 119 TQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCG 178
           +   G   DG                   +F +Y                L     + C 
Sbjct: 121 S---GYTHDG-------------------SFQQYATADAVQAAKIPQGTDLAQVAPILCA 158

Query: 179 VTTGYGAAVKTANVQKGDTVAIFGA-GTVGLSVAQGAKARGASQIILVDINDAKKKYMHE 237
             T Y  A+K+AN+  G+ VAI GA G +G    Q AKA G  +I+ +D  D K     E
Sbjct: 159 GITVY-KALKSANLSAGEWVAISGACGGLGSLAIQYAKAMG-YRILGIDGGDEKAALFKE 216

Query: 238 FGATDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEA 287
            G   FI    D    + I   +IE T+GG         NV V   A+E+
Sbjct: 217 LGGEVFI----DFTKTKDIEAAVIEATNGGAHGVI----NVSVSEAAIES 258

>TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 94.4 bits (233), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 87/290 (30%), Positives = 126/290 (43%), Gaps = 35/290 (12%)

Query: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP- 59
           MS    P T  A + YE+G  L  +++ V  PK +E+ I +K + VCHTD +   G  P 
Sbjct: 1   MSAPVIPKTQKAVIFYESGGALEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDWPL 60

Query: 60  EGAFPSILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRA 118
           +   P I GHEGAG+V  +G  V   K GD+  V      C  C+ C+    + C     
Sbjct: 61  DTKLPLIGGHEGAGVVVGMGANVRGWKIGDYAGVKWLNGSCMSCEECELSNESNCPEADL 120

Query: 119 TQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCG 178
           +   G   DG                   +F EY              A L     + C 
Sbjct: 121 S---GYTHDG-------------------SFQEYCTADAVQAARIPQGADLAEVAPILCA 158

Query: 179 VTTGYGAAVKTANVQKGDTVAIFGA-GTVGLSVAQGAKARGASQIILVDINDAKKKYMHE 237
             T Y  A+K+A++  G+ VAI GA G +G    Q AKA G  +++ +D  + KKK  HE
Sbjct: 159 GVTVY-KALKSADLAAGEWVAISGACGGLGSLAVQFAKAMGL-RVLGIDGGEEKKKMFHE 216

Query: 238 FGATDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEA 287
            G   F+    D +  + +   +I+ T+GG         NV V   A+EA
Sbjct: 217 MGGEVFL----DFRLEKDMEAAVIKATNGGAHGVI----NVSVSEAAIEA 258

>KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3 Alcohol dehydrogenase isoenzyme III
          Length = 389

 Score = 94.4 bits (233), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 79/264 (29%), Positives = 114/264 (43%), Gaps = 31/264 (11%)

Query: 7   PVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEGA-FPS 65
           P      + YE G  L  +++ V  PK +E+ I VK + VCHTD +   G  P     P 
Sbjct: 45  PSMQKGVIFYEHGGELHYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLAVKLPL 104

Query: 66  ILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 124
           + GHEGAG+V + GE VT+ + GD+  +      C  C+ C+ G    C     +   G 
Sbjct: 105 VGGHEGAGVVVAKGENVTNFEIGDYAGIKWLNGSCMSCELCEQGNEPNCEHADLS---GY 161

Query: 125 MPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYG 184
             DG                   +F +Y                L     + C   T Y 
Sbjct: 162 THDG-------------------SFQQYATADAVQAAQIPKGTDLAQIAPILCAGVTVY- 201

Query: 185 AAVKTANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDF 243
            A+KTA+V+ G  VAI G AG +G    Q AKA G  +++ +D  + KKK  H+ G   F
Sbjct: 202 KALKTADVRPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGEDKKKLFHDLGGETF 260

Query: 244 INPATDLQNGQTIVEKLIEMTDGG 267
           I    D +  + +V  + E T GG
Sbjct: 261 I----DFRTTKDMVGAIQEATQGG 280

>Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 94.0 bits (232), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 80/269 (29%), Positives = 113/269 (42%), Gaps = 31/269 (11%)

Query: 2   STEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEG 61
           ST   P T    + YE    L  ++I V  PK +E+ I VK + VCHTD +   G  P  
Sbjct: 26  STAAIPKTQKGVIFYENNGKLHYKDIPVPQPKPNEILINVKYSGVCHTDLHAWHGDWPLA 85

Query: 62  A-FPSILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRAT 119
              P + GHEGAG+V  +G  V   K GD   +      C  C+FC+SG  + C     +
Sbjct: 86  VKLPLVGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNCPEADLS 145

Query: 120 QGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGV 179
              G   DG                   +F ++            P   L     + C  
Sbjct: 146 ---GYTHDG-------------------SFQQFATADAIQAAKIQPGTDLAEVAPILCAG 183

Query: 180 TTGYGAAVKTANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEF 238
            T Y  A+K AN++ GD VAI G AG +G    Q A A G  +++ +D  + K+K   + 
Sbjct: 184 VTVY-KALKEANLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFKQL 241

Query: 239 GATDFINPATDLQNGQTIVEKLIEMTDGG 267
           G   FI    D    + +V  + E T GG
Sbjct: 242 GGEVFI----DFTKTKDMVSDIQEATKGG 266

>TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 93.6 bits (231), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 86/290 (29%), Positives = 124/290 (42%), Gaps = 35/290 (12%)

Query: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP- 59
           MS    P T  A + Y+ G PL  +++ V  PK +E+ I +K + VCHTD +   G  P 
Sbjct: 1   MSAPVIPQTQKAVIFYKNGGPLEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDWPL 60

Query: 60  EGAFPSILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRA 118
           +   P I GHEGAG+V  +G  V   K GD+  V      C  C+ C+    + C     
Sbjct: 61  DTKLPLIGGHEGAGVVVGMGSNVKGWKIGDYAGVKWLNGSCMSCEECELSNESNCPEADL 120

Query: 119 TQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCG 178
           +   G   DG                   +F EY                L     L C 
Sbjct: 121 S---GYTHDG-------------------SFQEYCTADAVQAARIPQGTDLAQVAPLLCA 158

Query: 179 VTTGYGAAVKTANVQKGDTVAIFGA-GTVGLSVAQGAKARGASQIILVDINDAKKKYMHE 237
             T Y  A+K+A++  G  VAI GA G +G    Q AKA G  +++ +D  + KKK  HE
Sbjct: 159 GVTVY-KALKSADLAAGQWVAISGACGGLGSLAIQFAKAMGL-RVLGIDGGEEKKKMFHE 216

Query: 238 FGATDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEA 287
            G   F+    D +  + +   +I+ T+GG         NV V   A+E+
Sbjct: 217 LGGEVFL----DFRLEKDMEAAIIKATNGGAHGVI----NVSVSEAAIES 258

>NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 93.6 bits (231), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 83/293 (28%), Positives = 129/293 (44%), Gaps = 35/293 (11%)

Query: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP- 59
           MS+   P T  A +    G PL  ++I V  PK++E+ + +K + VCHTD +   G  P 
Sbjct: 1   MSSPVIPKTQKAIIFESNGGPLEYKDIPVPTPKSNEILVNIKYSGVCHTDLHAWKGDWPL 60

Query: 60  EGAFPSILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRA 118
           +   P + GHEGAGIV ++G+ V   K GD+  V      C  C++C+ G  + C +   
Sbjct: 61  DTKLPLVGGHEGAGIVVAIGDNVKGWKIGDYAGVKWLNGSCMACEYCELGNESNCPNADL 120

Query: 119 TQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCG 178
           +   G   DG                   +F +Y                L     + C 
Sbjct: 121 S---GYTHDG-------------------SFQQYATADAVQAARIPAGTNLSEVAPILCA 158

Query: 179 VTTGYGAAVKTANVQKGDTVAIFGA-GTVGLSVAQGAKARGASQIILVDINDAKKKYMHE 237
             T Y  A+K+AN++ G+ VAI GA G +G    Q A A G  +++ +D  D K K   +
Sbjct: 159 GMTVY-KALKSANLRAGEWVAISGACGGLGSLCIQYANAMG-YRVLGIDGGDDKAKLFKQ 216

Query: 238 FGATDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHK 290
                FI    D    + ++ ++ ++T+GG         NV V   A+EA  K
Sbjct: 217 LHGEVFI----DFTKTKDVISEVNKVTNGGAHGVI----NVSVSEAAIEASTK 261

>NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON}
           Anc_3.118
          Length = 351

 Score = 93.2 bits (230), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 84/270 (31%), Positives = 117/270 (43%), Gaps = 31/270 (11%)

Query: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPE 60
           MS    P T  A +    G  L  ++I V  PK+ E+ I VK + VCHTD +   G  P 
Sbjct: 1   MSAPVIPKTQKAVIFETNGGKLEYKDIPVPVPKSTEILINVKYSGVCHTDLHAWKGDWPL 60

Query: 61  GA-FPSILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRA 118
               P + GHEGAGIV  VGE V   K GD   +      C  C++C+ G  + C +   
Sbjct: 61  ATKLPLVGGHEGAGIVVQVGENVQGWKVGDLAGIKWLNGSCMACEYCELGNESNCPNADL 120

Query: 119 TQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCG 178
           +   G   DG                   +F +Y                L     + C 
Sbjct: 121 S---GYTHDG-------------------SFQQYATADAVQAARIPQGTDLAEVAPVLCA 158

Query: 179 VTTGYGAAVKTANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHE 237
             T Y  A+K+AN++ G+ VAI G AG +G    Q AKA G  +I+ +D  + K+K   E
Sbjct: 159 GITVY-KALKSANLRAGEWVAISGAAGGLGSLAVQYAKAMG-YRILGIDGGEEKEKLFRE 216

Query: 238 FGATDFINPATDLQNGQTIVEKLIEMTDGG 267
            G   FI    D    + IV  +I+ T+GG
Sbjct: 217 LGGEIFI----DFTKTKDIVGDIIKATNGG 242

>KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score = 93.2 bits (230), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 81/269 (30%), Positives = 118/269 (43%), Gaps = 28/269 (10%)

Query: 2   STEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEG 61
           ST   P      + YE G PL+ +++ V  PK +E+ I VK + VCHTD +   G  P  
Sbjct: 25  STIAIPKMQKGVIFYENGGPLTYKDMPVPVPKPNEILINVKYSGVCHTDLHAWKGDWPLP 84

Query: 62  A-FPSILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRAT 119
              P + GHEGAGIV + G  V + + GD   +      C  C+ C+ G  + C     +
Sbjct: 85  VKLPLVGGHEGAGIVVAKGSNVKNFEIGDLAGIKWLNGSCMACELCEKGYESNCEHADLS 144

Query: 120 QGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGV 179
              G   DG                   +F +Y                L     + C  
Sbjct: 145 ---GYTHDG-------------------SFQQYATADATQAAQIPRGTDLAEVAPILCAG 182

Query: 180 TTGYGAAVKTANVQKGDTVAIFGA-GTVGLSVAQGAKARGASQIILVDINDAKKKYMHEF 238
            T Y  A+KTA +Q G+ VAI GA G +G    Q AKA G  +++ +D  +AK K   E 
Sbjct: 183 VTVY-KALKTAALQPGEWVAISGACGGLGSLAIQYAKAMGL-RVLGIDGGEAKAKMFKEL 240

Query: 239 GATDFINPATDLQNGQTIVEKLIEMTDGG 267
           G   FI+  T  +N + +++ + E T GG
Sbjct: 241 GGETFID-FTKYKNNEAMIKDIQEATKGG 268

>NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480
          Length = 381

 Score = 93.2 bits (230), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 81/264 (30%), Positives = 113/264 (42%), Gaps = 31/264 (11%)

Query: 7   PVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP-EGAFPS 65
           P T  A V YE G PL  ++I V  PKA+E+ I VK + VCHTD +   G  P     P 
Sbjct: 37  PKTQKAVVFYENGGPLHYKDIPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 96

Query: 66  ILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 124
           + GHEG+G+V  VGE V   K GD   +      C  C+ C++G  + C     +   G 
Sbjct: 97  VGGHEGSGVVMQVGENVKGWKVGDLAGIKWLNGSCMACELCETGNESNCEHADLS---GY 153

Query: 125 MPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYG 184
             DG                   +F +Y                L     + C   T Y 
Sbjct: 154 THDG-------------------SFQQYATADAVQAARIPEGTNLAEVAPILCAGITVY- 193

Query: 185 AAVKTANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDF 243
            A+K A+++ G  V I G AG +G    Q AKA G  ++I +D   AK++     G   F
Sbjct: 194 KALKEADLKAGQWVCISGAAGGLGSLAVQYAKAMG-YRVIGIDGGKAKEELFKSMGGEVF 252

Query: 244 INPATDLQNGQTIVEKLIEMTDGG 267
           I    D    + +V+ + E T GG
Sbjct: 253 I----DFTKSKDMVKDIQEATKGG 272

>KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3.118
           YBR145W
          Length = 350

 Score = 92.0 bits (227), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 82/284 (28%), Positives = 123/284 (43%), Gaps = 35/284 (12%)

Query: 7   PVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEGA-FPS 65
           P T +  +    G PL  +EI V  PKA+E+ I VK + VCHTD +   G  P     P 
Sbjct: 6   PETQMGVIFESNGGPLEYKEIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPL 65

Query: 66  ILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 124
           + GHEGAGIV ++G+ V +   GD+  +      C  C+ C+    + C     +   G 
Sbjct: 66  VGGHEGAGIVVAMGDSVKNWNIGDYAGIKWLNGSCMNCESCELANESNCPQADLS---GY 122

Query: 125 MPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYG 184
             DG                   +F +Y                L     + C   T Y 
Sbjct: 123 THDG-------------------SFQQYATADAVQAAKIPHGTDLAEVAPILCAGVTVY- 162

Query: 185 AAVKTANVQKGDTVAIFGA-GTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDF 243
            A+K+AN++ GD VAI GA G +G    Q A A G  +++ +D  + K +   + G   F
Sbjct: 163 KALKSANLKAGDWVAISGACGGLGSLAIQYATAMG-YRVLGIDGGEEKAELFKKLGGEYF 221

Query: 244 INPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEA 287
           I    D    + ++ +++E+TDGG         NV V   A+EA
Sbjct: 222 I----DFTKCKDVIAEILEVTDGGAHGVI----NVSVSEAAIEA 257

>Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 91.7 bits (226), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 83/284 (29%), Positives = 121/284 (42%), Gaps = 35/284 (12%)

Query: 7   PVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP-EGAFPS 65
           P T    + YE+   L  ++I V  PKA+E+ I VK + VCHTD +   G  P     P 
Sbjct: 4   PKTQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 66  ILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 124
           + GHEGAG+V ++GE V     GD   +      C  C++C+ G  + C     +   G 
Sbjct: 64  VGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNCPHADLS---GY 120

Query: 125 MPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYG 184
             DG                   +F +Y            P   L     + C   T Y 
Sbjct: 121 THDG-------------------SFQQYATADAVQAAHVAPGTDLAEVAPVLCAGITVY- 160

Query: 185 AAVKTANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDF 243
            A+K+AN+  G  VAI G AG +G    Q AKA G  ++I +D  + K++     G   F
Sbjct: 161 KALKSANLMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVIGIDGGEGKEELFRSIGGEVF 219

Query: 244 INPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEA 287
           +    D    + IV  +++ T+GG         NV V   A+EA
Sbjct: 220 V----DFTKEKDIVGAVLKATNGGAHGVI----NVSVSEAAIEA 255

>YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON}
           ADH1Alcohol dehydrogenase, fermentative isozyme active
           as homo- or heterotetramers; required for the reduction
           of acetaldehyde to ethanol, the last step in the
           glycolytic pathway
          Length = 348

 Score = 91.7 bits (226), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 84/284 (29%), Positives = 121/284 (42%), Gaps = 35/284 (12%)

Query: 7   PVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEGA-FPS 65
           P T    + YE+   L  ++I V  PKA+E+ I VK + VCHTD +   G  P     P 
Sbjct: 4   PETQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPL 63

Query: 66  ILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 124
           + GHEGAG+V  +GE V   K GD+  +      C  C++C+ G  + C     +   G 
Sbjct: 64  VGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHADLS---GY 120

Query: 125 MPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYG 184
             DG                   +F +Y                L     + C   T Y 
Sbjct: 121 THDG-------------------SFQQYATADAVQAAHIPQGTDLAQVAPILCAGITVY- 160

Query: 185 AAVKTANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDF 243
            A+K+AN+  G  VAI G AG +G    Q AKA G  +++ +D  + K++     G   F
Sbjct: 161 KALKSANLMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFRSIGGEVF 219

Query: 244 INPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEA 287
           I    D    + IV  +++ TDGG         NV V   A+EA
Sbjct: 220 I----DFTKEKDIVGAVLKATDGGAHGVI----NVSVSEAAIEA 255

>Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 91.3 bits (225), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 83/284 (29%), Positives = 121/284 (42%), Gaps = 35/284 (12%)

Query: 7   PVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP-EGAFPS 65
           P T    + YE+   L  ++I V  PKA+E+ I VK + VCHTD +   G  P     P 
Sbjct: 4   PETQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 66  ILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 124
           + GHEGAG+V ++GE V     GD+  +      C  C++C+ G  + C     +   G 
Sbjct: 64  VGGHEGAGVVVAMGENVKGWNIGDYAGIKWLNGSCMACEYCELGNESNCPHADLS---GY 120

Query: 125 MPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYG 184
             DG                   +F +Y                L     + C   T Y 
Sbjct: 121 THDG-------------------SFQQYATADAVQAAHIPQGTDLAEVAPVLCAGITVY- 160

Query: 185 AAVKTANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDF 243
            A+K+AN+  G  VAI G AG +G    Q AKA G  +++ +D  + K++     G   F
Sbjct: 161 KALKSANLMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFRSIGGEVF 219

Query: 244 INPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEA 287
           I    D    + IV  +++ TDGG         NV V   A+EA
Sbjct: 220 I----DFTKEKDIVNAVLKATDGGAHGVI----NVSVSEAAIEA 255

>KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {ON}
           uniprot|P49384 Kluyveromyces lactis KLLA0B09064g ADH3
           Alcohol dehydrogenase III mitochondrial precursor
          Length = 374

 Score = 91.7 bits (226), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 76/264 (28%), Positives = 115/264 (43%), Gaps = 31/264 (11%)

Query: 7   PVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP-EGAFPS 65
           P T    + YE G  L  ++I V  PK +E+ I VK + VCHTD +   G  P     P 
Sbjct: 30  PETQKGVIFYENGGKLEYKDIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 89

Query: 66  ILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 124
           + GHEGAG+V ++GE V     GD   +      C  C++C+    + C           
Sbjct: 90  VGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESNC----------- 138

Query: 125 MPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYG 184
            PD            L  +    +F +Y                L     + C   T Y 
Sbjct: 139 -PDA----------DLSGYTHDGSFQQYATADAVQAARIPKGTDLAEVAPILCAGVTVY- 186

Query: 185 AAVKTANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDF 243
            A+K+AN++ GD VAI G AG +G    Q AKA G  +++ +D  + K K + + G   F
Sbjct: 187 KALKSANLKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEEKGKLVKQLGGEAF 245

Query: 244 INPATDLQNGQTIVEKLIEMTDGG 267
           +    D    + +V ++ E+T+GG
Sbjct: 246 V----DFTKTKDMVAEIQEITNGG 265

>KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]
           {ON} uniprot|P49383 Kluyveromyces lactis KLLA0F18260g
           ADH2 Alcohol dehydrogenase 2
          Length = 348

 Score = 90.9 bits (224), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 75/264 (28%), Positives = 116/264 (43%), Gaps = 31/264 (11%)

Query: 7   PVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP-EGAFPS 65
           P T    + YE G  L  ++I V  PKA+E+ I VK + VCHTD +   G  P     P 
Sbjct: 4   PETQKGVIFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 63

Query: 66  ILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 124
           + GHEGAG+V ++GE V     GD   +      C  C++C+    + C           
Sbjct: 64  VGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESNC----------- 112

Query: 125 MPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYG 184
            PD            L  +    +F +Y                L     + C   T Y 
Sbjct: 113 -PDA----------DLSGYTHDGSFQQYATADAVQAARIPKGTDLAEVAPILCAGVTVY- 160

Query: 185 AAVKTANVQKGDTVAIFGA-GTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDF 243
            A+K+A+++ GD VAI GA G +G    Q AKA G  +++ +D    K K   E G   F
Sbjct: 161 KALKSADLKAGDWVAISGACGGLGSLAIQYAKAMG-YRVLGIDTGAEKAKLFKELGGEYF 219

Query: 244 INPATDLQNGQTIVEKLIEMTDGG 267
           ++ A      + +++++++ T+GG
Sbjct: 220 VDYAVS----KDLIKEIVDATNGG 239

>KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON}
           uniprot|P49385 Kluyveromyces lactis ADH4 Alcohol
           dehydrogenase IV, mitochondrial precursor
          Length = 375

 Score = 90.9 bits (224), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 78/264 (29%), Positives = 116/264 (43%), Gaps = 31/264 (11%)

Query: 7   PVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEGA-FPS 65
           P T    + YE G  L  +++ V  PKA+E+ I VK + VCHTD +   G  P     P 
Sbjct: 31  PETQKGVIFYENGGKLEYKDLPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLPVKLPL 90

Query: 66  ILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 124
           + GHEGAGIV + GE V + + GD+  +      C  C+ C+ G  + C     +   G 
Sbjct: 91  VGGHEGAGIVVAKGENVKNFEIGDYAGIKWLNGSCMSCELCEQGYESNCLQADLS---GY 147

Query: 125 MPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYG 184
             DG                   +F +Y                L     + C   T Y 
Sbjct: 148 THDG-------------------SFQQYATADAVQAAQIPKGTDLAEIAPILCAGVTVY- 187

Query: 185 AAVKTANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDF 243
            A+KTA+++ G  VAI G AG +G    Q AKA G  +++ +D  D K++   + G   F
Sbjct: 188 KALKTADLKPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGDGKEELFKQCGGEVF 246

Query: 244 INPATDLQNGQTIVEKLIEMTDGG 267
           I    D +  + +V  + E T+GG
Sbjct: 247 I----DFRKSKDMVADIQEATNGG 266

>Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {ON}
           YMR083W (ADH3) - 1:1 [contig 55] FULL
          Length = 387

 Score = 90.9 bits (224), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 79/264 (29%), Positives = 113/264 (42%), Gaps = 31/264 (11%)

Query: 7   PVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP-EGAFPS 65
           P T    + YE G  L  +++ V  PK +E+ I VK + VCHTD +   G  P +   P 
Sbjct: 43  PTTQKGVIFYEHGGELQYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLDVKLPL 102

Query: 66  ILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 124
           + GHEGAG+V + GE VT+ + GD   +      C  C+ C+ G    C     +   G 
Sbjct: 103 VGGHEGAGVVVAKGENVTNFEIGDLAGIKWLNGSCMSCELCEQGHEPNCEHADLS---GY 159

Query: 125 MPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYG 184
             DG                   +F +Y                L     + C   T Y 
Sbjct: 160 THDG-------------------SFQQYATADAVQAAQLPKGINLAEVAPILCAGVTVY- 199

Query: 185 AAVKTANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDF 243
            A+KTA++  G  VAI G AG +G    Q AKA G  +++ +D  D KK+  H+ G   F
Sbjct: 200 KALKTADLIPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGDEKKELFHKLGGEIF 258

Query: 244 INPATDLQNGQTIVEKLIEMTDGG 267
           I    D    + +V  + E T GG
Sbjct: 259 I----DYTTTKDMVGAIQEATQGG 278

>Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar to
           Ashbya gossypii ABL033C
          Length = 375

 Score = 90.9 bits (224), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 80/269 (29%), Positives = 116/269 (43%), Gaps = 31/269 (11%)

Query: 2   STEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEG 61
           ++ G P+T  A + YE G  L  ++I V  PK +E+ + VK + VCHTD +   G  P  
Sbjct: 26  TSSGIPLTQKAVIFYEHGDKLHYKDIPVPKPKPNEILVNVKYSGVCHTDIHAWKGDWPLA 85

Query: 62  A-FPSILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRAT 119
              P + GHEGAGIV + G  VT+ + GD+  V      C  C++C++G  + C     +
Sbjct: 86  TKLPLVGGHEGAGIVVAKGSNVTNFEIGDYAGVKWLNKSCMSCEYCETGHESNCAEADLS 145

Query: 120 QGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGV 179
              G   DG                   +F +Y                L     + C  
Sbjct: 146 ---GYTRDG-------------------SFQQYATADAVQAAKIPQGTDLAQVAPILCAG 183

Query: 180 TTGYGAAVKTANVQKGDTVAI-FGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEF 238
            T Y  A+KTAN+  G  VAI    G +G    Q AKA G  +++ +D   AK     + 
Sbjct: 184 VTVY-KALKTANLDPGQWVAISGAGGGLGSLAVQYAKAMGL-RVVGIDGGAAKDALFKKL 241

Query: 239 GATDFINPATDLQNGQTIVEKLIEMTDGG 267
           G   FI    D    + IV  + E T+GG
Sbjct: 242 GGEVFI----DFTKSKDIVADIQEATNGG 266

>TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score = 90.9 bits (224), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 81/269 (30%), Positives = 117/269 (43%), Gaps = 31/269 (11%)

Query: 2   STEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEG 61
           ST   P T    + YE   PL  ++I V  PK++E+ I V+ + VCHTD +   G  P  
Sbjct: 28  STYQIPKTQKGVIFYENNGPLEYKDIPVPKPKSNEILINVEYSGVCHTDLHAWKGDWPLP 87

Query: 62  A-FPSILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRAT 119
              P + GHEGAG+V  +G+ V + K GD   +      C  C+ C++G    C     +
Sbjct: 88  VKLPLVGGHEGAGVVVGMGDNVKNWKIGDLAGIKWLNGSCMSCELCENGFEANCEHADLS 147

Query: 120 QGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGV 179
              G   DG                   +F +Y                L +   + C  
Sbjct: 148 ---GYTHDG-------------------SFQQYATADAVQAARIPAGTDLANVAPILCAG 185

Query: 180 TTGYGAAVKTANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEF 238
            T Y  A+KTA+++ GD VAI G AG +G    Q A A G  ++I +D  + KKK   + 
Sbjct: 186 VTVY-KALKTADLKPGDWVAISGAAGGLGSLAVQYAAAMGL-RVIGIDGGEDKKKLFEKC 243

Query: 239 GATDFINPATDLQNGQTIVEKLIEMTDGG 267
           G   FI    D    + IV+ + E T GG
Sbjct: 244 GGEVFI----DFTKSKDIVKDIQEATHGG 268

>SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON}
           uniprot|Q9P8S5 Saccharomyces kluyveri Alcohol
           dehydrogenase isozyme 3
          Length = 373

 Score = 90.5 bits (223), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 80/270 (29%), Positives = 116/270 (42%), Gaps = 31/270 (11%)

Query: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP- 59
           M+T   P      + YE G  L  E+I V  PK +E+ I VK + VCHTD +   G  P 
Sbjct: 23  MATASIPEKQKGIIFYENGGELKYEDIPVPKPKPNELLINVKYSGVCHTDLHAWKGDWPL 82

Query: 60  EGAFPSILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRA 118
               P + GHEGAG+V ++GE V   K GD   +      C  C++C+    + C     
Sbjct: 83  PTKLPLVGGHEGAGVVVAMGENVKGWKIGDLAGIKWLNGSCLSCEYCEKSNESNCPHADL 142

Query: 119 TQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCG 178
           +   G   DG                   +F +Y                L     + C 
Sbjct: 143 S---GYTHDG-------------------SFQQYATADYVQAARIPEGTDLAEVSPILCA 180

Query: 179 VTTGYGAAVKTANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHE 237
             T Y  A+K+AN++ GD VAI G AG +G    Q AKA G  +++ +D    K + + +
Sbjct: 181 GVTVY-KALKSANLKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGAEKGELVKK 238

Query: 238 FGATDFINPATDLQNGQTIVEKLIEMTDGG 267
            G   FI    D    + +VE + E T+GG
Sbjct: 239 LGGEVFI----DFTKHKNLVEAVQEATNGG 264

>Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 90.1 bits (222), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 84/284 (29%), Positives = 122/284 (42%), Gaps = 35/284 (12%)

Query: 7   PVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEGA-FPS 65
           P T    + YE+   L  ++I V  PKA+E+ I VK + VCHTD +   G  P     P 
Sbjct: 4   PKTQKGVIFYESHGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPL 63

Query: 66  ILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 124
           + GHEGAG+V ++GE V     GD   +      C  C++C+ G  + C     +   G 
Sbjct: 64  VGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNCPHADLS---GY 120

Query: 125 MPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYG 184
             DG                   +F +Y                L     + C   T Y 
Sbjct: 121 THDG-------------------SFQQYATADSVQAAHIPKGTDLAECAPVLCAGITVY- 160

Query: 185 AAVKTANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDF 243
            A+K+AN+  G  VAI G AG +G    Q AKA G  +++ +D  + K++     G   F
Sbjct: 161 KALKSANLSAGQWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEGKEELFRSIGGEVF 219

Query: 244 INPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEA 287
           I+  T+    + IV  +I+ TDGG         NV V   A+EA
Sbjct: 220 IDFTTE----KDIVGAVIKATDGGAHGII----NVSVSEAAIEA 255

>AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR303C (ADH2)
          Length = 385

 Score = 90.1 bits (222), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 83/290 (28%), Positives = 123/290 (42%), Gaps = 35/290 (12%)

Query: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP- 59
           MS+   P T  A V  + G PL   EI V  PK  E+ I VK + VCHTD +   G  P 
Sbjct: 35  MSSPSIPKTQHAIVFDKNGGPLEYREIEVPEPKPTELLINVKYSGVCHTDLHAWKGDWPL 94

Query: 60  EGAFPSILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRA 118
               P + GHEGAG+V ++GE V   + GD   +      C  C+ C+ G  + C     
Sbjct: 95  PTKLPLVGGHEGAGVVVAMGENVRGWQVGDLAGIKWLNGSCMSCEACEQGHESNCPEADL 154

Query: 119 TQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCG 178
           +   G   DG                   +F +Y                L     + C 
Sbjct: 155 S---GYTHDG-------------------SFQQYATADAVQAAHIPAGTDLAQVAPILCA 192

Query: 179 VTTGYGAAVKTANVQKGDTVAIFGA-GTVGLSVAQGAKARGASQIILVDINDAKKKYMHE 237
             T Y  A+K+AN++ G+ VAI GA G +G    Q A+A G  +++ +D  D K+    +
Sbjct: 193 GITVY-KALKSANLRAGNWVAISGACGGLGSLAIQYARAMG-YRVLEIDGGDEKEALFRK 250

Query: 238 FGATDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEA 287
            G   F+    D +  + +V  +++ T GG         NV V   A+E+
Sbjct: 251 LGGEVFV----DFRKSKDVVADVVKATGGGAHGVI----NVSVSEAAIES 292

>Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 89.4 bits (220), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 82/284 (28%), Positives = 122/284 (42%), Gaps = 35/284 (12%)

Query: 7   PVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP-EGAFPS 65
           P T    + YE+   L  ++I V  PK +E+ I VK + VCHTD +   G  P     P 
Sbjct: 4   PKTQKGVIFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 66  ILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 124
           + GHEGAG+V ++G+ V   K GD   +    + C  C++C+ G  + C     +   G 
Sbjct: 64  VGGHEGAGVVVAIGDNVRGWKVGDLAGIKWLNSSCMACEYCELGNESNCPHADLS---GY 120

Query: 125 MPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYG 184
             DG                   +F +Y                L     + C   T Y 
Sbjct: 121 THDG-------------------SFQQYATADAVQAARIPEGTDLAQVAPILCAGITVY- 160

Query: 185 AAVKTANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDF 243
            A+K+AN++ G  VAI G AG +G    Q AKA G  +++ +D  + K++     G   F
Sbjct: 161 KALKSANLRAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFTSLGGEVF 219

Query: 244 INPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEA 287
           I    D    + IV  +++ TDGG         NV V   A+EA
Sbjct: 220 I----DFTKEKDIVSAVVKATDGGAHGIV----NVSVSEAAIEA 255

>KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]
           {ON} similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 89.0 bits (219), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 88/274 (32%), Positives = 130/274 (47%), Gaps = 40/274 (14%)

Query: 24  VEEITVDPPKAHEVRIRVKKTAVCHTDA-YTLSGADPEGAF----PSILGHEGAGIVESV 78
           V EIT DP   H V++++KKT +C +D  Y ++GA   G F    P ILGHE +G+V  V
Sbjct: 23  VPEIT-DP---HYVKLQIKKTGICGSDVHYYVAGAI--GDFVVKKPMILGHESSGLVVEV 76

Query: 79  GEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGT-SRFKNKKG 137
           G  V+ V+ GD V              K+G+ NLC  ++      +  DGT  ++     
Sbjct: 77  GSEVSRVRVGDRVAIEPGVPSRYSDETKAGRYNLCPHMQFAATPPI--DGTLVKYYLAPE 134

Query: 138 ETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYGAAVKTANVQKGDT 197
           + L+      ++ E               A +E    L  GV      A K A V     
Sbjct: 135 DFLVKLPDHVSYEE--------------GALVEP---LSVGVH-----ANKLAGVAFNQR 172

Query: 198 VAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFINPATDLQNGQTIV 257
           VA+FGAG VGL     A+A GAS+++ +D+ + K      FG T F+N A ++++   +V
Sbjct: 173 VAVFGAGPVGLLTGAVARAFGASEVVYIDVFEHKLSLSSNFGGTQFVNSA-NIKDEDDLV 231

Query: 258 EKLIEMTDGGL--DFTFDCTGNVKVMRDALEACH 289
            K IE   GG   D  FDCTG    +R  ++ C+
Sbjct: 232 -KEIERVLGGARPDVVFDCTGAEICIRTGIKVCN 264

>Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 89.0 bits (219), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 84/284 (29%), Positives = 121/284 (42%), Gaps = 35/284 (12%)

Query: 7   PVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEGA-FPS 65
           P T    + YE+   L  ++I V  PK +E+ I VK + VCHTD +   G  P     P 
Sbjct: 4   PKTQKGVIFYESNGKLEHKDIPVPTPKPNELLINVKYSGVCHTDLHAWHGDWPLATKLPL 63

Query: 66  ILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 124
           + GHEGAG+V ++GE V   K GD   +    + C  C++C+ G  + C     +   G 
Sbjct: 64  VGGHEGAGVVVAMGENVRGWKVGDLAGIKWLNSSCMACEYCELGNESNCPHADLS---GY 120

Query: 125 MPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYG 184
             DG                   +F +Y                L     + C   T Y 
Sbjct: 121 THDG-------------------SFQQYATADAVQAAHIPEGTDLAEVAPILCAGITVY- 160

Query: 185 AAVKTANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDF 243
            A+K+AN++ G  VAI G AG +G    Q AKA G  +++ +D    K++     G   F
Sbjct: 161 KALKSANLRAGHWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGPGKEELFTSLGGEVF 219

Query: 244 INPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEA 287
           I    D    + IV  +I+ TDGG         NV V   A+EA
Sbjct: 220 I----DFTKEKDIVGAVIKATDGGAHGIV----NVSVSEAAIEA 255

>Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 88.6 bits (218), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 83/287 (28%), Positives = 122/287 (42%), Gaps = 35/287 (12%)

Query: 7   PVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP-EGAFPS 65
           P T    + YE+   L  + I V  PK +E+ I VK + VCHTD +   G  P     P 
Sbjct: 4   PETQKGVIFYESNGKLEHKNIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 66  ILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 124
           + GHEGAG+V ++G+ V   K GD   V    + C  C++C+ G  + C     +   G 
Sbjct: 64  VGGHEGAGVVVAIGDNVRGWKVGDLAGVKWLNSSCMACEYCELGNESNCPHADLS---GY 120

Query: 125 MPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYG 184
             DG                   +F +Y                L     + C   T Y 
Sbjct: 121 THDG-------------------SFQQYATADAVQAARIPEGTDLAEVAPILCAGITVY- 160

Query: 185 AAVKTANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDF 243
            A+K+AN++ G+ VAI G AG +G    Q AKA G  +++ +D    K++     G   F
Sbjct: 161 KALKSANLRAGNWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGPGKQELFTSLGGEVF 219

Query: 244 INPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHK 290
           I    D    + I+  +++ TDGG         NV V   A+EA  K
Sbjct: 220 I----DFTKEKDIIGAVVKATDGGAHGII----NVSVSEAAIEASTK 258

>YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON}
           ADH2Glucose-repressible alcohol dehydrogenase II,
           catalyzes the conversion of ethanol to acetaldehyde;
           involved in the production of certain carboxylate
           esters; regulated by ADR1
          Length = 348

 Score = 88.6 bits (218), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 83/284 (29%), Positives = 120/284 (42%), Gaps = 35/284 (12%)

Query: 7   PVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP-EGAFPS 65
           P T  A + YE+   L  ++I V  PK +E+ I VK + VCHTD +   G  P     P 
Sbjct: 4   PETQKAIIFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 66  ILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 124
           + GHEGAG+V  +GE V   K GD+  +      C  C++C+ G  + C     +   G 
Sbjct: 64  VGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHADLS---GY 120

Query: 125 MPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYG 184
             DG                   +F EY                L     + C   T Y 
Sbjct: 121 THDG-------------------SFQEYATADAVQAAHIPQGTDLAEVAPILCAGITVY- 160

Query: 185 AAVKTANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDF 243
            A+K+AN++ G   AI G AG +G    Q AKA G  +++ +D    K++     G   F
Sbjct: 161 KALKSANLRAGHWAAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGPGKEELFTSLGGEVF 219

Query: 244 INPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEA 287
           I    D    + IV  +++ T+GG         NV V   A+EA
Sbjct: 220 I----DFTKEKDIVSAVVKATNGGAHGII----NVSVSEAAIEA 255

>KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 348

 Score = 87.4 bits (215), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 82/284 (28%), Positives = 121/284 (42%), Gaps = 35/284 (12%)

Query: 7   PVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEGA-FPS 65
           P T  A V    G  L  ++I V  P A+E+ I VK + VCHTD +   G  P     P 
Sbjct: 4   PKTQKAVVFETNGGELEYKDIPVPKPAANEILINVKYSGVCHTDLHAWKGDWPLATKLPL 63

Query: 66  ILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 124
           + GHEGAG+V  +GE V   K GD   +      C  C+ C+    + C     +   G 
Sbjct: 64  VGGHEGAGVVVGIGENVKGWKLGDLAGIKWLNGSCMACESCELSNESNCPHADLS---GY 120

Query: 125 MPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYG 184
             DG                   +F +Y                L     + C   T Y 
Sbjct: 121 THDG-------------------SFQQYATADAVQAARIPEGTDLAEVAPILCAGITVY- 160

Query: 185 AAVKTANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDF 243
            A+K+AN++ G+ VAI G AG +G    Q AKA G  ++I +D  D K++   + G   F
Sbjct: 161 KALKSANLRAGNWVAISGAAGGLGSLAVQYAKAMG-YRVIGIDGGDEKEQLFKKLGGEYF 219

Query: 244 INPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEA 287
           +    D +  + +V +++E+T GG         NV V   A+E+
Sbjct: 220 V----DFRKSKDVVAEILEVTGGGAHGVV----NVSVSEAAIES 255

>Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 87.8 bits (216), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 79/269 (29%), Positives = 111/269 (41%), Gaps = 31/269 (11%)

Query: 2   STEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEG 61
           ST   P T    + YE    L  ++I V  PK +E+ I VK + VCHTD +   G  P  
Sbjct: 26  STIAIPQTQKGVIFYENNGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLP 85

Query: 62  A-FPSILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRAT 119
              P + GHEGAG+V  +G  V   K GD   +      C  C+FC+SG  + C      
Sbjct: 86  VKLPLVGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC------ 139

Query: 120 QGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGV 179
                 PD            L  +    +F ++                L     + C  
Sbjct: 140 ------PDA----------DLSGYTHDGSFQQFATADAIQAAKIQQGTDLAEVAPILCAG 183

Query: 180 TTGYGAAVKTANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEF 238
            T Y  A+K AN++ GD VAI G AG +G    Q A A G  +++ +D    K+K   + 
Sbjct: 184 VTVY-KALKEANLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGAEKEKLFKQL 241

Query: 239 GATDFINPATDLQNGQTIVEKLIEMTDGG 267
           G   FI    D    + +V  + E T GG
Sbjct: 242 GGEVFI----DFTKTKDMVSDIQEATKGG 266

>Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086C
           (ADH1) - Alcohol dehydrogenase [contig 183] FULL
          Length = 351

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 84/290 (28%), Positives = 121/290 (41%), Gaps = 35/290 (12%)

Query: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP- 59
           MS    P T  A + YE G PL  ++I V  P A E+ I VK + VCHTD +   G  P 
Sbjct: 1   MSAPEIPKTQKAVIFYENGGPLEYKDIPVPKPSATELLINVKYSGVCHTDLHAWKGDWPL 60

Query: 60  EGAFPSILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRA 118
               P + GHEGAG+V ++GE V   K GD+  +      C  C+ C+    + C     
Sbjct: 61  PTKLPLVGGHEGAGVVVAMGENVKGWKIGDYAGIKWLNGSCMSCESCELSNESNCPEADL 120

Query: 119 TQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCG 178
           +   G   DG                   +F +Y                L     + C 
Sbjct: 121 S---GYTHDG-------------------SFQQYATADAVQAAKIPQGTDLAEVAPVLCA 158

Query: 179 VTTGYGAAVKTANVQKGDTVAIFGA-GTVGLSVAQGAKARGASQIILVDINDAKKKYMHE 237
             T Y  A+K+AN+  GD VAI GA G +G    Q A A G  +++ +D    K +   +
Sbjct: 159 GITVY-KALKSANLSAGDWVAISGACGGLGSLCIQYATAMG-YRVLGIDGGAEKAELFKQ 216

Query: 238 FGATDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEA 287
            G   FI    D    + +  ++I+ T+GG         NV V   A+E+
Sbjct: 217 LGGEVFI----DFTTCKDVEGEIIKATNGGAHGVI----NVSVSEAAIES 258

>TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 83/290 (28%), Positives = 121/290 (41%), Gaps = 35/290 (12%)

Query: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPE 60
           MS    P T    + YE    L  ++I V  P  +E+ I VK + VCHTD +   G  P 
Sbjct: 1   MSAPTIPETQKGVIFYENNGTLEYKDIPVPKPAPNELLINVKYSGVCHTDLHAWKGDWPL 60

Query: 61  GA-FPSILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRA 118
               P + GHEGAG+V ++G  V + K GD+  +      C  C+ C+ G  + C     
Sbjct: 61  PVKLPLVGGHEGAGVVVALGSNVKNWKVGDYAGIKWLNGCCMSCEDCELGNESNCPQADL 120

Query: 119 TQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCG 178
           +   G   DG                   +F +Y            P   L     + C 
Sbjct: 121 S---GYTHDG-------------------SFQQYATTDAVQAAKISPGTDLAEVAPVLCA 158

Query: 179 VTTGYGAAVKTANVQKGDTVAIFGA-GTVGLSVAQGAKARGASQIILVDINDAKKKYMHE 237
             T Y  A+K+A ++ G  VAI GA G +G    Q AKA G  +++ +D  D K K   E
Sbjct: 159 GLTVY-KALKSAELEAGQWVAISGACGGLGSLAVQYAKAMG-YRVLGIDGGDEKAKMFKE 216

Query: 238 FGATDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEA 287
            G   FI    D    + I+ ++++ T+GG         NV V   A+ A
Sbjct: 217 LGGEYFI----DFTKCKDIIGEVVKATNGGAHGVI----NVSVSEAAISA 258

>YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}
           ADH3Mitochondrial alcohol dehydrogenase isozyme III;
           involved in the shuttling of mitochondrial NADH to the
           cytosol under anaerobic conditions and ethanol
           production
          Length = 375

 Score = 87.4 bits (215), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 78/269 (28%), Positives = 112/269 (41%), Gaps = 31/269 (11%)

Query: 2   STEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEG 61
           ST   P T    + YE    L  ++I V  PK +E+ I VK + VCHTD +   G  P  
Sbjct: 26  STAAIPKTQKGVIFYENKGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLP 85

Query: 62  A-FPSILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRAT 119
              P + GHEGAG+V  +G  V   K GD   +      C  C+FC+SG  + C      
Sbjct: 86  VKLPLVGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC------ 139

Query: 120 QGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGV 179
                 PD            L  +    +F ++                L     + C  
Sbjct: 140 ------PDA----------DLSGYTHDGSFQQFATADAIQAAKIQQGTDLAEVAPILCAG 183

Query: 180 TTGYGAAVKTANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEF 238
            T Y  A+K A+++ GD VAI G AG +G    Q A A G  +++ +D  + K+K   + 
Sbjct: 184 VTVY-KALKEADLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFKKL 241

Query: 239 GATDFINPATDLQNGQTIVEKLIEMTDGG 267
           G   FI    D    + +V  + E T GG
Sbjct: 242 GGEVFI----DFTKTKNMVSDIQEATKGG 266

>SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON}
           uniprot|Q6XQ71 Saccharomyces kluyveri ADH4 Alcohol
           dehydrogenase 4
          Length = 377

 Score = 86.7 bits (213), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 78/264 (29%), Positives = 111/264 (42%), Gaps = 31/264 (11%)

Query: 7   PVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP-EGAFPS 65
           P T    + YE+G  L  ++I V  PK +E+ I VK + VCHTD +   G  P     P 
Sbjct: 33  PTTQKGVIFYESGGKLEYKDIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 92

Query: 66  ILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 124
           + GHEGAG+V + GE V + + GD   +      C  C+ C+ G  + C     +   G 
Sbjct: 93  VGGHEGAGVVVAKGENVMNFEIGDLAGIKWLNGSCMACELCEQGHESNCLHADLS---GY 149

Query: 125 MPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYG 184
             DG                   +F +Y                L     + C   T Y 
Sbjct: 150 THDG-------------------SFQQYATADAVQAAQIPKGTDLAEVAPILCAGVTVY- 189

Query: 185 AAVKTANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDF 243
            A+KTA+++ G  VAI G AG +G    Q AKA G  +I+ +D    K++     G   F
Sbjct: 190 KALKTADLKPGQWVAISGAAGGLGSLAVQYAKAMGL-RILGIDGGPGKEELFKSLGGEVF 248

Query: 244 INPATDLQNGQTIVEKLIEMTDGG 267
           I    D    + IV  + E T GG
Sbjct: 249 I----DFTKTKDIVSAIQEATKGG 268

>ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W
          Length = 370

 Score = 86.7 bits (213), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 76/288 (26%), Positives = 121/288 (42%), Gaps = 31/288 (10%)

Query: 2   STEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP-E 60
           ST   P T    + YE+G  L  +++ V  P+ +E+ + VK + VCHTD +   G  P +
Sbjct: 21  STISIPSTQKGVIFYESGGKLHYKDLAVPKPRNNEILVNVKYSGVCHTDLHAWKGDWPLD 80

Query: 61  GAFPSILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRAT 119
              P + GHEGAG+V + GE V + + GD   +      C  C+ C+ G  + C     +
Sbjct: 81  TKLPLVGGHEGAGVVVAKGENVKNFEIGDLAGIKWLNGSCQSCEMCEMGHESNCAHADLS 140

Query: 120 QGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGV 179
              G   DG                   TF +Y                L     + C  
Sbjct: 141 ---GYTHDG-------------------TFQQYATADAIQAAHIPKGTDLAGVAPILCAG 178

Query: 180 TTGYGAAVKTANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEF 238
            T Y  A++++  + G+ VAI G AG +G    Q A+A G  +++ +D  + K K     
Sbjct: 179 VTVY-KALRSSGARPGEWVAISGAAGGLGSLATQYARAMGL-RVVGIDGGEDKAKLFKSL 236

Query: 239 GATDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALE 286
           G   FI    D    + I   ++E T GG     + + + K M  ++E
Sbjct: 237 GGEIFI----DFTKEKDIPAAILEATQGGAHGVINVSVSEKAMSQSVE 280

>Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 86.7 bits (213), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 78/269 (28%), Positives = 112/269 (41%), Gaps = 31/269 (11%)

Query: 2   STEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEG 61
           ST   P T    + YE    L  ++I V  PK +E+ I VK + VCHTD +   G  P  
Sbjct: 26  STAAIPETQKGVIFYENKGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLP 85

Query: 62  A-FPSILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRAT 119
              P + GHEGAG+V  +G  V   K GD   +      C  C+FC+SG  + C      
Sbjct: 86  VKLPLVGGHEGAGVVVKLGSNVKGWKIGDLAGIKWLNGSCMTCEFCESGHESNC------ 139

Query: 120 QGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGV 179
                 PD            L  +    +F ++                L     + C  
Sbjct: 140 ------PDA----------DLSGYTHDGSFQQFATADAIQAAKIQQGTDLAEVAPILCAG 183

Query: 180 TTGYGAAVKTANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEF 238
            T Y  A+K A+++ GD VAI G AG +G    Q A A G  +++ +D  + K+K   + 
Sbjct: 184 VTVY-KALKEADLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFKKL 241

Query: 239 GATDFINPATDLQNGQTIVEKLIEMTDGG 267
           G   FI    D    + +V  + E T GG
Sbjct: 242 GGEVFI----DFTKTKDMVSDIQEATKGG 266

>ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly
           similar to uniprot|P00330 Saccharomyces cerevisiae
           YOL086C ADH1 Alcohol dehydrogenase involved in the
           production of certain carboxylate esters
          Length = 379

 Score = 85.9 bits (211), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 83/287 (28%), Positives = 117/287 (40%), Gaps = 35/287 (12%)

Query: 7   PVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP-EGAFPS 65
           P T    V  E+  PL  +EI V  PK +E+ I V+ + VCHTD +   G  P     P 
Sbjct: 35  PKTQKGVVFNESNGPLEYKEIPVPTPKPNEILIHVRYSGVCHTDLHAWKGDWPLPTKLPL 94

Query: 66  ILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 124
           + GHEGAG V ++G  V + K GD   +      C  C+ C+    + C           
Sbjct: 95  VGGHEGAGEVIALGSNVKNWKVGDLAGIKWLNGSCMSCESCEQSNESNC----------- 143

Query: 125 MPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYG 184
            PD            L  +    +F +Y            P   L     + C   T Y 
Sbjct: 144 -PDA----------DLSGYTHDGSFQQYATADAVQAAHIPPGTDLAEVAPVLCAGITVY- 191

Query: 185 AAVKTANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDF 243
            A+K+AN++ G  VAI G AG +G    Q AKA G  +++ +D    K++     G   F
Sbjct: 192 KALKSANLKAGQWVAISGAAGGLGSLAVQFAKAMGL-RVVGIDGGPGKEELFKTLGGEVF 250

Query: 244 INPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHK 290
           I    D Q    IV  ++  T+GG         NV V   A+ A  K
Sbjct: 251 I----DFQKESDIVGAVVNATNGGAHGVV----NVSVSEGAISASTK 289

>KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 79/270 (29%), Positives = 114/270 (42%), Gaps = 31/270 (11%)

Query: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSG-ADP 59
           MS    P T  A +  E G  L  ++I V  PK++E+ I V  + VCH+D +   G    
Sbjct: 1   MSAPTIPKTQKAIIFSEVGGKLEYKDIPVPVPKSNELLINVLYSGVCHSDLHIWQGDLPL 60

Query: 60  EGAFPSILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRA 118
               P + GHEGAG+V  +G  V   K GD+  +      C  C+FC+      C     
Sbjct: 61  PLKLPLVGGHEGAGVVVGMGSNVKGWKLGDYAGIKFLNGTCNACEFCEQSFEISCPHADF 120

Query: 119 TQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCG 178
           T   G + DG                   +F +Y                L +   L C 
Sbjct: 121 T---GTVHDG-------------------SFQQYATADAVQAARIPQGTDLAAIAPLLCA 158

Query: 179 VTTGYGAAVKTANVQKGDTVAIFGA-GTVGLSVAQGAKARGASQIILVDINDAKKKYMHE 237
             T Y  A+K+AN++ G  VAI GA G +G    Q A A G  +++ +D  + K KY   
Sbjct: 159 GLTAY-KALKSANMRPGQWVAISGACGGLGTYAIQYATAMG-YRVLGIDSGEEKAKYFKT 216

Query: 238 FGATDFINPATDLQNGQTIVEKLIEMTDGG 267
            G   FI    D +  + +V  +I+ TDGG
Sbjct: 217 LGGEVFI----DYKKSKDVVADVIKATDGG 242

>NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON}
           Anc_2.480
          Length = 373

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 78/269 (28%), Positives = 112/269 (41%), Gaps = 31/269 (11%)

Query: 2   STEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEG 61
           ST   P      + YE G PL  ++I V  PKA+E+ I VK + VCHTD +   G  P  
Sbjct: 24  STVTIPKMQKGVIFYETGGPLHYKDIPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLA 83

Query: 62  A-FPSILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRAT 119
              P + GHEG+G V ++GE V   K GD   +      C  C+ C+SG  + C     +
Sbjct: 84  TKLPLVGGHEGSGEVVAMGENVKGWKIGDLAGIKWLNGSCMSCELCESGHESNCEHADLS 143

Query: 120 QGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGV 179
              G   DG                   +F +Y                +     + C  
Sbjct: 144 ---GYTHDG-------------------SFQQYATADAVQAARIPKGTNMAEVAPILCAG 181

Query: 180 TTGYGAAVKTANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEF 238
            T Y  A+K A+++ G  V I G AG +G    Q AKA G  ++I +D    K++     
Sbjct: 182 ITVY-KALKEADMRAGQWVCISGAAGGLGSLAVQYAKAMG-YRVIGIDGGPGKEELFKSL 239

Query: 239 GATDFINPATDLQNGQTIVEKLIEMTDGG 267
           G   F+    D    + IV ++ E T GG
Sbjct: 240 GGEIFV----DFTKTKDIVAEIQEATRGG 264

>TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16
           YLR070C
          Length = 353

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 104/385 (27%), Positives = 158/385 (41%), Gaps = 50/385 (12%)

Query: 8   VTSLAAVAYEAGKPLSVEEITVDPPK-AHEVRIRVKKTAVCHTDAYTL---SGADPEGAF 63
           + S  AV  E  + + +E   +   K  H+V+I++K T +C +D +     S  D     
Sbjct: 1   MASQEAVVLEKKELIQIESRPIPEIKNPHDVKIQIKATGICGSDVHYFTQGSIGDFVVKS 60

Query: 64  PSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQGKG 123
           P +LGHE AG+V  VG+ V+SVK GD V           K   SG  NLC  +       
Sbjct: 61  PLVLGHESAGVVVEVGDAVSSVKVGDRVAVEPGVPSRYSKETMSGHYNLCPHMAFAATPP 120

Query: 124 VMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGY 183
              DGT          + +++    F  Y               PL  A           
Sbjct: 121 Y--DGT---------LVKYYLSPEDFV-YKLADHISFEEGAVVEPLSVAV---------- 158

Query: 184 GAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATD- 242
             A + AN   G  V + GAG VGL     AKA GA+ ++ VDI ++K +   +FGAT  
Sbjct: 159 -HANRLANTAFGQAVLVLGAGPVGLLAGAVAKAFGATDVVFVDIFESKLEKAKQFGATRT 217

Query: 243 -FINPATDLQNGQTIVEKLIEMTDGGL--DFTFDCTGNVKVMRDALEACHK----XXXXX 295
               P +D  +  ++V K +    GGL  D  F+C+G  K +R A+++  +         
Sbjct: 218 VLFKPDSDENDLVSLVTKSL----GGLHPDVVFECSGAEKCIRAAVKSVKRGGTFVQVGM 273

Query: 296 XXXXXXXXXQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNR 355
                     E S +         +KG  F   +G  +    +K    G + V   IT  
Sbjct: 274 GKDNINFPINEFSQKE------ATFKG-CFRYYEG--DFDDAVKLLSTGKVNVKPLITKV 324

Query: 356 RPFKQINEAFED--LHAGDSLRTVL 378
            PF+Q  EA++    HA D  +T++
Sbjct: 325 FPFEQAVEAYKHNVEHAKDVTKTII 349

>KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 83.2 bits (204), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 110/270 (40%), Gaps = 31/270 (11%)

Query: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP- 59
           +S    P T  A V  E G  L   +I V   KA+E+ I VK + VCH+D Y      P 
Sbjct: 11  LSVMTLPKTQKAMVFSEYGGDLEYRDIPVPTKKANEILINVKYSGVCHSDLYVWKNRTPM 70

Query: 60  EGAFPSILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRA 118
               P + GHEGAG+V  +G  V + K GD   V    + C  C+ C+ G    C     
Sbjct: 71  TSKLPLVGGHEGAGVVVGMGSNVKNWKIGDKAGVKWLNSTCMTCEHCELGNEPSC---LK 127

Query: 119 TQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCG 178
           ++  G   +G                   +F +Y                L       C 
Sbjct: 128 SEYNGFTRNG-------------------SFQQYVAVDAIHAPRLPDNCDLAELAPASCA 168

Query: 179 VTTGYGAAVKTANVQKGDTVAIFGA-GTVGLSVAQGAKARGASQIILVDINDAKKKYMHE 237
             T Y  A+K+AN++ G  +AI GA G +G    Q  KA G  +++ +D  +AK     E
Sbjct: 169 GVTVY-KAIKSANIRAGQWMAITGACGGLGSVAIQYCKAMG-YRVVGIDAGEAKANLFKE 226

Query: 238 FGATDFINPATDLQNGQTIVEKLIEMTDGG 267
            G   FI    D    + +V  ++  T+GG
Sbjct: 227 LGGEVFI----DFTKSKDLVADVVSATNGG 252

>TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {ON}
           Anc_3.118 YBR145W
          Length = 350

 Score = 82.8 bits (203), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 83/290 (28%), Positives = 123/290 (42%), Gaps = 36/290 (12%)

Query: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPE 60
           MSTE  P T    + YE   PL  ++I V  P  +E+ I V  + VCHTD +   G  P 
Sbjct: 1   MSTE-IPKTQKGVIFYENNGPLEYKDIPVPTPLPNELLIHVLYSGVCHTDLHAWHGDWPL 59

Query: 61  GA-FPSILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRA 118
               P + GHEGAG+V  +G  V   K GD+  +      C  C+ C+    + C     
Sbjct: 60  PVKLPLVGGHEGAGVVVGMGSSVKGWKVGDYAGIKWLNGSCMSCEECELSNESNCPEADL 119

Query: 119 TQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCG 178
           +   G   DG                   +F +Y              A L++   + C 
Sbjct: 120 S---GYTHDG-------------------SFQQYATADAVQAAKIPAGADLKNIAPILCA 157

Query: 179 VTTGYGAAVKTANVQKGDTVAIFGA-GTVGLSVAQGAKARGASQIILVDINDAKKKYMHE 237
             T Y  A+K+AN++ GD +AI GA G +G    Q  KA G  +I+ +D    K++   +
Sbjct: 158 GVTVY-KAIKSANLKAGDWLAISGACGGLGSLAIQYGKAMGF-RILGIDGGAEKEELFKK 215

Query: 238 FGATDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEA 287
            G   FI    D    + I+ ++ + T+GG         NV V   A+EA
Sbjct: 216 LGGEYFI----DFTQCKDIIAEVKKATNGGAHGVI----NVSVSEAAIEA 257

>KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar to
           uniprot|P39713 Saccharomyces cerevisiae YAL061W putative
           polyol dehydrogenase
          Length = 382

 Score = 82.8 bits (203), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 80/304 (26%), Positives = 121/304 (39%), Gaps = 73/304 (24%)

Query: 11  LAAVAYEAGKPLSVEEITVDPPKAHE--VRIRVKKTAVCHTD----------------AY 52
           + A+AY   K +   +    P  +HE  V I V    VC +D                 +
Sbjct: 1   MRALAYFGQKDIRFTDSLAQPQVSHEDEVEIDVSWCGVCGSDLHEYLDGPIFFPANGKTH 60

Query: 53  TLSGADPEGAFPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAEC------------- 99
            +SG       P  +GHE +GIV  VG  V+ VK GDHVV      C             
Sbjct: 61  AMSGQ----GLPQAMGHEMSGIVSKVGSDVSKVKVGDHVVVGACCTCEDRARWPDVKHER 116

Query: 100 -GKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFKNKKGETLLHF--MGCST--FSEYTX 154
            G C  CK+G  N C                         T L F  +GC +  F+E   
Sbjct: 117 EGLCIACKTGNPNCC-------------------------TDLGFCGLGCQSGGFAEKIV 151

Query: 155 XXXXXXXXXXPKAPLESACLLGCGVTTGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGA 214
                        PL+ A L+     + +  AV+ + +Q G T  + GAG +GL+     
Sbjct: 152 LSERNVVKIPNSLPLDVAALVEPISVSWH--AVRISKLQPGQTALVLGAGPIGLAAVLAL 209

Query: 215 KARGASQIILVDINDAKKKYMHEFGATDFINPATDLQNGQTIVEKLIEMTDG--GLDFTF 272
           ++ GA  II+ +  D +++     GA  F NP    ++G  ++E L ++  G  G +F++
Sbjct: 210 QSHGAGTIIVSEPADTRRQKAEALGAQTF-NPT---EHGDNVIEALRKLAPGGEGFNFSY 265

Query: 273 DCTG 276
           DC G
Sbjct: 266 DCCG 269

>Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON}
           (21043..22185) [1143 nt, 381 aa]
          Length = 380

 Score = 82.8 bits (203), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 73/249 (29%), Positives = 105/249 (42%), Gaps = 31/249 (12%)

Query: 22  LSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEGA-FPSILGHEGAGIVESVGE 80
           L   +I V  PK++E+ I VK + VCHTD +   G  P     P + GHEGAG+V  +GE
Sbjct: 51  LKYTDIPVPTPKSNEILINVKYSGVCHTDLHAWKGDWPLAVKLPLVGGHEGAGVVVGIGE 110

Query: 81  GVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFKNKKGET 139
            V   K GD   +      C  C+ C++G    C     +   G   DG           
Sbjct: 111 NVKGWKLGDLAGIKWLNGSCMSCELCETGHEANCEHADLS---GYTHDG----------- 156

Query: 140 LLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYGAAVKTANVQKGDTVA 199
                   +F +Y              + L     + C   T Y  A+KTAN++ G+ VA
Sbjct: 157 --------SFQQYATADAVQAARIPEGSDLAQIAPILCAGITVY-KALKTANLKPGEWVA 207

Query: 200 IFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFINPATDLQNGQTIVE 258
           I G AG +G    Q AKA G  +++ +D  + K+K     G   F+    D    + IV 
Sbjct: 208 ISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEEKEKLFRSLGGEVFV----DFTKSKDIVA 262

Query: 259 KLIEMTDGG 267
            +   T GG
Sbjct: 263 DIQNATKGG 271

>CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar to
           uniprot|P39714 Saccharomyces cerevisiae YAL060w FUN49 or
           uniprot|P39713 Saccharomyces cerevisiae YAL061w FUN50
          Length = 383

 Score = 82.4 bits (202), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 80/294 (27%), Positives = 121/294 (41%), Gaps = 65/294 (22%)

Query: 29  VDPPKA---HEVRIRVKKTAVCHTD----------------AYTLSGADPEGAFPSILGH 69
           +D PK    HE+ I V    +C TD                 + LSG D     P  +GH
Sbjct: 18  IDTPKINNDHELMIDVAWCGICGTDLHEFLEGPIFMPKDGDTHYLSGLD----LPLPMGH 73

Query: 70  EGAGIVESVGEGVTSVKPGDHVVALYTAECGK--------------CKFCKSGKTNLCGS 115
           E +GIV+ VG+GVT  KPGD VV   T  CG               C  C+ G  N C +
Sbjct: 74  EMSGIVKEVGKGVTRFKPGDRVVIEATTSCGDTHRWPKSKVAKGELCPACEMGLPNCC-T 132

Query: 116 VRATQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLL 175
             + QG G +  G                    F+E              K PL+ A L+
Sbjct: 133 HGSFQGLGSVGGG--------------------FAEQVVVGEKHVVKIPDKLPLDVAALV 172

Query: 176 GCGVTTGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYM 235
              ++  + AA + A  ++G    + G+G +GL++    K   A +I++ +    +++  
Sbjct: 173 E-PLSVAWHAA-RLAEFKEGSNALVLGSGPIGLAMILALKGMKAGKIVVSEPAKLRRELA 230

Query: 236 HEFGATDFINPATDLQNGQTIVEKLIEMT--DGGLDFTFDCTGNVKVMRDALEA 287
            +     F    T  QN    +EKL E++  D G D+TFDC+G       A++A
Sbjct: 231 EKLNVVVFNPTHTRAQNA---IEKLKELSPKDHGFDYTFDCSGVQDTFNAAVKA 281

>TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {ON}
           Anc_2.480 YMR083W
          Length = 373

 Score = 82.4 bits (202), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 73/264 (27%), Positives = 112/264 (42%), Gaps = 31/264 (11%)

Query: 7   PVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEGA-FPS 65
           P T    + YE G  L  ++I V  PK +E+ I +K + VCHTD +   G  P     P 
Sbjct: 29  PATQKGVIFYENGGELHYKDIAVPKPKPNEILINIKYSGVCHTDLHAWKGDWPLPVKLPL 88

Query: 66  ILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 124
           + GHEGAG+V + G+ VT+ + GD   V    + C  C++C+ G  + C     +   G 
Sbjct: 89  VGGHEGAGVVVAKGKDVTNFEIGDLAGVKWLNSSCMACEYCELGHESNCAKADLS---GY 145

Query: 125 MPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYG 184
             DG                   +F +Y                L     + C   T Y 
Sbjct: 146 THDG-------------------SFQQYATADAIQAAPIPKDTDLAEVAPILCAGVTVY- 185

Query: 185 AAVKTANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDF 243
            A+KT+  + G  VAI G AG +G    Q A A G  +++ +D  + K++     G   F
Sbjct: 186 KALKTSGAKPGQWVAISGAAGGLGSLAVQYATAMGL-RVLGIDGGEGKEELFKSLGGEVF 244

Query: 244 INPATDLQNGQTIVEKLIEMTDGG 267
           +    D    + +V  + E T+GG
Sbjct: 245 V----DFTKTKDMVSAIQEATNGG 264

>Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON}
           YJR159W (SOR1) - sorbitol-induced sorbitol dehydrogenase
           [contig 159] FULL
          Length = 356

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 81/253 (32%), Positives = 110/253 (43%), Gaps = 40/253 (15%)

Query: 35  HEVRIRVKKTAVCHTDA-YTLSGADPEGAF--PSILGHEGAGIVESVGEGVTSVKPGDHV 91
           +  ++ VK T +C +D  Y  SG   +     P +LGHE +G+V  VG  V  +K GD V
Sbjct: 30  YYAKVAVKATGICGSDVHYYRSGGIGKYILNSPMVLGHESSGVVVEVGPKVEKIKVGDRV 89

Query: 92  VALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGT-SRFKNKKGETLLHFMGCSTFS 150
                         K+GK NLC  +       +  DGT  ++     + L+      +F 
Sbjct: 90  AIEPGVPDRYSDETKAGKYNLCPHMAFAATPPI--DGTLVKYYLSPADFLVKLPDHVSFE 147

Query: 151 EYTXXXXXXXXXXXPKAPLESACL--LGCGVTTGYGAAVKTANVQKGDTVAIFGAGTVGL 208
           E                    AC+  L  GV +      K A V+ G TV +FGAG VGL
Sbjct: 148 E-------------------GACIEPLSVGVHSN-----KLAKVRFGQTVVVFGAGPVGL 183

Query: 209 SVAQGAKARGASQIILVDINDAKKKYMHEFGATDFIN----PATDLQNGQTIVEKLIEMT 264
                AKA GAS ++ VD+ D K +    FGAT  IN    P  D Q     VEKL+   
Sbjct: 184 LTGAVAKAFGASDVVFVDVFDQKLERAKNFGATHVINSTKLPKNDPQALADEVEKLL--- 240

Query: 265 DGGL-DFTFDCTG 276
            G L D  F+C+G
Sbjct: 241 GGALADVVFECSG 253

>Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON}
           (51276..52337) [1062 nt, 354 aa]
          Length = 353

 Score = 81.6 bits (200), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 81/284 (28%), Positives = 117/284 (41%), Gaps = 35/284 (12%)

Query: 7   PVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP-EGAFPS 65
           P T    + YE    L  +++ V  PK  E+ I V  + VCHTD +   G  P +   P 
Sbjct: 9   PKTQKGVIFYENNGELQYKDLPVPQPKPTELLIHVLYSGVCHTDLHAWKGDWPLDTKLPL 68

Query: 66  ILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 124
           + GHEGAG+V  +G  V   K GD   +      C  C+ C+    + C     +   G 
Sbjct: 69  VGGHEGAGVVVGMGSSVKGWKMGDLAGIKWLNGSCMNCEECELSNESNCPEADLS---GY 125

Query: 125 MPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYG 184
             DG                   +F +Y              A +     + C   T Y 
Sbjct: 126 THDG-------------------SFQQYATADAVQAAHIPQGADMAEVAPILCAGVTVY- 165

Query: 185 AAVKTANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDF 243
            A+K+A ++ GD VAI G AG +G    Q AKA G  +++ +D  D K+K+    G   F
Sbjct: 166 KALKSAELKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGDEKEKFFKSMGGEVF 224

Query: 244 INPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEA 287
           +    D    + IV  + E T+GG      C  NV V   A+EA
Sbjct: 225 V----DFMTCKDIVGAVKEATNGG---AHGCI-NVSVSEKAIEA 260

>Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 106/376 (28%), Positives = 151/376 (40%), Gaps = 61/376 (16%)

Query: 20  KPLSVEEITVDPPKAHEVRIRVKKTAVCHTDA-YTLSGADPEGAF--PSILGHEGAGIVE 76
           +P+ + E   DP   H V+I +K T +C +D  Y  SG   +     P +LGHE +G V 
Sbjct: 22  RPVPIIE---DP---HYVKIAIKATGICGSDIHYYRSGGIGKYILKAPMVLGHESSGQVV 75

Query: 77  SVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFKNKK 136
            VG  VT VK GD V              K G+ NLC  +       +  DGT       
Sbjct: 76  EVGSAVTRVKVGDRVAIEPGVPSRYSDETKEGRYNLCPHMAFAATPPI--DGTLVKYYLS 133

Query: 137 GETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACL--LGCGVTTGYGAAVKTANVQK 194
            E  L  +      E                  E AC+  L  GV +      K A V+ 
Sbjct: 134 PEDFLVKLPEGVSYE------------------EGACVEPLSVGVHSN-----KLAGVRF 170

Query: 195 GDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFIN----PATDL 250
           G  V +FGAG VGL     A+A GAS ++ +D+ D K     EFGAT   N    PA   
Sbjct: 171 GSRVVVFGAGPVGLLTGAVARAFGASDVVFIDVFDNKLDRAKEFGATHTFNSSKFPADKT 230

Query: 251 QNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDA-LEACHKXXXXXXXXXXXXXXQEIST 309
           Q     VEKL  ++    D  F+C+G      DA ++A  K              +  + 
Sbjct: 231 QELADEVEKL--LSGHHADIVFECSGA-----DACIDAGVKITKVGGTMVQIGMGKNYTN 283

Query: 310 RPFQLVTGRVWK-----GSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQINEA 364
            P   V+G+  K       +FG  +        +K    G + V   IT+R  F+   +A
Sbjct: 284 FPIAEVSGKEMKLIGCFRYSFGDYRDA------VKLVASGKVNVKAMITHRFKFEDAAKA 337

Query: 365 --FEDLHAGDSLRTVL 378
             F   H G+ ++T++
Sbjct: 338 YDFNIAHGGEVVKTII 353

>YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON}
           XYL2Xylitol dehydrogenase, converts xylitol to
           D-xylulose; expression induced by xylose, even though
           this pentose sugar is not well utilized by S.
           cerevisiae; null mutant has cell wall defect
          Length = 356

 Score = 80.9 bits (198), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 102/382 (26%), Positives = 165/382 (43%), Gaps = 44/382 (11%)

Query: 8   VTSLAAVAYEAGKPLSVEEITVDPPK---AHEVRIRVKKTAVCHTDAYTLSG---ADPEG 61
           +T+  A+  E  +P  +    V  PK    +EV I++K T +C +D +  +    A+   
Sbjct: 4   LTTQEAIVLE--RPGKITLTNVSIPKISDPNEVIIQIKATGICGSDIHYYTHGRIANYVV 61

Query: 62  AFPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQG 121
             P +LGHE +GIV  +GE V ++K GD V              K G+ NL  +++    
Sbjct: 62  ESPMVLGHESSGIVALIGENVKTLKVGDRVALEPGIPDRFSPEMKEGRYNLDPNLKFAAT 121

Query: 122 KGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTT 181
                DGT     K  +T+  F+       Y               PL  A         
Sbjct: 122 PPF--DGTL---TKYYKTMKDFV-------YKLPDDVSFEEGALIEPLSVAI-------- 161

Query: 182 GYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGAT 241
               A K A ++ G    +FGAG +GL   + A   GA+ ++ VD+ + K +   +FGAT
Sbjct: 162 ---HANKLAKIKFGARCVVFGAGPIGLLAGKVASVFGAADVVFVDLLENKLETARQFGAT 218

Query: 242 DFINPATDLQNGQTIVEKLIEMTDG--GLDFTFDCTGNVKVMRDALEACHKXXXXXXXXX 299
             +N + DL +G T V+ +I+   G  G D  F+C+G    +R  +E C           
Sbjct: 219 HIVN-SGDLPHGVT-VDSVIKKAIGKKGADVVFECSGAEPCVRAGIEVCKAGGTIVQVGM 276

Query: 300 XXXXXQ-EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPF 358
                Q  IS  P + +T   ++G  F   +G  +    I+      L +  FIT+R  F
Sbjct: 277 GQEEIQFPISIIPTKELT---FQG-CFRYCQG--DYSDSIELVSSRKLSLKPFITHRYSF 330

Query: 359 KQINEAFEDL--HAGDSLRTVL 378
           K   EAFE+   H  ++++T++
Sbjct: 331 KDAVEAFEETSHHPLNNIKTII 352

>TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 351

 Score = 79.3 bits (194), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 81/288 (28%), Positives = 119/288 (41%), Gaps = 36/288 (12%)

Query: 7   PVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP-EGAFPS 65
           P T  A V    G  L  ++I V  P+ +E+ I VK + VCHTD +   G  P     P 
Sbjct: 6   PKTQKAVVFDTNGGELQYKDIPVPEPQPNELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 65

Query: 66  ILGHEGAGIVESVGEGVTS-VKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKG 123
           + GHEGAGIV + G  V    + GD   +      C  C++C+    + C     +   G
Sbjct: 66  VGGHEGAGIVVAKGSMVXXGWEIGDLAGIKWLNGSCMSCEYCEKANESNCPQADLS---G 122

Query: 124 VMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGY 183
              DG                   +F +Y                L     + C   T Y
Sbjct: 123 YTHDG-------------------SFQQYATADAVQAARVPKGTDLAEVAPILCAGITVY 163

Query: 184 GAAVKTANVQKGDTVAIFGA-GTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATD 242
             A+K+AN++ G+ VAI GA G +G    Q AKA G  +++ +D  D K K   + G   
Sbjct: 164 -KALKSANLRAGEWVAISGASGGLGSLAVQYAKAMG-YRVLGIDGGDEKAKLFKQLGGEY 221

Query: 243 FINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHK 290
           FI    D    + ++ ++I+ TDGG         NV V   A+ A  +
Sbjct: 222 FI----DFTKSKDVIAEVIKATDGGAHGVI----NVSVSEGAISASTR 261

>ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 348

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 80/287 (27%), Positives = 115/287 (40%), Gaps = 35/287 (12%)

Query: 7   PVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP-EGAFPS 65
           P T  A +  E   PL  ++I V  PK +E+ I V+ + VCHTD +   G  P     P 
Sbjct: 4   PETQKAVIFSENNGPLEYKDIPVPKPKPNEILIHVRYSGVCHTDLHAWKGDWPLPTKLPL 63

Query: 66  ILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 124
           + GHEGAG V ++G  V + K GD   +      C  C+ C+    + C           
Sbjct: 64  VGGHEGAGEVVALGSDVKNWKIGDLAGIKWLNGSCMSCEACEQSHESNC----------- 112

Query: 125 MPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYG 184
            PD         G          +F +Y                L     + C   T Y 
Sbjct: 113 -PDADLSGYTHDG----------SFQQYATADAVQAAHIPAGTNLAEVAPVLCAGITVY- 160

Query: 185 AAVKTANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDF 243
            A+K+AN++ G  VAI G AG +G    Q A+A G  +++ +D    K++     G   F
Sbjct: 161 KALKSANLKAGQWVAISGAAGGLGSLAVQYARAMGL-RVLGIDGGPGKEELFKTLGGECF 219

Query: 244 INPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHK 290
           I    D      I E +I+ T+GG         NV V   A+ A  K
Sbjct: 220 I----DFTKEHDIAEAVIKATNGGAHGVI----NVSVSEGAISASTK 258

>Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON}
           (41165..42226) [1062 nt, 354 aa]
          Length = 353

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 78/259 (30%), Positives = 110/259 (42%), Gaps = 31/259 (11%)

Query: 35  HEVRIRVKKTAVCHTDA-YTLSGADPEGAF----PSILGHEGAGIVESVGEGVTSVKPGD 89
           H V++++K T +C +D  +   GA   G+F    P +LGHE +GIV  VG  VT V  GD
Sbjct: 31  HFVKVQIKATGICGSDVHFCTHGAI--GSFIVKEPMVLGHESSGIVVEVGSEVTKVAVGD 88

Query: 90  HVVALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFKNKKGETLLHFMGCSTF 149
            V           +   SG  NLC  ++      V  DGT          LL +      
Sbjct: 89  RVAIEPGYPSRYSEETVSGHYNLCPGMKFAATPPV--DGT----------LLKYFQVPED 136

Query: 150 SEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYGAAVKTANVQKGDTVAIFGAGTVGLS 209
             Y               PL  A             AVK A V+ GD V +FGAG VGL 
Sbjct: 137 FVYKLPDDVTFEEGALVEPLAVAV-----------HAVKLAGVKFGDKVVVFGAGPVGLL 185

Query: 210 VAQGAKARGASQIILVDINDAKKKYMHEFGATDFINPATDLQNGQTIVEKLIEMTDGGLD 269
           V    KA GA++++ +D+ D K     E G+T  IN + D+      +E   ++     +
Sbjct: 186 VGSVCKAFGATEVVSIDVVDKKLDKSLEMGSTIAIN-SKDMAEEALALEIQNDLNGQHPN 244

Query: 270 FTFDCTGNVKVMRDALEAC 288
              DCTG    +R ++ AC
Sbjct: 245 KVIDCTGAEPCLRSSILAC 263

>ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR083W
           (ADH3)
          Length = 373

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 79/277 (28%), Positives = 113/277 (40%), Gaps = 45/277 (16%)

Query: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSG---A 57
           +S+   P T  A V YE G  L   +I V  PK +E+ + +K + VCHTD +   G    
Sbjct: 23  LSSTAIPTTQKAVVFYEHGGELKYTDIPVPKPKPNEILVNIKYSGVCHTDLHAWKGDWAI 82

Query: 58  DPEGAFPSILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSV 116
            P+   P + GHEGAG+V + G  VT+ + GD+  V      C +C+FC+          
Sbjct: 83  KPK--LPLVGGHEGAGVVVAKGANVTNFEIGDYAGVKWLGKTCMECEFCQ---------- 130

Query: 117 RATQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLG 176
                KG  P       N +  TL  +    TF +Y            P   L     + 
Sbjct: 131 -----KGFEP-------NCETPTLSGYTHDGTFQQYATADAIHAAHIPPGTDLAKVAPIL 178

Query: 177 CGVTTGYGAAVKTANVQKGDTVAI------FGAGTVGLSVAQGAKARGASQIILVDINDA 230
           C   T Y  A+KTA +  G  VAI       G+  V  +VA G +  G      +D  + 
Sbjct: 179 CAGITVY-KALKTAALIPGQWVAISGAGGGLGSLAVQYAVAMGYRVVG------IDGGNE 231

Query: 231 KKKYMHEFGATDFINPATDLQNGQTIVEKLIEMTDGG 267
           K+      G   F+    D    + IV  + E T GG
Sbjct: 232 KEALFRSLGGETFV----DFHKNKDIVSAVREATGGG 264

>Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {ON}
           YLR070C (REAL)
          Length = 356

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 97/383 (25%), Positives = 164/383 (42%), Gaps = 48/383 (12%)

Query: 9   TSLAAVAYEAGKPLSVEEITVDPPK---AHEVRIRVKKTAVCHTDAYTLSGADPEGAF-- 63
           T+  AV  E  +P  +    V+ PK   A++V +++K T +C +D +  +          
Sbjct: 5   TTQEAVVLE--QPGKIVLTNVNIPKISDANDVIVQIKATGICGSDIHYYTHGRISHFVVK 62

Query: 64  -PSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQGK 122
            P +LGHE +G+V  +G+ V ++K GD V              K G+ NL   ++     
Sbjct: 63  SPMVLGHESSGVVVLIGDNVKTLKVGDRVALEPGFPNRFSSELKEGRYNLDPDLKFAATP 122

Query: 123 GVMPDGT-SRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTT 181
               DGT +++     + +       +F E                PL  A         
Sbjct: 123 PY--DGTLTKYYRAPKDFVYKIPDHVSFEEGALM-----------EPLSVAV-------- 161

Query: 182 GYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGAT 241
               A + A ++ G    +FGAG VGL   + A   GA+ ++ VD+++ K +   +FGAT
Sbjct: 162 ---HANRLAKMRFGARCVVFGAGPVGLLTGKVASVFGATDVVFVDLSETKLERAKQFGAT 218

Query: 242 DFINPATDLQNG---QTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKXXXXXXXX 298
             +N + DL  G   +T++ K I     G D  F+C+G    +R  +E C          
Sbjct: 219 HMVN-SGDLPQGVSAETVIRKAI--GKKGADVVFECSGAQPCIRTGIEVCKAGGTYVQVG 275

Query: 299 XXXXXXQ-EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRP 357
                 Q  IS  P + +T   ++GS F   +G  +    I+    G L +   IT R  
Sbjct: 276 MGQEEIQFPISKIPAKEIT---FQGS-FRYCQG--DYSDSIELVSSGKLSLKPLITRRYQ 329

Query: 358 FKQINEAFEDL--HAGDSLRTVL 378
           FK+  EAF++   H  D+++T++
Sbjct: 330 FKEAIEAFDENRDHPLDNVKTII 352

>KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON}
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 356

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 72/261 (27%), Positives = 112/261 (42%), Gaps = 31/261 (11%)

Query: 7   PVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP-EGAFPS 65
           P+T  A +  +    L ++ I V  PKA+E+ I VK + VCH+D +   G  P +   P 
Sbjct: 10  PLTQRAVIFKKHSGKLELKSIEVQSPKANELLINVKFSGVCHSDLHAWKGDWPTKTKLPL 69

Query: 66  ILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 124
           + GHEGAGIV ++G  V   K GD+  +    + C  C+ C+      C     +   G 
Sbjct: 70  VGGHEGAGIVVAMGASVRGWKIGDYAGIKWLNSCCMSCEQCELSNEPNCAYADIS---GF 126

Query: 125 MPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYG 184
             DG                   +F +Y            P   L     + C   T + 
Sbjct: 127 TRDG-------------------SFQQYATADAVQAARIPPGTNLAEVSPVLCAGITVF- 166

Query: 185 AAVKTANVQKGDTVAIFGA-GTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDF 243
            A+KTAN+  G+ VAI GA G +G    Q AKA G S ++ +D    K+   ++ G   F
Sbjct: 167 KALKTANLTAGNWVAISGACGGLGSMAIQYAKAMGYS-VVGIDSGAEKEHLFNDLGGDVF 225

Query: 244 INPATDLQNGQTIVEKLIEMT 264
           +    D    + +V +++  T
Sbjct: 226 L----DFSKSENLVPEVVSAT 242

>Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 76/280 (27%), Positives = 112/280 (40%), Gaps = 55/280 (19%)

Query: 36  EVRIRVKKTAVCHTDAYTLSG------------ADPEGAFPSILGHEGAGIVESVGEGVT 83
           EV I V    +C +D +  +             A    A P  +GHE +GI+  VG  VT
Sbjct: 28  EVIIDVSWCGICGSDLHEYTDGPIFMPKDGECHALSNAALPLAMGHEMSGIIAKVGPRVT 87

Query: 84  SVKPGDHVVALYTAECGK--------------CKFCKSGKTNLCGSVRATQGKGVMPDGT 129
            VK GDHVV    + C                C+ CK G  NLC       G GV+  G 
Sbjct: 88  KVKVGDHVVVDAGSSCADLHCWPHSKYYNSKPCEACKKGSENLCAH-SGFVGLGVISGG- 145

Query: 130 SRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYGAAVKT 189
                              F+E              + PL+ A L+     T +  AVK 
Sbjct: 146 -------------------FAEQVVVSEHHIIPVPKEIPLDVAALVEPLSVTWH--AVKL 184

Query: 190 ANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFINPATD 249
           +  +KG +  + GAG +GL      K  GA +I++ ++ + + K         F NPA  
Sbjct: 185 SGFKKGSSALVLGAGPIGLCTILVLKGMGAGKIVVSEVAERRLKMAKSLDVEVF-NPA-- 241

Query: 250 LQNGQTIVEKLIEMTDG--GLDFTFDCTGNVKVMRDALEA 287
            Q+G   VE L  +T+   G D+++DC+G       +L+A
Sbjct: 242 -QHGHKSVELLRGLTESHDGFDYSYDCSGIQATFETSLKA 280

>ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR070C
           (XYL2)
          Length = 353

 Score = 78.2 bits (191), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 82/281 (29%), Positives = 116/281 (41%), Gaps = 38/281 (13%)

Query: 13  AVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDA-YTLSGADPEGAF----PSIL 67
           A+ YE  +P+ V E   DP   H V+++++KT +C +D  Y L G+   G F    P +L
Sbjct: 16  AIVYE-HRPVPVIE---DP---HYVKVKIEKTGICGSDVHYYLHGSI--GPFVVRSPMVL 66

Query: 68  GHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPD 127
           GHE +G V  VG  VT V+ GD V           +  KSG  NLC  +R         D
Sbjct: 67  GHESSGTVVEVGSDVTRVRIGDRVAIEPGVPSRYSEETKSGHYNLCREMRFAATPPY--D 124

Query: 128 GTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYGAAV 187
           G                   T  +Y                LE   L  C        A 
Sbjct: 125 G-------------------TLVKYYISPEDFLVKLPDSVSLEEGAL--CEPLAVAVHAN 163

Query: 188 KTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFINPA 247
           + A  Q    V +FGAG VGL  A  AKA GA+ + +VDI+  K       G T  ++ +
Sbjct: 164 RLAGTQFPSRVVVFGAGPVGLLTASVAKAFGATTVAIVDISKHKLCVAPALGVTHPVD-S 222

Query: 248 TDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEAC 288
           +D  + + +  KL       +D  FDC+G    +  A+  C
Sbjct: 223 SDCSSPEALANKLRAELRSDVDIAFDCSGAEICIAAAVLIC 263

>Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W
           (SOR1) - sorbitol-induced sorbitol dehydrogenase [contig
           381] FULL
          Length = 356

 Score = 78.2 bits (191), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 78/253 (30%), Positives = 107/253 (42%), Gaps = 34/253 (13%)

Query: 32  PKAHEVRIRVKKTAVCHTDA-YTLSGADPEGAF--PSILGHEGAGIVESVGEGVTSVKPG 88
           P  H V++ +K T +C +D  Y  SG+  +     P +LGHE +G V  VG  V S+K G
Sbjct: 27  PNEHYVKVAIKATGICGSDIHYYKSGSIGKYVVNQPMVLGHESSGEVVEVGSAVRSIKVG 86

Query: 89  DHVVALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGT-SRFKNKKGETLLHFMGCS 147
           D V              K G+ NLC  +       +  DGT  ++     + L+      
Sbjct: 87  DRVAIEPGVPDRYSDETKQGRYNLCPDMAFAATPPI--DGTLVKYYVSPADFLVKLPDHV 144

Query: 148 TFSEYTXXXXXXXXXXXPKAPLESACL--LGCGVTTGYGAAVKTANVQKGDTVAIFGAGT 205
           +F E                    AC+  L  GV      A K A V  G  V +FGAG 
Sbjct: 145 SFEE-------------------GACIEPLSVGVH-----ANKLAKVHFGSVVVVFGAGP 180

Query: 206 VGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFINPATDLQNGQTIVEKLIEMTD 265
           VGL     AKA GAS++I VD+ D K +    FGAT  IN  +  +     V   +    
Sbjct: 181 VGLLTGAVAKAFGASEVIYVDVFDNKLERAKGFGATHTINSKSLPRGEGDAVSAAVSNYL 240

Query: 266 GG--LDFTFDCTG 276
           GG   D  F+C+G
Sbjct: 241 GGALADVVFECSG 253

>Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {ON}
           YOL086C (ADH1) - Alcohol dehydrogenase [contig 146] FULL
          Length = 216

 Score = 75.9 bits (185), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 68/235 (28%), Positives = 99/235 (42%), Gaps = 27/235 (11%)

Query: 7   PVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP-EGAFPS 65
           P T  A V    G  L  ++I V  P + E+ I VK + VCHTD +   G  P     P 
Sbjct: 4   PKTQKAIVFASNGGELEYKDIPVPKPSSTEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 63

Query: 66  ILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 124
           + GHEGAG+V ++GE V   K GD   +      C  C++C+ G  + C     +   G 
Sbjct: 64  VGGHEGAGVVVALGENVKGWKVGDLAGIKWLNGSCMACEYCELGNESNCPHADLS---GY 120

Query: 125 MPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYG 184
             DG                   +F +Y                L     + C   T Y 
Sbjct: 121 THDG-------------------SFQQYATADAVQAAKIPQGTDLAQVAPILCAGITVY- 160

Query: 185 AAVKTANVQKGDTVAIFGA-GTVGLSVAQGAKARGASQIILVDINDAKKKYMHEF 238
            A+K+A+++ G  VAI GA G +G    Q A+A G  +++ +D  D K+K   E 
Sbjct: 161 KALKSADLKAGQWVAISGACGGLGSLAVQYARAMG-YRVLGIDGGDDKRKLFKEL 214

>YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}
           BDH1NAD-dependent (R,R)-butanediol dehydrogenase,
           catalyzes oxidation of (R,R)-2,3-butanediol to
           (3R)-acetoin, oxidation of meso-butanediol to
           (3S)-acetoin, and reduction of acetoin; enhances use of
           2,3-butanediol as an aerobic carbon source
          Length = 382

 Score = 77.4 bits (189), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 74/263 (28%), Positives = 107/263 (40%), Gaps = 47/263 (17%)

Query: 39  IRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAE 98
           I + K   CH     LS A    A P  +GHE +GIV  VG  VT VK GDHVV    + 
Sbjct: 51  IFMPKDGECHK----LSNA----ALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAASS 102

Query: 99  CGK--------------CKFCKSGKTNLCGSVRATQGKGVMPDGTSRFKNKKGETLLHFM 144
           C                C  C+ G  NLC       G GV+  G                
Sbjct: 103 CADLHCWPHSKFYNSKPCDACQRGSENLCTHA-GFVGLGVISGG---------------- 145

Query: 145 GCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYGAAVKTANVQKGDTVAIFGAG 204
               F+E              + PL+ A L+     T +  AVK +  +KG +  + GAG
Sbjct: 146 ----FAEQVVVSQHHIIPVPKEIPLDVAALVEPLSVTWH--AVKISGFKKGSSALVLGAG 199

Query: 205 TVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFINPATDLQNGQTIVEKLIEMT 264
            +GL      K  GAS+I++ +I + + +   + G   F NP+        I+  L +  
Sbjct: 200 PIGLCTILVLKGMGASKIVVSEIAERRIEMAKKLGVEVF-NPSKHGHKSIEILRGLTKSH 258

Query: 265 DGGLDFTFDCTGNVKVMRDALEA 287
           D G D+++DC+G       +L+A
Sbjct: 259 D-GFDYSYDCSGIQVTFETSLKA 280

>TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7.3
           YAL060W
          Length = 395

 Score = 77.4 bits (189), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 97/240 (40%), Gaps = 41/240 (17%)

Query: 63  FPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAEC--------------GKCKFCKSG 108
            P  +GHE AG+V  VG GV   K GDHVV   T  C                C  CK G
Sbjct: 67  LPQAMGHEMAGVVSRVGPGVKKFKVGDHVVVEPTGTCKDRYRWKNSPSKNDDMCNACKKG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAP 168
             N+C  +    G GV   G                    F+E                P
Sbjct: 127 YYNICSKL-GLCGAGVQSGG--------------------FAERVVMNESHCHKVPDDLP 165

Query: 169 LESACLLGCGVTTGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDIN 228
           L+ A L+       +  A++  N +KG +  + G+G +GL +       G + I++ +  
Sbjct: 166 LDIAALIQPIAVCWH--ALRICNFKKGSSALVVGSGPIGLGIILALHGHGCTDIVVSEPA 223

Query: 229 DAKKKYMHEFGATDFINPATDLQNGQTIVEKLIEMTDG--GLDFTFDCTGNVKVMRDALE 286
             ++ +  E GAT F +P++ L   +  ++ L  +  G  G D+TFDC+GN      ++E
Sbjct: 224 KIRRDFAKELGATVF-DPSS-LPTHEESIKYLRSIAPGGDGFDYTFDCSGNQYTFNASIE 281

>Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 77.0 bits (188), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 100/369 (27%), Positives = 148/369 (40%), Gaps = 59/369 (15%)

Query: 28  TVDPPKAHEVRIRVKKTAVCHTDA-YTLSGADPEGAF--PSILGHEGAGIVESVGEGVTS 84
           T++ P  H V++ +K T +C +D  Y  SG   +     P +LGHE +G V  VG  VT 
Sbjct: 26  TIEDP--HYVKLAIKATGICGSDVHYYRSGGIGKYILKAPMVLGHESSGEVVEVGNAVTR 83

Query: 85  VKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFKNKKGETLLHFM 144
           VK GD V              K G+ NLC  +       +  DGT        E  L  +
Sbjct: 84  VKVGDRVAIEPGVPSRYSDETKEGRYNLCPHMAFAATPPI--DGTLVKYYLSPEDFLVKL 141

Query: 145 GCSTFSEYTXXXXXXXXXXXPKAPLESACL--LGCGVTTGYGAAVKTANVQKGDTVAIFG 202
                 E                  E AC+  L  GV +      K A V+    V +FG
Sbjct: 142 PEGVSYE------------------EGACVEPLSVGVHSN-----KLAGVRFSTRVVVFG 178

Query: 203 AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFIN----PATDLQNGQTIVE 258
           AG VGL     A+A GAS ++ VD+ D K +   +FGAT+  N    P    Q   + VE
Sbjct: 179 AGPVGLLTGAVARAFGASDVVFVDVFDNKLQRAKDFGATNTFNSSKIPTDKAQELASEVE 238

Query: 259 KLIEMTDGG--LDFTFDCTGNVKVMRDALEACHKXXXXXXXXXXXXXXQEISTRPFQLVT 316
           KL+    GG   D  F+C+G        ++A  K              +  +  P   V+
Sbjct: 239 KLL----GGNHADVVFECSG----ADVCIDAGVKVTKVGGTMVQVGMGKNYTNFPIAEVS 290

Query: 317 GRVWK-----GSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQINEAFED--LH 369
           G+  K       +FG  +    +         G + V   IT+R  F+   +A++    H
Sbjct: 291 GKEMKLIGCFRYSFGDYRDAVNL------VATGKVNVKPLITHRFKFEDAAKAYDYNISH 344

Query: 370 AGDSLRTVL 378
            GD ++T++
Sbjct: 345 GGDVVKTII 353

>NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16
          Length = 357

 Score = 76.6 bits (187), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 72/262 (27%), Positives = 105/262 (40%), Gaps = 36/262 (13%)

Query: 35  HEVRIRVKKTAVCHTDAYTL---SGADPEGAFPSILGHEGAGIVESVGEGVTSVKPGDHV 91
           H V++++K T +C +D +     S  D     P +LGHE +GI+  VG  V ++K GD V
Sbjct: 31  HWVKVQIKATGICGSDVHFYKYGSIGDFVVKSPMVLGHESSGIIAEVGSAVKTLKVGDRV 90

Query: 92  VALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFKNKKGETLLHFMGCS---- 147
                      +   SG  NLC                           +HF        
Sbjct: 91  ALEPGYPSRYTEATMSGHYNLC-------------------------PFMHFAATPPCDG 125

Query: 148 TFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYGAAVKTANVQKGDTVAIFGAGTVG 207
           T ++Y                 E   LL   ++ G  A  K A  + GD V +FGAG VG
Sbjct: 126 TLTKYYLTPFDFVYKLPDNVSYEEGALLE-PLSVGVHAN-KQAGTRFGDKVVVFGAGPVG 183

Query: 208 LSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFINPATDLQNGQTIVEKLIEMTDGG 267
           L     AK  GA Q++ +D+ D K +    FGAT  IN +    N +  +   I+   GG
Sbjct: 184 LLNGAVAKVFGALQVVFIDVVDEKLERAKHFGATAVINSSKLRINDEFELAVAIKEKLGG 243

Query: 268 L--DFTFDCTGNVKVMRDALEA 287
           +  D   +CTG    +R  + A
Sbjct: 244 VDPDIVLECTGAEPCIRAGIRA 265

>Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {ON}
           complement(35191..36351) [1161 nt, 387 aa]
          Length = 386

 Score = 77.0 bits (188), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 67/242 (27%), Positives = 101/242 (41%), Gaps = 42/242 (17%)

Query: 63  FPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAEC--------------GKCKFCKSG 108
            P  +GHE +GI+ SVG G    K GDHVV   TA C                C+ C++G
Sbjct: 67  LPQAMGHEISGIISSVGPGCKKFKIGDHVVVEPTATCIDRYRWPNAPNRDTPMCEACRNG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAP 168
             N+C  +  T G GV   G                    F+E                P
Sbjct: 127 MPNICKYLGLT-GAGVEGGG--------------------FAEKMVINEHHCHKIPHHMP 165

Query: 169 LESACLLGCGVTTGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDIN 228
           L+ A L+   ++  +  AVK ++ ++G +V I G G +GL      K  G   I++ +  
Sbjct: 166 LDVASLIQ-PISVCW-HAVKVSHYKQGGSVLIVGGGPIGLGTILALKGFGCEDIVVSEPA 223

Query: 229 DAKKKYMHEFGATDFINPATDLQNGQTIVEKLIEMTDG--GLDFTFDCTGNVKVMRDALE 286
             +++   + GA  F      L N    ++ L EM  G  G D+TFDC+G    ++ A+E
Sbjct: 224 LIRRELAEKMGARVFDPSNMSLDNS---IKTLTEMAPGSQGFDYTFDCSGIPATLKVAIE 280

Query: 287 AC 288
            C
Sbjct: 281 CC 282

>Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)
          Length = 357

 Score = 76.6 bits (187), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 100/393 (25%), Positives = 159/393 (40%), Gaps = 55/393 (13%)

Query: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDA-YTLSGADP 59
           MS    P   L  V   A +   V   T+D P  H V++ +K T +C +D  Y  SG   
Sbjct: 1   MSQSSNPAVVLRKVGDIAIEQRPVP--TIDDP--HYVKLAIKATGICGSDVHYYRSGGIG 56

Query: 60  EGAF--PSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVR 117
           +     P +LGHE +G V  VG+ VT VK GD V              K G+ NLC  + 
Sbjct: 57  KYILKAPMVLGHESSGQVVEVGDAVTRVKIGDRVAIEPGVPGRYSDETKEGRYNLCPHMA 116

Query: 118 ATQGKGVMPDGT-SRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACL-- 174
                 +  DGT  R+     + L+      ++ E                    AC+  
Sbjct: 117 FAATPPI--DGTLVRYYLSPEDFLVKLPDGVSYEE-------------------GACVEP 155

Query: 175 LGCGVTTGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKY 234
           L  GV +      K A V+ G  V +FGAG VGL     A A GAS +I VD+ D + + 
Sbjct: 156 LSVGVHSN-----KLAGVRFGTRVVVFGAGPVGLLTGAVAHAFGASDVIFVDVFDNRLQR 210

Query: 235 MHEFGATDFINPAT-DLQNGQTIVEKLIEMTDG-GLDFTFDCTGNVKVMRDALEACHKXX 292
             +FGA+   N +   +   Q + +++ ++  G   D  F+C+G        ++A  K  
Sbjct: 211 AKDFGASGTFNSSKFSVDEAQQLADEVEKLLGGHHADVVFECSG----ADVCIDAGVKTT 266

Query: 293 XXXXXXXXXXXXQEISTRPFQLVTGRVWK-----GSAFGGIKGRSEMGGLIKDYQGGALK 347
                       +  +  P   V+G+  +       +FG  +    +         G + 
Sbjct: 267 KVGGTMVQVGMGKNYTNFPIAEVSGKEMRLIGCFRYSFGDYRDAVNL------VASGKVN 320

Query: 348 VDEFITNRRPFKQINEAFED--LHAGDSLRTVL 378
           V   IT+R  F+   +A++    H GD ++T++
Sbjct: 321 VKPLITHRFKFEDAAKAYDYNIAHGGDVVKTII 353

>Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 76.6 bits (187), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 100/393 (25%), Positives = 159/393 (40%), Gaps = 55/393 (13%)

Query: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDA-YTLSGADP 59
           MS    P   L  V   A +   V   T+D P  H V++ +K T +C +D  Y  SG   
Sbjct: 1   MSQSSNPAVVLRKVGDIAIEQRPVP--TIDDP--HYVKLAIKATGICGSDVHYYRSGGIG 56

Query: 60  EGAF--PSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVR 117
           +     P +LGHE +G V  VG+ VT VK GD V              K G+ NLC  + 
Sbjct: 57  KYILKAPMVLGHESSGQVVEVGDAVTRVKIGDRVAIEPGVPGRYSDETKEGRYNLCPHMA 116

Query: 118 ATQGKGVMPDGT-SRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACL-- 174
                 +  DGT  R+     + L+      ++ E                    AC+  
Sbjct: 117 FAATPPI--DGTLVRYYLSPEDFLVKLPDGVSYEE-------------------GACVEP 155

Query: 175 LGCGVTTGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKY 234
           L  GV +      K A V+ G  V +FGAG VGL     A A GAS +I VD+ D + + 
Sbjct: 156 LSVGVHSN-----KLAGVRFGTRVVVFGAGPVGLLTGAVAHAFGASDVIFVDVFDNRLQR 210

Query: 235 MHEFGATDFINPAT-DLQNGQTIVEKLIEMTDG-GLDFTFDCTGNVKVMRDALEACHKXX 292
             +FGA+   N +   +   Q + +++ ++  G   D  F+C+G        ++A  K  
Sbjct: 211 AKDFGASGTFNSSKFSVDEAQQLADEVEKLLGGHHADVVFECSG----ADVCIDAGVKTT 266

Query: 293 XXXXXXXXXXXXQEISTRPFQLVTGRVWK-----GSAFGGIKGRSEMGGLIKDYQGGALK 347
                       +  +  P   V+G+  +       +FG  +    +         G + 
Sbjct: 267 KVGGTMVQVGMGKNYTNFPIAEVSGKEMRLIGCFRYSFGDYRDAVNL------VASGKVN 320

Query: 348 VDEFITNRRPFKQINEAFED--LHAGDSLRTVL 378
           V   IT+R  F+   +A++    H GD ++T++
Sbjct: 321 VKPLITHRFKFEDAAKAYDYNIAHGGDVVKTII 353

>KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {ON}
           Anc_2.480 YMR083W
          Length = 374

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 74/269 (27%), Positives = 110/269 (40%), Gaps = 28/269 (10%)

Query: 2   STEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEG 61
           ST   P T    + YE G  L  ++I V  PK +E+ + VK + VCHTD +   G  P  
Sbjct: 22  STVSIPQTQKGVIFYEHGGDLHYKDIPVPKPKPNEILVNVKYSGVCHTDLHAWKGDWPLS 81

Query: 62  A-FPSILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRAT 119
              P + GHEGAG+V + G  V + + GD   +      C  C+ C+SG  + C     +
Sbjct: 82  VKLPLVGGHEGAGVVVAKGSNVNNFEIGDLAGIKWLNGSCMSCELCESGHESNCEHADLS 141

Query: 120 QGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGV 179
              G   DG                   +F +Y                L     + C  
Sbjct: 142 ---GYTHDG-------------------SFQQYATADAVQAAKIPEGTNLAEVAPVLCAG 179

Query: 180 TTGYGAAVKTANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEF 238
            T Y  A+K A++  G  V I G AG +G    Q  KA G  ++I +D    K++     
Sbjct: 180 ITVY-KALKEASLSPGQWVCISGAAGGLGSLAVQYGKAMGL-RVIGIDGGPGKEELFKSL 237

Query: 239 GATDFINPATDLQNGQTIVEKLIEMTDGG 267
           G   FI+  T  +    +V  + + T+GG
Sbjct: 238 GGEVFID-FTKQKTDSDMVAAIQKATNGG 265

>YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbitol
           dehydrogenase; expression is induced in the presence of
           sorbitol or xylose
          Length = 357

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 107/399 (26%), Positives = 159/399 (39%), Gaps = 67/399 (16%)

Query: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDA-YTLSGADP 59
           MS    P   L  V   A +   +  I  DP   H V++ +K T +C +D  Y  SG   
Sbjct: 1   MSQNSNPAVVLEKVGDIAIEQRPIPTIK-DP---HYVKLAIKATGICGSDIHYYRSGGIG 56

Query: 60  EGAF--PSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVR 117
           +     P +LGHE +G V  VG+ VT VK GD V              K G+ NLC  + 
Sbjct: 57  KYILKAPMVLGHESSGQVVEVGDAVTRVKVGDRVAIEPGVPSRYSDETKEGRYNLCPHMA 116

Query: 118 ATQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACL--L 175
                 +  DGT        E  L  +      E                  E AC+  L
Sbjct: 117 FAATPPI--DGTLVKYYLSPEDFLVKLPEGVSYE------------------EGACVEPL 156

Query: 176 GCGVTTGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYM 235
             GV +      K A V+ G  V +FGAG VGL     A+A GA+ +I VD+ D K +  
Sbjct: 157 SVGVHSN-----KLAGVRFGTKVVVFGAGPVGLLTGAVARAFGATDVIFVDVFDNKLQRA 211

Query: 236 HEFGATDFINP-------ATDLQNGQTIVEKLIEMTDGG--LDFTFDCTGNVKVMRDALE 286
            +FGAT+  N        A DL +G   V+KL+    GG   D  F+C+G        ++
Sbjct: 212 KDFGATNTFNSSQFSTDKAQDLADG---VQKLL----GGNHADVVFECSG----ADVCID 260

Query: 287 ACHKXXXXXXXXXXXXXXQEISTRPFQLVTGRVWK-----GSAFGGIKGRSEMGGLIKDY 341
           A  K              +  +  P   V+G+  K       +FG  +    +       
Sbjct: 261 AAVKTTKVGGTMVQVGMGKNYTNFPIAEVSGKEMKLIGCFRYSFGDYRDAVNL------V 314

Query: 342 QGGALKVDEFITNRRPFKQINEAFED--LHAGDSLRTVL 378
             G + V   IT++  F+   +A++    H G+ ++T++
Sbjct: 315 ATGKVNVKPLITHKFKFEDAAKAYDYNIAHGGEVVKTII 353

>Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 76/280 (27%), Positives = 114/280 (40%), Gaps = 55/280 (19%)

Query: 36  EVRIRVKKTAVCHTDAYT-LSG-----------ADPEGAFPSILGHEGAGIVESVGEGVT 83
           EV I V    +C +D +  L G           A      P  +GHE +GIV  VG  VT
Sbjct: 28  EVLIDVSWCGICGSDLHEYLDGPIFMPKDGECHALSNAGLPLAMGHEMSGIVAEVGPKVT 87

Query: 84  SVKPGDHVVALYTAECGK--------------CKFCKSGKTNLCGSVRATQGKGVMPDGT 129
            VK GDHVV    + C                C+ CK G  NLC +     G GV+  G 
Sbjct: 88  KVKVGDHVVVDAASSCADLHCWPQSKHYSSKPCEACKKGSENLC-THGGFIGLGVISGG- 145

Query: 130 SRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYGAAVKT 189
                              F+E              + PL+ A L+     T +  AVK 
Sbjct: 146 -------------------FAEQVAVSEHHIIPVPKEIPLDVAALVEPLSVTWH--AVKI 184

Query: 190 ANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFINPATD 249
           +  +KG +  + GAG +GL      K  GA +I++ ++ + + +     G   F NP+  
Sbjct: 185 SGFKKGSSALVLGAGPIGLCTILVLKGMGAGKIVVSEVAERRIEMAKNLGVEVF-NPS-- 241

Query: 250 LQNGQTIVEKLIEMTDG--GLDFTFDCTGNVKVMRDALEA 287
            ++GQ  +E L  +T    G D+++DC+G       +L+A
Sbjct: 242 -KHGQKSIEVLRGLTKSHDGFDYSYDCSGIQVTFETSLKA 280

>KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON}
           similar to uniprot|P39714 Saccharomyces cerevisiae
           YAL060W BDH1 NAD-dependent (2R 3R)-2 3-butanediol
           dehydrogenase
          Length = 385

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 97/228 (42%), Gaps = 39/228 (17%)

Query: 63  FPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAEC--------------GKCKFCKSG 108
            P  +GHE +GIV  VG  VT++K GDHVV   T  C               +C  C+ G
Sbjct: 67  LPQAMGHEMSGIVSKVGPKVTNIKAGDHVVVEATGTCLDHYTWPNAAHAKDAECAACQRG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAP 168
             N C  +    G GV   G                    F+E                P
Sbjct: 127 FYNCCAHL-GFMGLGVHSGG--------------------FAEKVVVSEKHVVKIPNTLP 165

Query: 169 LESACLLGCGVTTGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDIN 228
           L+ A L+     + +  AV+ + +QKG +  + GAG +GL+     +  GAS+I++ +  
Sbjct: 166 LDVAALVEPISVSWH--AVRISKLQKGQSALVLGAGPIGLATILALQGHGASKIVVSEPA 223

Query: 229 DAKKKYMHEFGATDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTG 276
           + ++    + G   F +P+   ++   I++KL    + G DF +DC+G
Sbjct: 224 EIRRNQAAKLGVETF-DPSEHKEDAVNILKKLAPGGE-GFDFAYDCSG 269

>YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}
           SOR2Protein of unknown function; protein sequence is 99%
           identical to the Sor1p sorbitol dehydrogenase;
           computational analysis of large-scale protein-protein
           interaction data also suggests a role in fructose or
           mannose metabolism
          Length = 357

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 107/399 (26%), Positives = 158/399 (39%), Gaps = 67/399 (16%)

Query: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDA-YTLSGADP 59
           MS    P   L  V   A +   +  I  DP   H V++ +K T +C +D  Y  SG   
Sbjct: 1   MSQNSNPAVVLEKVGDIAIEQRPIPTIK-DP---HYVKLAIKATGICGSDIHYYRSGGIG 56

Query: 60  EGAF--PSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVR 117
           +     P +LGHE +G V  VG+ VT VK GD V              K G  NLC  + 
Sbjct: 57  KYILKAPMVLGHESSGQVVEVGDAVTRVKVGDRVAIEPGVPSRYSDETKEGSYNLCPHMA 116

Query: 118 ATQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACL--L 175
                 +  DGT        E  L  +      E                  E AC+  L
Sbjct: 117 FAATPPI--DGTLVKYYLSPEDFLVKLPEGVSYE------------------EGACVEPL 156

Query: 176 GCGVTTGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYM 235
             GV +      K A V+ G  V +FGAG VGL     A+A GA+ +I VD+ D K +  
Sbjct: 157 SVGVHSN-----KLAGVRFGTKVVVFGAGPVGLLTGAVARAFGATDVIFVDVFDNKLQRA 211

Query: 236 HEFGATDFINP-------ATDLQNGQTIVEKLIEMTDGG--LDFTFDCTGNVKVMRDALE 286
            +FGAT+  N        A DL +G   V+KL+    GG   D  F+C+G        ++
Sbjct: 212 KDFGATNTFNSSQFSTDKAQDLADG---VQKLL----GGNHADVVFECSG----ADVCID 260

Query: 287 ACHKXXXXXXXXXXXXXXQEISTRPFQLVTGRVWK-----GSAFGGIKGRSEMGGLIKDY 341
           A  K              +  +  P   V+G+  K       +FG  +    +       
Sbjct: 261 AAVKTTKVGGTMVQVGMGKNYTNFPIAEVSGKEMKLIGCFRYSFGDYRDAVNL------V 314

Query: 342 QGGALKVDEFITNRRPFKQINEAFED--LHAGDSLRTVL 378
             G + V   IT++  F+   +A++    H G+ ++T++
Sbjct: 315 ATGKVNVKPLITHKFKFEDAAKAYDYNIAHGGEVVKTII 353

>ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3
          Length = 373

 Score = 74.3 bits (181), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 72/263 (27%), Positives = 107/263 (40%), Gaps = 30/263 (11%)

Query: 19  GKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADP-EGAFPSILGHEGAGIVES 77
           G  L  E++ V  P ++EV I VK + VCHTD +T  G  P +   P + GHEGAG+V +
Sbjct: 39  GPLLYREDLPVPTPASNEVLINVKYSGVCHTDLHTWKGEIPFKTKLPLVGGHEGAGVVVA 98

Query: 78  VGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFKNKK 136
            G+ V + + GD   V    + C  C+ C+ G    C      +  G   DG        
Sbjct: 99  KGKDVKTFEIGDLAGVKQLVSSCMGCESCEIGHEFGC---EQAEMSGSSHDG-------- 147

Query: 137 GETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYGAAVKTANVQKGD 196
                      TF +Y                L +   + C   + Y  A+K  N+Q   
Sbjct: 148 -----------TFQQYVAIDALQAPPLPANVDLAAVAPIFCAGVSVY-KALKNGNLQTNQ 195

Query: 197 TVAIFGA-GTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFINPATDLQNGQT 255
            VAIFGA G +G    Q AKA G   + +    + +K+  H  G   F+    D      
Sbjct: 196 WVAIFGATGGLGSIAVQYAKAMGYRVLGIDGPGEERKQLFHSLGGEVFL----DYTQVDN 251

Query: 256 IVEKLIEMTDGGLDFTFDCTGNV 278
           I   + + T GG     + T ++
Sbjct: 252 IPAAVKQATQGGAHCVLNVTASL 274

>Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 72/265 (27%), Positives = 108/265 (40%), Gaps = 51/265 (19%)

Query: 39  IRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAE 98
           I + K   CH+    LS A      P  +GHE +GI+  VG  VT VK GDHVV    + 
Sbjct: 51  IFMPKDGECHS----LSNA----GLPQAMGHEMSGIIAKVGPKVTKVKVGDHVVVQAGSS 102

Query: 99  CGK--------------CKFCKSGKTNLCGSVRATQGKGVMPDGTSRFKNKKGETLLHFM 144
           C                C  CK G  NLC       G GV+  G                
Sbjct: 103 CADLHCWPHSKHYNSKPCDACKKGCENLCTHA-GFIGLGVISGG---------------- 145

Query: 145 GCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYGAAVKTANVQKGDTVAIFGAG 204
               F+E              + PL+ A L+     T +  AV+ +  +KG +  + GAG
Sbjct: 146 ----FAEQVVVSEHHIIPVPKEIPLDVAALVEPLSVTWH--AVRLSGFKKGSSALVLGAG 199

Query: 205 TVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFINPATDLQNGQTIVEKLIEMT 264
            +GL      K  GA QI++ ++ + + +     G   F +P    ++G+  VE L  +T
Sbjct: 200 PIGLCTILVLKGMGAGQIVVSEVAERRMELARRLGVEIF-DPR---KHGEKSVESLRALT 255

Query: 265 DG--GLDFTFDCTGNVKVMRDALEA 287
               G D+++DC+G       +L+A
Sbjct: 256 KSHDGFDYSYDCSGIQATFDASLKA 280

>TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {ON}
           Anc_7.2 YAL061W
          Length = 382

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 78/279 (27%), Positives = 107/279 (38%), Gaps = 56/279 (20%)

Query: 36  EVRIRVKKTAVCHTDAYTLS----------GADPEGA--FPSILGHEGAGIVESVGEGVT 83
           EV I V    +C TD +  S          G+ P      P  +GHE +GIV  +G  VT
Sbjct: 28  EVLIEVSWAGICGTDLHEYSDGPIFMPQDGGSHPLSGKKLPQPMGHEMSGIVSKIGSKVT 87

Query: 84  SVKPGDHVVALYTAEC-------------GK-CKFCKSGKTNLCGSVRATQGKGVMPDGT 129
            VK GDHVV      C             GK C  C+ G  N+C     T G G    G 
Sbjct: 88  KVKVGDHVVVEAGCSCMDVKRWKESPLKGGKTCSACEKGLVNICAHACFT-GLGTSGGG- 145

Query: 130 SRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYGAAVKT 189
                              F+E                PL+ A L+     T + A  K 
Sbjct: 146 -------------------FAERLTVSQDHCIPIPKDLPLDVAALVEPLSVTWHAA--KV 184

Query: 190 ANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFINPATD 249
           A  QKG T  + GAG +GL+     K  GAS+I++ ++   ++      G   F NPA  
Sbjct: 185 AGFQKGQTACVLGAGPIGLATILTLKGLGASKIVVSELAQIRRDMAASMGVEVF-NPAEH 243

Query: 250 LQNGQTIVEKLIEMTDG--GLDFTFDCTGNVKVMRDALE 286
               +  + +L ++ +G  G D  FDC+G       AL 
Sbjct: 244 ----KDAIAELRKIPEGATGFDAAFDCSGVKATFNTALH 278

>KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {ON}
           
          Length = 391

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 89/238 (37%), Gaps = 38/238 (15%)

Query: 63  FPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECG--------------KCKFCKSG 108
            P  +GHE AGIV  VG GVT  K GDHV    T  C               KC  CK G
Sbjct: 67  LPQAMGHEMAGIVREVGSGVTQFKVGDHVSVEPTGTCRDRYRWPEAPGVNKEKCAACKRG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAP 168
             N+C  +    G GV   G                    F+E                P
Sbjct: 127 MYNVCSHL-GLIGNGVQSGG--------------------FAERVVINESHCYKLPNHIP 165

Query: 169 LESACLLGCGVTTGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDIN 228
           +E   L+     + +  AV+ +  + G +V I G G +GLS        G ++I++ +  
Sbjct: 166 MEVVALVQPIAVSWH--AVRVSKFKPGSSVLILGGGPIGLSTILALNGHGCTEIVVSEPA 223

Query: 229 DAKKKYMHEFGATDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALE 286
             ++    + GA  +       +     +  L    D G D+ FDC+G    +R ++E
Sbjct: 224 KIRRDLAEKMGAVVYDPMQHSYEENIKYLRALAPDKD-GFDYCFDCSGTPATLRSSIE 280

>Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W
           (BDH1) - (2R,3R)-2,3-butanediol dehydrogenase [contig
           44] FULL
          Length = 382

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 97/221 (43%), Gaps = 25/221 (11%)

Query: 63  FPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECG---KCKFCKSGKTNLCGSVRAT 119
            P  +GHE +G+V  +G GV ++K GDHVV   T  C    +    K      C + +  
Sbjct: 67  LPQAMGHEMSGVVAKIGPGVKNIKVGDHVVVETTGTCKDRYRWPDVKHASDEECAACK-- 124

Query: 120 QGKGVMPDGTSRFKNKKGETLLHFMGCST--FSEYTXXXXXXXXXXXPKAPLESACLLGC 177
                       F N   E     +GC +  F+E                PL+ A L+  
Sbjct: 125 ----------KDFYNCCSELGFCGLGCHSGGFAEKVVISEKHVVKVPKDIPLDVAALVEP 174

Query: 178 GVTTGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHE 237
              + +  AV+ + ++ G +  I GAG +GL+     +  GA  I++ + + +++K    
Sbjct: 175 LAVSWH--AVRISQLKAGQSALILGAGPIGLATVLALQGHGAGTIVVSEPSASRRKQAEA 232

Query: 238 FGATDFINPATDLQNGQTIVEKLIEMTDG--GLDFTFDCTG 276
            GA  F NP     +G   V++L ++  G  G DF++DC+G
Sbjct: 233 LGALTF-NP---FDHGDKAVDELRKIPPGSDGFDFSYDCSG 269

>SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]
           {ON} highly similar to gnl|GLV|KLLA0F00506g
           Kluyveromyces lactis KLLA0F00506g and similar to YAL060W
           uniprot|P39714 Saccharomyces cerevisiae YAL060W BDH1
           NAD- dependent (2R 3R)-2 3-butanediol dehydrogenase a
           zinc- containing medium-chain alcohol dehydrogenase
           produces 2 3- butanediol from acetoin during
           fermentation and allows using 2 3-butanediol as a carbon
           source during aerobic growth
          Length = 383

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 98/246 (39%), Gaps = 52/246 (21%)

Query: 63  FPSILGHEGAGIVESVGEGVT-SVKPGDHVVALYTAEC--------------GKCKFCKS 107
            P  +GHE +GIV  VG GV    K GDHVV   T  C                C  CK 
Sbjct: 67  LPQPMGHEMSGIVSKVGPGVKGDYKVGDHVVVEATCTCLDRYRWPKIESSKLPPCSACKR 126

Query: 108 GKTNLCGSVRATQGKGVMPDGTSRFKNKKGETLLHFMGCST----FSEYTXXXXXXXXXX 163
           G  N C                         T L F G       FSE            
Sbjct: 127 GIYNCC-------------------------THLGFCGLGAHGGGFSEKVVISEQHVIKI 161

Query: 164 XPKAPLESACLLGCGVTTGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQII 223
             + PL+ A L+     + +  AVK +N++ G +  + GAG +GL+     +  GA +I+
Sbjct: 162 PKEIPLDIAALVEPISVSWH--AVKISNLKPGQSALVLGAGPIGLATILALQGHGAGKIV 219

Query: 224 LVDINDAKKKYMHEFGATDFINPATDLQNGQTIVEKLIEMTDG--GLDFTFDCTGNVKVM 281
           + +    +++   + G   F NP    ++G+  VE+L ++  G  G DF+FDC+G     
Sbjct: 220 VSEPAQIRREQAAKLGVETF-NP---FEHGEKAVEELRKIPPGGDGFDFSFDCSGMKATF 275

Query: 282 RDALEA 287
              L A
Sbjct: 276 DTGLHA 281

>ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} similar
           to uniprot|Q07786 Saccharomyces cerevisiae YDL246C SOR2
           Protein of unknown function computational analysis of
           large-scale protein-protein interaction data suggests a
           possible role in fructose or mannose metabolism
          Length = 351

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 74/263 (28%), Positives = 110/263 (41%), Gaps = 40/263 (15%)

Query: 35  HEVRIRVKKTAVCHTDA-YTLSGADPEGAF----PSILGHEGAGIVESVGEGVTSVKPGD 89
           H V++ +K T +C +D  Y   GA   G F    P +LGHE +GIV  VG  VT+VK GD
Sbjct: 29  HYVKLHIKATGICGSDVHYYTQGAI--GQFVVKSPMVLGHESSGIVAEVGSAVTNVKVGD 86

Query: 90  HVVALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFKNKKGETLLHFMGCSTF 149
            V               SG  NLC  +          DGT                    
Sbjct: 87  RVAIEPGIPSRYSDETMSGNYNLCPHMVFAATPPY--DGT-------------------L 125

Query: 150 SEYTXXXXXXXXXXXPKAPLESACL---LGCGVTTGYGAAVKTANVQKGDTVAIFGAGTV 206
           ++Y                 E   L   +  GV      A K A  + G  V + GAG V
Sbjct: 126 TKYYLAPEDFVYKMPDHLSFEEGALAEPMSVGVH-----ANKLAGTRFGSKVLVSGAGPV 180

Query: 207 GLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFINPATDLQNGQTIVEKLIEMTDG 266
           GL     A+A GA++++ VDI + K +   +FGAT  ++ ++D +   + V K++    G
Sbjct: 181 GLLAGAVARAFGATEVVFVDIAEEKLERSKQFGATHTVSSSSDEERFVSEVSKVL---GG 237

Query: 267 GL-DFTFDCTGNVKVMRDALEAC 288
            L +   +C+G    +R  ++AC
Sbjct: 238 DLPNIVLECSGAQPAIRCGVKAC 260

>NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa]
           {ON} 
          Length = 439

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 91/238 (38%), Gaps = 38/238 (15%)

Query: 63  FPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGK--------------CKFCKSG 108
            P  +GHE AG +   G GVT  K GD VV   T  C                C  CK G
Sbjct: 106 LPQAMGHEIAGTIIECGPGVTKFKVGDRVVVEPTGTCKDRYRWPNSPNVDKEPCAACKKG 165

Query: 109 KTNLCGSVRATQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAP 168
             N+C ++    G GV   G                    F+E                 
Sbjct: 166 LYNICSNL-GLVGAGVQSGG--------------------FAERLVMNERQCYKVPDHMS 204

Query: 169 LESACLLGCGVTTGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDIN 228
           ++ A L+     + +  AV+ +  +KG +V I GAG +GL         G S++++ +  
Sbjct: 205 MDVAALIQPIAVSWH--AVRVSKFKKGASVLIVGAGPIGLGTILALNGHGVSEVVVSEPA 262

Query: 229 DAKKKYMHEFGATDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALE 286
             ++ +  + GA  +   A D       +  +    D G D+ FDC+GN   ++ A+E
Sbjct: 263 KIRRDFAEKMGAIVYDPSAKDHDESIKYLRSIAPGGD-GFDYAFDCSGNPATLKAAIE 319

>SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]
           {ON} similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 385

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 99/241 (41%), Gaps = 42/241 (17%)

Query: 63  FPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAEC--------------GKCKFCKSG 108
            P  +GHE AG+V  +G GV   + GDHVV   T+ C                C  CK G
Sbjct: 67  LPQAMGHEMAGVVSKIGPGVQGFEVGDHVVVEPTSTCLDRYRFPNSKHSGEEPCAACKRG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAP 168
             N+C  +    G GV   G                    FSE                P
Sbjct: 127 LYNICSHL-GLCGVGVQSGG--------------------FSERVVMNQKHVIKIPKHIP 165

Query: 169 LESACLLGCGVTTGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDIN 228
           L+ A L+     + +  A++ + +  G +  + G G +GL      +A GAS+I++ +  
Sbjct: 166 LDVAALVQPLAVSWH--AIRISGLTAGKSALVVGGGPIGLGTILALQAYGASKIVVSEPA 223

Query: 229 DAKKKYMHEFGATDFINPATDLQNGQTIVEKLIEMTDG--GLDFTFDCTGNVKVMRDALE 286
             +++     GA  F +P T+ +  +  VE L ++  G  G D++FDC+G     R ++ 
Sbjct: 224 KNRRELAKLMGAEVF-DP-TEWEEHEA-VEYLRKVAPGGDGFDYSFDCSGLPVTFRASVH 280

Query: 287 A 287
           A
Sbjct: 281 A 281

>KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2
           YAL061W
          Length = 385

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 71/310 (22%), Positives = 118/310 (38%), Gaps = 64/310 (20%)

Query: 11  LAAVAYEAGKPLSVEEITVDP--PKAHEVRIRVKKTAVCHTDAYT--------------- 53
           + A+AY A   +   +  V+P      E+ + +    +C TD +                
Sbjct: 1   MRALAYFAKGDIHFTKDLVEPKISTPDELILEINYCGICGTDLHEYIDGPIFFPEDGETN 60

Query: 54  -LSGADPEGAFPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGK----------- 101
            LSG+      P  +GHE AG V  +G  VT  K GDHVV      C             
Sbjct: 61  ELSGS----GLPQAMGHEIAGTVVKIGPKVTKFKVGDHVVVQPNGTCKDRYRWPHSPHVN 116

Query: 102 ---CKFCKSGKTNLCGSVRATQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXX 158
              C  CK G  N+C ++    G GV   G +                    E       
Sbjct: 117 KPWCSACKKGHYNVCSNL-GLIGNGVQSGGCA--------------------ERMCINES 155

Query: 159 XXXXXXPKAPLESACLLGCGVTTGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARG 218
                    P++ A L+     + +  A+K A  ++G +V + G G +GL      +  G
Sbjct: 156 HCFKVPKDMPMDIAALIQPIAVSWH--AIKVARFKRGGSVLVIGGGPIGLCTLLALQGHG 213

Query: 219 ASQIILVDINDAKKKYMHEFGATDFINPATDLQNGQTIVEKLIEMTDG--GLDFTFDCTG 276
            S I++ +    +++     GAT + +P+    N +  ++ L +M  G  G D+ FD +G
Sbjct: 214 CSDIVVSEPAKVRRELAERMGATTY-DPSQ--HNTEKNIQNLRKMILGGDGFDYVFDNSG 270

Query: 277 NVKVMRDALE 286
             + +  A+E
Sbjct: 271 TPETLETAIE 280

>YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative
           medium-chain alcohol dehydrogenase with similarity to
           BDH1; transcription induced by constitutively active
           PDR1 and PDR3
          Length = 417

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/269 (24%), Positives = 100/269 (37%), Gaps = 54/269 (20%)

Query: 36  EVRIRVKKTAVCHTDAYTLSGAD---PE---------GAFPSILGHEGAGIVESVGEGVT 83
           E+ I ++   +C TD +  +      PE            P  +GHE AG V  VG GV 
Sbjct: 28  ELVIDIEWCGICGTDLHEYTDGPIFFPEDGHTHEISHNPLPQAMGHEMAGTVLEVGPGVK 87

Query: 84  SVKPGDHVVALYTAECGK--------------CKFCKSGKTNLCGSVRATQGKGVMPDGT 129
           ++K GD VV   T  C                C  CK G  N+C S     G GV   G 
Sbjct: 88  NLKVGDKVVVEPTGTCRDRYRWPLSPNVDKEWCAACKKGYYNIC-SYLGLCGAGVQSGG- 145

Query: 130 SRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYGAAVKT 189
                              F+E                PL+ A L+       +  A++ 
Sbjct: 146 -------------------FAERVVMNESHCYKVPDFVPLDVAALIQPLAVCWH--AIRV 184

Query: 190 ANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFINPATD 249
              + G T  I GAG +GL       A G   I++ +    +++   + GA  + +P   
Sbjct: 185 CEFKAGSTALIIGAGPIGLGTILALNAAGCKDIVVSEPAKVRRELAEKMGARVY-DPTA- 242

Query: 250 LQNGQTIVEKLIEMTDG--GLDFTFDCTG 276
               +  ++ L  + DG  G D+TFDC+G
Sbjct: 243 -HAAKESIDYLRSIADGGDGFDYTFDCSG 270

>NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 71/277 (25%), Positives = 117/277 (42%), Gaps = 27/277 (9%)

Query: 28  TVDPPKAH---EVRIRVKKTAVCHTDAYTLSG----------ADPEG--AFPSILGHEGA 72
           T+  PK +   EV I V    +C TD +  +            +P      P  +GHE +
Sbjct: 17  TLPEPKINSPDEVLIEVSYCGICGTDLHEYTDGPIFFPKDGETNPLSNIPLPQPMGHEFS 76

Query: 73  GIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRF 132
           G V+++G  VT V+ GD VV    A CG CK       +     R         +G    
Sbjct: 77  GFVKAIGSNVTKVEVGDKVVV--EAGCG-CKDVHRWPDSKLYEKRKDTFCSACENGIDNC 133

Query: 133 KNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYGAAVKTANV 192
                 T L  +G   F+E              + P +   L+   ++  +  AV+ +  
Sbjct: 134 CENYDFTGLGVVG-GAFAERVVVGERHIVKLPEEVPTDVGALVE-PISVAW-HAVRVSKF 190

Query: 193 QKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFINPATDLQN 252
           +KG +  I GAG +GL+     KA GAS+I++ ++ + ++    + G   F +P+   ++
Sbjct: 191 EKGKSALILGAGPIGLAAILALKAHGASKIVVSELAERRRILASKMGVEVF-DPS---KH 246

Query: 253 GQTIVEKLIEMTDG--GLDFTFDCTGNVKVMRDALEA 287
           G   V +L  +  G  G D+ FDC+G       AL+A
Sbjct: 247 GDNAVTELRNIPRGQHGFDYAFDCSGVKATFNTALKA 283

>Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 85/228 (37%), Gaps = 38/228 (16%)

Query: 63  FPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGK--------------CKFCKSG 108
            P  +GHE AG V  VG GVT  K GD VV   T  C                C  CK G
Sbjct: 67  LPQAMGHEMAGTVAKVGPGVTQFKVGDKVVVEPTGTCRDRYRWPTSPNVDKEWCAACKRG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAP 168
             N+C S     G GV   G +         +++   C    E+               P
Sbjct: 127 LYNIC-SYLGLCGAGVQSGGFAE------RVVINESHCYKVPEFV--------------P 165

Query: 169 LESACLLGCGVTTGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDIN 228
           L+ A L+       +  A+   + + G T  I GAG +GL       A G S I + +  
Sbjct: 166 LDVAALIQPLAVCWH--AISVCDFKAGSTALIIGAGPIGLGTILALNAAGCSDIAVSEPA 223

Query: 229 DAKKKYMHEFGATDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTG 276
             +++   + GA  F +P            + +     G D+TFDC+G
Sbjct: 224 KVRRELAEKMGARVF-DPTAHAAKDSIDYLRSVAPGGDGYDYTFDCSG 270

>KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {ON}
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 77/261 (29%), Positives = 113/261 (43%), Gaps = 34/261 (13%)

Query: 34  AHEVRIRVKKTAVCHTDA-YTLSGADPEGAF--PSILGHEGAGIVESVGEGVTSVKPGDH 90
           +H V+I VKKT +C +D  Y   G+  E     P +LGHE +G+V  VG+ VT V+ GD 
Sbjct: 29  SHYVKIHVKKTGICGSDIHYYTHGSIGEFVVKKPMVLGHESSGVVVEVGKDVTLVQVGDR 88

Query: 91  VVALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGT-SRFKNKKGETLLHFMGCSTF 149
           V              KSG  NLC  +          DGT  ++     + L+      +F
Sbjct: 89  VAIEPGVPSRYSDETKSGHYNLCPHMAFAATPPY--DGTLVKYYLAPEDFLVKLPDHVSF 146

Query: 150 SEYTXXXXXXXXXXXPKAPLESACL--LGCGVTTGYGAAVKTANVQKGDTVAIFGAGTVG 207
                               E AC   L  GV      A + A    G  V +FGAG VG
Sbjct: 147 E-------------------EGACAEPLAVGV-----HANRLAETSFGKNVVVFGAGPVG 182

Query: 208 LSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFINPATDLQNGQTIVEKL-IEMTDG 266
           L     A A GAS ++ VD+ + K +   +FGAT+ IN +T  ++   + E +  E+   
Sbjct: 183 LVTGAVAAAFGASAVVYVDVFENKLERSKDFGATNTIN-STKYKSEDELTEVIKSELKGE 241

Query: 267 GLDFTFDCTGNVKVMRDALEA 287
             +   DC+G    +R A++ 
Sbjct: 242 QPEIAIDCSGAEICIRTAIKV 262

>KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3
           YAL060W
          Length = 381

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 68/229 (29%), Positives = 102/229 (44%), Gaps = 17/229 (7%)

Query: 62  AFPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQG 121
           + P  +GHE +GIV  VG+ VT VK GD VV   ++ C       +GK           G
Sbjct: 66  SLPLAMGHEMSGIVREVGKNVTKVKKGDKVVVEASSACSDVHRFATGK---------HYG 116

Query: 122 KGVMPDGTSRFKN---KKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCG 178
           +   P+    + N     G T L F+G   F+E              + PL+ A L+   
Sbjct: 117 EEKCPNCARGYDNCCAYAGFTGLGFIG-GGFAEQILVGEQHIVRIPDEIPLDVAALVEPL 175

Query: 179 VTTGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEF 238
             T + A  K     KG T  I G+G +GL++    KA GAS+I++ ++   ++K   + 
Sbjct: 176 SVTWHAA--KVGKFVKGSTALILGSGPIGLAMILVLKALGASKIVVSEVAQVRRKLAEKM 233

Query: 239 GATDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEA 287
               F +P+   +N    +  L E  D G DF FDC+G    M  A+ A
Sbjct: 234 KVEVF-DPSVHGKNTSNELRLLTENKD-GFDFAFDCSGLEVTMNTAIHA 280

>YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}
           ZTA1NADPH-dependent quinone reductase, GFP-tagged
           protein localizes to the cytoplasm and nucleus; has
           similarity to E. coli quinone oxidoreductase and to
           human zeta-crystallin
          Length = 334

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 72/257 (28%), Positives = 107/257 (41%), Gaps = 55/257 (21%)

Query: 22  LSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIVESVGEG 81
           +  E+  V      E+ I+ K T V + ++Y   G  P    P +LG E +G V + G+G
Sbjct: 23  IKYEDYPVPSISEEELLIKNKYTGVNYIESYFRKGIYPCEK-PYVLGREASGTVVAKGKG 81

Query: 82  VTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFKNKKGETLL 141
           VT+ + GD V     A      F +  K +  G V        +P GTS  + K      
Sbjct: 82  VTNFEVGDQV-----AYISNSTFAQYSKISSQGPVMK------LPKGTSDEELK------ 124

Query: 142 HFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYGAAVKTANVQKGDTVAIF 201
                                      L +A LL   V T      +  +V+KGD V +F
Sbjct: 125 ---------------------------LYAAGLLQ--VLTALSFTNEAYHVKKGDYVLLF 155

Query: 202 GA-GTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFINPATDLQNGQTIVEKL 260
            A G VGL + Q  K +GA   I V   D K K   E+GA   IN +      + I+ ++
Sbjct: 156 AAAGGVGLILNQLLKMKGA-HTIAVASTDEKLKIAKEYGAEYLINASK-----EDILRQV 209

Query: 261 IEMTDG-GLDFTFDCTG 276
           ++ T+G G+D +FD  G
Sbjct: 210 LKFTNGKGVDASFDSVG 226

>KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 98/233 (42%), Gaps = 21/233 (9%)

Query: 62  AFPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAEC---GKCKFCKSGKTNLCGSVRA 118
           + P  +GHE +G V  VG  VT VK GD VV   T  C    +    K  KT  C + + 
Sbjct: 66  SIPQAMGHEFSGYVAKVGPKVTKVKVGDRVVVEATCSCVDLHRWPESKHYKTPACNACK- 124

Query: 119 TQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCG 178
                   D         G   L  +G   F+E                P++ A L+   
Sbjct: 125 --------DRCDNCCEYAGFMGLGVVG-GAFAERIVTIEHHVVKLPDGFPMDVAALIE-P 174

Query: 179 VTTGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEF 238
           ++  + AA + +    G +  + GAG +GL++    KA+GAS+II+ +    +++     
Sbjct: 175 LSVAWHAA-RVSKFPPGKSALVLGAGPIGLAMILVLKAQGASKIIVSEPATMRRELADRM 233

Query: 239 GATDFINPATDLQNGQTIVEKLIEMT-DG-GLDFTFDCTGNVKVMRDALEACH 289
               F +P+T   +G   V  L   T DG G DF FDC+G        L+A H
Sbjct: 234 HVETF-DPST---HGDKSVAMLRSKTFDGKGFDFAFDCSGVPATFNTGLQAAH 282

>Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 85/230 (36%), Gaps = 42/230 (18%)

Query: 63  FPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGK--------------CKFCKSG 108
            P  +GHE AG V  VG GV  +K GD VV   T  C                C  CK G
Sbjct: 67  LPQAMGHEMAGTVLEVGPGVAHLKVGDKVVVEPTGTCRDRYRWPESPNVDKEWCAACKKG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAP 168
             N+C S     G GV   G                    F+E                P
Sbjct: 127 YYNIC-SYLGLCGAGVQSGG--------------------FAERVVMNESHCYKVPDFVP 165

Query: 169 LESACLLGCGVTTGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDIN 228
           L+ A L+       +  A+     + G T  I GAG +GL       A G   I++ +  
Sbjct: 166 LDVAALIQPLAVCWH--AISVCEFKAGSTALIIGAGPIGLGTILALNAAGCRDIVVSEPA 223

Query: 229 DAKKKYMHEFGATDFINPATDLQNGQTIVEKLIEMTDG--GLDFTFDCTG 276
             +++   + GA  + +P       +  ++ L  + +G  G D+TFDC+G
Sbjct: 224 KLRRELAEKMGARVY-DPTE--HAARESIDYLRSVAEGGDGFDYTFDCSG 270

>Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 85/230 (36%), Gaps = 42/230 (18%)

Query: 63  FPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGK--------------CKFCKSG 108
            P  +GHE AG V  VG GV  +K GD VV   T  C                C  CK G
Sbjct: 67  LPQAMGHEMAGTVLEVGPGVAHLKVGDKVVVEPTGTCRDRYRWPNSPNVSKEWCAACKKG 126

Query: 109 KTNLCGSVRATQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAP 168
             N+C S     G GV   G                    F+E                P
Sbjct: 127 YYNIC-SYLGLCGAGVQSGG--------------------FAERVVMNESHCYKVPDFVP 165

Query: 169 LESACLLGCGVTTGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDIN 228
           L+ A L+       +  A+     + G T  I GAG +GL       A G   I++ +  
Sbjct: 166 LDVAALIQPLAVCWH--AISVCEFKAGSTALIIGAGPIGLGTILALDAAGCKDIVVSEPA 223

Query: 229 DAKKKYMHEFGATDFINPATDLQNGQTIVEKLIEMTDG--GLDFTFDCTG 276
             +++   + GA  + +P       +  ++ L  + +G  G D+TFDC+G
Sbjct: 224 KLRRELAEKMGARVY-DPTE--HAAKESIDYLRSIAEGGDGFDYTFDCSG 270

>KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON}
           similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 381

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 115/295 (38%), Gaps = 57/295 (19%)

Query: 11  LAAVAYEAGKPLSVEEITVDPP-----KAHEVRIRVKKTAVCHTDAYTL---------SG 56
           + A+AY   + +     T D P     K  +V I +    +C TD + L          G
Sbjct: 1   MRALAYFGTRDI---RFTTDLPEPVIEKPDDVLIDIVWCGICGTDLHELLDGPNFFPKDG 57

Query: 57  ADPEGA---FPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGK----------CK 103
              E +    P  +GHE AG+V  VG  VT  +PGDHVV   T  C            CK
Sbjct: 58  ETHEISGRGLPQAMGHEMAGVVSQVGSSVTKFQPGDHVVVEPTGTCQDRERYNTKGETCK 117

Query: 104 FCKSGKTNLCGSVRATQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXX 163
            CK G  N+C  +    G GV   G                    F+E            
Sbjct: 118 ACKRGMHNVCVHL-GLCGCGVQSGG--------------------FAEKVVIGEKHCFKV 156

Query: 164 XPKAPLESACLLGCGVTTGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQII 223
               PL+ A L+       +  AVK   V++G +  I G G +GL +    +  G + I+
Sbjct: 157 PSWIPLDVAALIQPLAVCWH--AVKLGAVKEGQSALILGGGPIGLGIIMALQHFGCTDIV 214

Query: 224 LVDINDAKKKYMHEFGATDFINPATDLQNGQTIVEKLIEMTDG--GLDFTFDCTG 276
           + +    ++    + GA   ++   D +  +  ++ L  ++    G DFTFDC+G
Sbjct: 215 VSEPAKIRRDLAEKMGA--IVSNPMDFKTNEENIKNLCSLSPNGEGYDFTFDCSG 267

>NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa]
           {ON} 
          Length = 386

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 99/229 (43%), Gaps = 15/229 (6%)

Query: 63  FPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQGK 122
            P  +GHE  G V+++G  VT V  GD VV    A CG     +  ++++ G  + T  +
Sbjct: 67  LPQPMGHEFCGFVKAIGNKVTKVAVGDKVVV--EAGCGCKDVHRWPQSHVYGKEQCTACR 124

Query: 123 GVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTG 182
                G        G T L  +G   F+E              + P +   L+       
Sbjct: 125 ----KGFDNCCTHAGFTGLGVVG-GAFAEQVVVGERHVVKLPEEVPTDVGALVEPLSVAW 179

Query: 183 YGAAVKTANVQKGD--TVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGA 240
           +  AVK A  +KG      + GAG +GL+     KA GAS+I++ ++   +++   + G 
Sbjct: 180 H--AVKVAGFEKGSGKNALVLGAGPIGLATILALKAHGASKIVVSELAAIRRELALKMGV 237

Query: 241 TDFINPATDLQNGQTIVEKLIEMTD--GGLDFTFDCTGNVKVMRDALEA 287
             F +P+      Q I +KL E+ +   G DF FDC+G       AL +
Sbjct: 238 EVF-DPSKHGDEKQGI-KKLREIPEDHDGFDFAFDCSGVETTFNTALHS 284

>TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {ON}
           Anc_7.3 YAL060W
          Length = 392

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 77/282 (27%), Positives = 108/282 (38%), Gaps = 56/282 (19%)

Query: 36  EVRIRVKKTAVCHTD--AYTLSGA---DPEGA--------FPSILGHEGAGIVESVGEGV 82
           E+ I V    +C TD   YT  GA    P+G          P  +GHE +G+VE VG+G 
Sbjct: 28  ELIIAVSYCGICGTDLKEYT-EGAIFFPPDGGHNEISGNGLPQAMGHEISGVVEKVGKGC 86

Query: 83  TSVKPGDHVVALYTAECGK--------------CKFCKSGKTNLCGSVRATQGKGVMPDG 128
            + K GDHVV   T  C                C  C  G TN+C  + A  G G+   G
Sbjct: 87  KTFKVGDHVVVEPTGTCKDRYRWPESQNANKPMCSACSIGMTNICAHL-ALCGAGLESGG 145

Query: 129 TSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYGAAVK 188
                               F+E                PL+   L+       +  AVK
Sbjct: 146 --------------------FAERLVINEAHVHKIPDHMPLDIGALIQPISVCWH--AVK 183

Query: 189 TANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFINPAT 248
            A+ +KG +  I G G +GL      K  G   I+L +    +++Y  + GA  +     
Sbjct: 184 VAHYKKGGSALIIGGGPIGLGTILALKGFGCEYIVLSEPATIRREYAGKMGAKVYDPTGV 243

Query: 249 DLQNGQTIVEKLIEM--TDGGLDFTFDCTGNVKVMRDALEAC 288
                   V+ L EM     G D+TFDC+G    +  A+E C
Sbjct: 244 PFDES---VKTLREMGPNGDGFDYTFDCSGLPITLNAAIECC 282

>KAFR0C00580 Chr3 (113544..114548) [1005 bp, 334 aa] {ON} Anc_3.253
           YBR046C
          Length = 334

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 66/246 (26%), Positives = 93/246 (37%), Gaps = 61/246 (24%)

Query: 36  EVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIVESVGEGVTSVKPGDHVVALY 95
           EV I+ + T V + ++Y   G  P    P +LG E  G V ++G+ V  +K GD V   Y
Sbjct: 37  EVIIKNRYTGVNYIESYFRKGIYP-AELPYVLGREAVGTVVAIGKSVRDLKVGDKVS--Y 93

Query: 96  TAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXX 155
            A     +F K   +              +PD TS                         
Sbjct: 94  IAGATFAQFTKVPNSTHVFK---------LPDTTST------------------------ 120

Query: 156 XXXXXXXXXPKAPLESACLLGCGVTTGYGAAV---KTANVQKGDTVAIFGA-GTVGLSVA 211
                         E   L   G+  G  A     +  +V+KGD V ++ A G VGL   
Sbjct: 121 --------------EQLKLYAAGMIQGLTALTFVNEAYDVKKGDYVLLYAAAGGVGLIFN 166

Query: 212 QGAKARGASQIILVDINDAKKKYMHEFGATDFINPATDLQNGQTIVEKLIEMTDG-GLDF 270
           Q  + RGA  I +   N+ K     E GA   IN   D      I+EK+ ++T G G+D 
Sbjct: 167 QLLRMRGAHTIAVASTNE-KLSLAKENGAEFLINSKED-----NILEKVQQITKGNGVDV 220

Query: 271 TFDCTG 276
            FD  G
Sbjct: 221 AFDSVG 226

>KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C
          Length = 353

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 92/238 (38%), Gaps = 19/238 (7%)

Query: 143 FMGCSTFSEYTXXXXXXXXXXXPK-APLESACLLGCGVTTGYGAAV---KTANVQKGDTV 198
           ++  STF+++T           PK    E   ++   +  G        +  NVQKGD +
Sbjct: 112 YLSASTFAQFTKYPQNGHLIKLPKDISAEKEKIIAGSLVQGLTPLTFIDEAYNVQKGDFI 171

Query: 199 AIFGA-GTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFINPATDLQNGQTIV 257
            ++ A G VGL   Q  KARGA + I V   D K +   E+GA   IN   D      IV
Sbjct: 172 LVYAAAGGVGLIFDQLLKARGA-RTIAVASTDEKLQLAKEYGAEFLINSTKD-----DIV 225

Query: 258 EKLIEMTDG-GLDFTFDCTGNVKVMRDALEACHKXXXXXXXXXXXXXXQEISTRPFQLVT 316
           EK+ E T+G G+   FD  G        L+   +                 S        
Sbjct: 226 EKVKEFTNGEGVAAAFDSIGK-DTFETTLQVVKRKGTIVSFGNASGAVPPFSINRLSPKN 284

Query: 317 GRVWKGSAFGGIKGRSEM----GGLIKDYQGGALKVDEFITNRRPFKQINEAFEDLHA 370
            ++ +   F  +   SE       LI+    G LK+   I+   P K   EA EDL +
Sbjct: 285 LKLVRPQLFAYVADPSEWEHYSSELIRLIDSGELKIT--ISKVYPLKDYKEATEDLES 340

>KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 86/211 (40%), Gaps = 19/211 (9%)

Query: 36  EVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIVESVGEGVTS-VKPGDHV-VA 93
           ++ ++++   VC +D +  SG   + A P I+GHE  G V  VG   TS VK GD V + 
Sbjct: 35  DIDVKIECCGVCGSDVHCASGHWGDIAKPLIVGHEIVGHVVKVGPNCTSGVKVGDRVGLG 94

Query: 94  LYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYT 153
                C KCK C +G  + C            P+    +     +  +   G   +++Y 
Sbjct: 95  AQALSCMKCKRCLNGNESYC------------PNAIQTYSTPYEDGYVSKGG---YADYV 139

Query: 154 XXXXXXXXXXXPKAPLESACLLGCGVTTGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQG 213
                         P   A  L CG  T +   ++      G  VAI G G +G      
Sbjct: 140 RVHEQFTVPIPENIPSHLAAPLMCGGLTVFSPLLRNG-CGPGKKVAILGIGGIGHMGVLL 198

Query: 214 AKARGASQIILVDINDAKKKYMHEFGATDFI 244
           AKA GA ++  +    +KK+   + GA  FI
Sbjct: 199 AKAMGA-EVYAISRTSSKKEDAMKLGADHFI 228

>Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318C
           (ADH6) - NADPH-dependent alcohol dehydrogenase [contig
           207] FULL
          Length = 373

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 86/380 (22%), Positives = 138/380 (36%), Gaps = 67/380 (17%)

Query: 20  KPLSVEEITVDPPKA---HEVRIRVKKTAVCHTDAYTLS---GADPEGAFPS-------I 66
           K  +  ++T   PKA   H+V I V+   +C ++ + L    G  P     S       +
Sbjct: 16  KDWATPKLTSFEPKAFGPHDVDIEVECCGICASELFALKNEWGHAPLACLSSKYGPKTQV 75

Query: 67  LGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGVM 125
           +GHE  G V +VG  V+    GD V +    + C +C  C SG    C +  +T  K   
Sbjct: 76  VGHEVVGKVVAVGPQVSLCNVGDRVGLGAQASACMQCSRCNSGNEQYCPNAISTYCKP-Y 134

Query: 126 PDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYGA 185
           PDG              ++    ++ +            P+ P E    L CG  T +  
Sbjct: 135 PDG--------------YVSQGGYASHVRAHEQFCFPIPPEIPSELVAPLQCGGLTVFSP 180

Query: 186 AVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFIN 245
             +    +    VA+ G G +G      A+A GA ++       +K+    + GA  F+ 
Sbjct: 181 IKRNLQGKHDPKVAVIGIGGLGHMAIMIARALGA-EVYAFSRGHSKRDDALKMGAHHFVA 239

Query: 246 PATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNV-----KVMRDALEACHKXXXXXXXXXX 300
                 N              GLD TFD   N       +  +A+  C K          
Sbjct: 240 TGDADWN-------------AGLDDTFDLILNCASSTSSLDLNAMLPCLKVNCNFVSVGL 286

Query: 301 XXXXQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQ 360
               +E+S +PF         GS+   +  RSE   L++      L V+    N RP+ +
Sbjct: 287 PHIDEELSVKPFSFFKNGCNIGSS--KLGSRSEAIELMQ------LAVEH---NFRPWVE 335

Query: 361 --------INEAFEDLHAGD 372
                   ++E    L+ GD
Sbjct: 336 TIKVSEAGVSEGLTRLNKGD 355

>NDAI0A06320 Chr1 (1438393..1439442) [1050 bp, 349 aa] {ON}
           Anc_3.253
          Length = 349

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 67/266 (25%), Positives = 102/266 (38%), Gaps = 64/266 (24%)

Query: 16  YEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIV 75
           Y+  K   +   T+  P  +++ I+ K   V + ++Y   G  P  A P+ILG E +G+V
Sbjct: 35  YDVIKYKDIATPTIQTP--NDIIIKNKYAGVNYIESYFRKGIYP-CALPAILGREASGVV 91

Query: 76  ESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFKNK 135
              G  + + + GD V   Y   C   +F K   + +           +  D T+     
Sbjct: 92  VDKGTNIKNFEIGDKVA--YIGNCSMAQFTKIDNSMIM---------KLSSDSTN----- 135

Query: 136 KGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYGA---AVKTANV 192
                                             E   L   G+  G  A     +   V
Sbjct: 136 ----------------------------------EDLKLYAAGILQGLTALSFVTEAYEV 161

Query: 193 QKGDTVAIF-GAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFINPATDLQ 251
           +KGD + ++  AG  GL   Q  KARGA  +I V  +D K +   E GA   IN  TD  
Sbjct: 162 KKGDYILVYAAAGGAGLIFDQLIKARGA-HVIAVCSSDEKLQLAKENGAEYLINSKTD-- 218

Query: 252 NGQTIVEKLIEMTDG-GLDFTFDCTG 276
               I+ K++E+TD  G+   FD  G
Sbjct: 219 ---DILTKVMEITDNKGVQAAFDSVG 241

>NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 93/357 (26%), Positives = 136/357 (38%), Gaps = 43/357 (12%)

Query: 25  EEITVDPPKA--HEVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIVESVGEGV 82
           +++  DP K   H++ I+V+   VC +D +  SG   +   P ++GHE  G V  +GE  
Sbjct: 24  KKVQFDPRKLYDHDIEIKVECCGVCGSDIHAASGNWGDLTKPLVVGHEIIGTVVRLGENC 83

Query: 83  TS-VKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFKNKKGETL 140
            S +K GD V V      C  C+ CK+     C     T G+   PDG   + +K G   
Sbjct: 84  NSGLKLGDRVGVGAQVFSCLDCERCKNDNEPYCEGFVTTYGQD-YPDG---YSSKGG--- 136

Query: 141 LHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYGAAVKT--ANVQKGDTV 198
                   +++Y               P   A  L CG  T Y   V+      +K   V
Sbjct: 137 --------YADYFRVHEHFAVPIPENIPSHLAAPLMCGGLTVYSPLVRNGCGPNKKVGIV 188

Query: 199 AIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFINPATDLQNGQTIVE 258
            I G G  GL     AKA GA ++  +    AKK+   + GA  FI    +   G    +
Sbjct: 189 GIGGIGHQGLLF---AKAMGA-EVYAISRTSAKKEDAMKLGADHFIATKEEPDWGTKYFD 244

Query: 259 KLIEMTDGGLDFTFDCTGNV-KVMRDALEACHKXXXXXXXXXXXXXXQEISTRPFQLVTG 317
                     D    C  ++  V  + +    K              + +S +PF L  G
Sbjct: 245 T--------FDLIVVCASSLTDVDFNTVPNTMKIGGSIVSISVPEQNETLSLKPFGL-KG 295

Query: 318 RVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPF--KQINEAFEDLHAGD 372
                SA G I   SEM  L+K      +K+        P   K + EAFE +  GD
Sbjct: 296 VSISNSALGSI---SEMRDLLKLVSENNIKL---WVETIPIGEKGVKEAFERMDKGD 346

>TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.253
           YBR046C
          Length = 335

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 61/251 (24%), Positives = 95/251 (37%), Gaps = 69/251 (27%)

Query: 35  HEVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIVESVGEGVTSVKPGDHVVAL 94
           +E+ I+ K   +   +AY   G  P    P ILG E  G+V + G+ V +   GD V   
Sbjct: 37  NELLIKNKYAGINFIEAYFRKGIYPV-QLPQILGREATGVVVAKGQSVKNFDIGDKVA-- 93

Query: 95  YTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTX 154
                                                           +M  STF++YT 
Sbjct: 94  ------------------------------------------------YMSSSTFAQYTK 105

Query: 155 XXXXXXXXXXPKAPLE-------SACLLGCGVTTGYGAAVKTANVQKGDTVAIFGA-GTV 206
                     P    +       +A + G    T    A K   V++GD + ++ A G V
Sbjct: 106 YSSSGLISKLPSETTDDQLKVYAAALIQGLTALTFLDEAYK---VKEGDYILLYAAAGGV 162

Query: 207 GLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFINPATDLQNGQTIVEKLIEMT-D 265
           GL + Q  K RGA  I +V   + K++   +FGA   IN      + + I+++ +E+T D
Sbjct: 163 GLLMDQLLKERGAHAIAVVS-TEEKEELAKKFGAEYVIN-----SSKEDILKRALEITND 216

Query: 266 GGLDFTFDCTG 276
            G+D  FD  G
Sbjct: 217 KGVDAVFDSVG 227

>NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {ON} 
          Length = 399

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 62/277 (22%), Positives = 106/277 (38%), Gaps = 50/277 (18%)

Query: 36  EVRIRVKKTAVCHTDAYTLSGAD---PEGA---------FPSILGHEGAGIVESVGEGVT 83
           E+ I +    +C TD +         PE            P  +GHE AGIV  +G  V 
Sbjct: 28  ELIIDISWCGICGTDLHEFQDGPIFFPENGCCHEISGEGLPQAMGHEIAGIVSEIGPKVK 87

Query: 84  SVKPGDHVVALYTAECG--------------KCKFCKSGKTNLCGSVRATQGKGVMPDGT 129
             + GD VV   T  C               +C  CK G  N+C ++    G GV   G 
Sbjct: 88  KFQVGDRVVVEPTGTCKDRYRWPDAPNANQEECAACKKGLYNICSNL-GLVGCGVQSGGF 146

Query: 130 SRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYGAAVKT 189
           +         +++   C    E+                ++ A L+     + +  AV+ 
Sbjct: 147 AE------RMVMNEAKCYKIPEHLT--------------MDVAALIQPIAVSWH--AVRV 184

Query: 190 ANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFINPATD 249
           +  + G +V I G G +GL         G +++++ +    ++    + GA  + +P T 
Sbjct: 185 SKFKPGSSVLIIGGGPIGLGTILALNGHGVTEVVVSEPAKIRRDLAEKMGAVVY-DPMTR 243

Query: 250 LQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALE 286
             +      + I     G D+TFDC+GN   ++ A+E
Sbjct: 244 DHDESIKYLRSIAPGGDGFDYTFDCSGNPATLKAAIE 280

>Smik_2.170 Chr2 complement(312211..313215) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 64/263 (24%), Positives = 103/263 (39%), Gaps = 67/263 (25%)

Query: 22  LSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIVESVGEG 81
           +  E+  V      ++ I+ K T V + ++Y   G  P    P ILG E AG + + G+ 
Sbjct: 23  IKYEDYPVPSISGKDLLIKNKYTGVNYIESYFRKGLYPCEK-PYILGREAAGTIVAKGKD 81

Query: 82  VTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFKNKKGETLL 141
           VT+ + GD V                                                  
Sbjct: 82  VTNFEIGDKVA------------------------------------------------- 92

Query: 142 HFMGCSTFSEYTXXXXXXXXXXXPK------APLESACLLGCGVTTGYGAAVKTANVQKG 195
            ++  STF++YT            K        L +A LL     T      +  +V+KG
Sbjct: 93  -YISNSTFAQYTKFPSEGTVMKLSKETNDEELKLYAAGLLQA--LTALSFTNEAYHVRKG 149

Query: 196 DTVAIF-GAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFINPATDLQNGQ 254
           D + +F  AG VGL + Q  + +GA  I +    D K +   E+GA   IN +      +
Sbjct: 150 DYILLFAAAGGVGLILNQLLRMKGAHAIAVAS-TDEKLEIAKEYGAEYLINSSK-----E 203

Query: 255 TIVEKLIEMTDG-GLDFTFDCTG 276
            I++K++E+T+G G+D +FD  G
Sbjct: 204 DILKKVLEITNGEGVDASFDSVG 226

>KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 68/280 (24%), Positives = 105/280 (37%), Gaps = 56/280 (20%)

Query: 36  EVRIRVKKTAVCHTDAYTLSGA------DPE------GAFPSILGHEGAGIVESVGEGVT 83
           E+ + +    +C TD + L+        D E         P  +GHE AGIV +VG GV 
Sbjct: 28  ELLVDIVYCGICGTDLHELTDGPIFFPLDNERNEISGNGLPQAMGHEMAGIVTAVGSGVK 87

Query: 84  SVKPGDHVVALYTAECGK--------------CKFCKSGKTNLCGSVRATQGKGVMPDGT 129
             + GDHV    T  C                C  C+ G  N C  +    G GV   G 
Sbjct: 88  KFQVGDHVAIEPTGTCRDRYRWPDAPDAKKPVCTSCQRGMYNCCDYL-GLIGNGVQSGG- 145

Query: 130 SRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYGAAVKT 189
                              F+E                P E A L+       +  A+  
Sbjct: 146 -------------------FAERIVVNESHCYKCPDNLPWEVAALIQPIAVCWH--AINI 184

Query: 190 ANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFINPATD 249
           A  + G +V I G G +GL         G ++II+ +    ++ Y  + GA  + +P   
Sbjct: 185 AQFKPGSSVLILGGGPIGLGTILALNGHGCTEIIVSEPVKLRRDYAEKMGAVVY-DP--- 240

Query: 250 LQ-NGQTIVEKLIEMTDG--GLDFTFDCTGNVKVMRDALE 286
           LQ + +  +  L +M  G  G D+ FDC+G    ++ ++E
Sbjct: 241 LQCSHEQSIPNLRKMAPGADGFDYCFDCSGTPATLKASIE 280

>KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa]
           {ON} 
          Length = 360

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 64/247 (25%), Positives = 96/247 (38%), Gaps = 27/247 (10%)

Query: 35  HEVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIVESVGEGVTS-VKPGDHV-V 92
           +++ I+++   VC +D +  SG   +   P ++GHE  G V  VG   TS +K GD V V
Sbjct: 34  NDIDIKIEACGVCGSDVHMASGNWGDVKKPLVVGHEIVGTVVKVGSKCTSGMKVGDRVGV 93

Query: 93  ALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEY 152
                 C  C  C +     C +V  T G    PDG              + G   ++ Y
Sbjct: 94  GAQVHSCLTCDRCNNDNEQYCPNVVFTYGFD-YPDG--------------YNGKGGYANY 138

Query: 153 TXXXXXXXXXXXPKAPLESACLLGCGVTTGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQ 212
                          P   A  L CG  T Y   ++      G  V I G G +G     
Sbjct: 139 IRVHEHFAVPIPENIPTHLAAPLLCGGITVYSPLLRNG-CGPGKKVGILGIGGIGHMGII 197

Query: 213 GAKARGASQIILVDINDAKKKYMHEFGATDFINPATDLQNGQTIVEKLIEMTDGGLDFTF 272
            AK+ GA ++  +  +DAKK+   + GA  FI    +   G+   +         LD   
Sbjct: 198 FAKSMGA-EVYAISRSDAKKEDAFKLGADHFIATKDEPDWGKKYFDT--------LDLIV 248

Query: 273 DCTGNVK 279
            C G++K
Sbjct: 249 ICAGSLK 255

>NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {ON} 
          Length = 363

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 86/353 (24%), Positives = 132/353 (37%), Gaps = 39/353 (11%)

Query: 35  HEVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIVESVGEGVTSVKPGDHV-VA 93
           ++V ++++   VC +D +T SG   E   P ++GHE  G V  +G     +K GD V + 
Sbjct: 38  YDVEVKIECCGVCGSDIHTASGHWGETKKPLVVGHEIIGTVTQIGSQCNELKVGDRVGIG 97

Query: 94  LYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYT 153
                C +C  CKS     C     T  K    D T  + +K G           +++Y 
Sbjct: 98  AQVFSCLECDRCKSDNEPYCPKTVNTYRK----DYTDGYNSKGG-----------YADYI 142

Query: 154 XXXXXXXXXXXPKAPLESACLLGCGVTTGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQG 213
                         P   A  L CG  T +   ++      G  V I G G +G      
Sbjct: 143 RLHEHFAVPIPENIPSHLAAPLMCGGVTAFSPLLRNG-CGPGKKVGIMGIGGIGHMGLIF 201

Query: 214 AKARGASQIILVDINDAKKKYMHEFGATDFI--NPATDLQNGQTIVEKLIEMTDGGL-DF 270
           AKA GA +   +  + AKK+   + GA  FI      D          LI +    L D 
Sbjct: 202 AKAMGA-ETFAISRSSAKKEDAIKMGADHFIATKEEPDWATKYFDTFDLIVVCSNSLTDI 260

Query: 271 TFDCTGN-VKVMRDALEACHKXXXXXXXXXXXXXXQEISTRPFQLVTGRVWKGSAFGGIK 329
            F+     +KV    +  C                + ++ +PF L+ G     SA GGI 
Sbjct: 261 DFNVVPRTMKVGGKIVSIC-----------VPEQHEVMNLKPFGLI-GVSISNSALGGIN 308

Query: 330 GRSEMGGLIKDYQGGALKVDEFITNRRPFKQINEAFEDLHAGDSLRTVLNYTD 382
              +M  L+   +   + V+    +    K + E FE +  GD +R     TD
Sbjct: 309 EIKQMLDLVSK-KNLKIWVETIPISE---KGVKEVFERMEKGD-VRYRFTLTD 356

>KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} similar
           to uniprot|P25377 Saccharomyces cerevisiae YCR105W ADH7
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis
          Length = 374

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 68/295 (23%), Positives = 105/295 (35%), Gaps = 45/295 (15%)

Query: 36  EVRIRVKKTAVCHTDAYTLSG---ADPEGAFPS-------ILGHEGAGIVESVGEGVTSV 85
           +V I V+   +C ++ + L      +P     S       ++GHE  G V +VG  V+  
Sbjct: 35  DVDIEVECCGICASELFALKNDWTHEPLACLSSKYGPKTQVVGHEVVGKVVAVGPEVSLC 94

Query: 86  KPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFKNKKGETLLHFM 144
           K GD V +    + C +C  C+S     C     T      PDG              ++
Sbjct: 95  KVGDRVGLGAQASACMQCSRCQSSNEQYCAQSIGTYCNP-YPDG--------------YV 139

Query: 145 GCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYGAAVKTANVQKGDTVAIFGAG 204
               ++ +            P+ P E    L CG  T +    +    +K   VAI G G
Sbjct: 140 SQGGYASHVRAHEQFCFPIPPEIPSELVAPLQCGGLTVFSPIKRNIQGKKNPRVAIIGIG 199

Query: 205 TVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFINPATDLQNGQTIVEKLIEMT 264
            +G      +KA GA ++  V    +K+    + GA  FI  AT   N            
Sbjct: 200 GLGHMAIMISKALGA-EVSAVSRGYSKRDDALKMGADHFI--ATSEPN-----------W 245

Query: 265 DGGLDFTFDCTGNV-----KVMRDALEACHKXXXXXXXXXXXXXXQEISTRPFQL 314
           + GLD TFD   N       +  +AL  C K              ++   +PF  
Sbjct: 246 NAGLDDTFDLILNCASSTSSLDLNALLPCLKVNCNFVSVGLPHIDEDFKVKPFSF 300

>SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 376

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 69/308 (22%), Positives = 106/308 (34%), Gaps = 45/308 (14%)

Query: 33  KAHEVRIRVKKTAVCHTDAYTLSGA---DPEGAFPS-------ILGHEGAGIVESVGEGV 82
           +AH+V I V+   +C ++ ++L      +P     S       ++GHE  G V +VG  V
Sbjct: 34  EAHDVDIEVECCGICASELFSLKNEWKHEPLACLSSSYGPKSQVVGHEVVGKVVAVGSNV 93

Query: 83  TSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFKNKKGETLL 141
           T    GD V +      C KC  C SG    C     T          SR+ +       
Sbjct: 94  TLCNIGDRVGLGAQAFSCMKCSRCNSGNEQYCPQAVGTY--------CSRYADG------ 139

Query: 142 HFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYGAAVKTANVQKGDTVAIF 201
            ++    ++ +               P E    L CG  T Y    +     K   VAI 
Sbjct: 140 -YISQGGYASHVRAHEQFCFPIPDDIPSELVAPLQCGGLTVYSPIKRNIEGVKDPKVAII 198

Query: 202 GAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFINPATDLQNGQTIVEKLI 261
           G G +G      +KA GA ++       +KK+   + GA  FI                 
Sbjct: 199 GIGGLGHMAIMISKALGA-EVTAFSRGYSKKEDALKMGAHHFIATGE------------- 244

Query: 262 EMTDGGLDFTFDCTGNVKVMRDALE-----ACHKXXXXXXXXXXXXXXQEISTRPFQLVT 316
           E  + GL+ TFD   N      +L+      C K              ++   +PF   +
Sbjct: 245 EGWESGLNDTFDLILNCASSTTSLDLNKLLPCLKINRNFISVGLPHVDEDFKVKPFSFFS 304

Query: 317 GRVWKGSA 324
                GS+
Sbjct: 305 NGCCIGSS 312

>Skud_2.162 Chr2 complement(299642..300646) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 101/243 (41%), Gaps = 55/243 (22%)

Query: 36  EVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIVESVGEGVTSVKPGDHVVALY 95
           ++ I+ K T V + ++Y   G  P    P +LG E  G++ + G+ VT+ + GD V    
Sbjct: 37  DILIKNKYTGVNYIESYFRKGLYPCEK-PYVLGREATGVIVAKGKDVTNFETGDQV---- 91

Query: 96  TAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXX 155
            A      F +  K    G++        +P GTS  K K                    
Sbjct: 92  -AYISNSTFAQYTKFPSEGTIMK------LPSGTSDEKMK-------------------- 124

Query: 156 XXXXXXXXXPKAPLESACLLGCGVTTGYGAAVKTANVQKGDTVAIF-GAGTVGLSVAQGA 214
                        L +A LL     T      +  +V+KGD + ++  AG VGL + Q  
Sbjct: 125 -------------LYAAGLLQA--LTALSFTNEAYHVKKGDYILVYAAAGGVGLILNQLL 169

Query: 215 KARGASQIILVDINDAKKKYMHEFGATDFINPATDLQNGQTIVEKLIEMTDG-GLDFTFD 273
           + + A  I +    + K +   ++GA   I+      + + I+ +++E+TDG G+D +FD
Sbjct: 170 RMKDAHAIAVASTYE-KLETAKDYGAEFLID-----SSKEDILTRVLEITDGKGVDASFD 223

Query: 274 CTG 276
             G
Sbjct: 224 SVG 226

>NCAS0D01220 Chr4 (223821..224909) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 48/96 (50%), Gaps = 3/96 (3%)

Query: 35  HEVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIVESVGEGVTS-VKPGDHV-V 92
           H+++I+V+   VC +D +  SG       P ++GHE  G V  VG+   + +K GD V V
Sbjct: 34  HDIQIKVECCGVCGSDIHAASGHWGNIPTPLVVGHEIVGRVVKVGDRCDNGLKVGDRVGV 93

Query: 93  ALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDG 128
                 C +C  CK+   + C    AT G G  PDG
Sbjct: 94  GAQVFSCLECNRCKTDNESYCPKWVATYG-GEYPDG 128

>NDAI0G04880 Chr7 complement(1175518..1176603) [1086 bp, 361 aa]
           {ON} 
          Length = 361

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 100/392 (25%), Positives = 151/392 (38%), Gaps = 48/392 (12%)

Query: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPK--AHEVRIRVKKTAVCHTDAYTLSGAD 58
           MST       +A + ++  K  + +++  +P K   H++ I+++   VC +D +T SG  
Sbjct: 1   MSTSPAKFQGIAILDHKDWK--NPKKVEYEPKKFLDHDIDIKIECCGVCGSDIHTASGHW 58

Query: 59  PEGAFPSILGHEGAGIVESVGEGVTS-VKPGDHV-VALYTAECGKCKFCKSGKTNLCGSV 116
            +   P ++GHE  G V  +G+  TS +K GD V V      C +C  CKS     C   
Sbjct: 59  GDITKPLVVGHEIIGTVVRLGDKCTSGLKLGDRVGVGAQAFSCLECGRCKSDNEPYCTKS 118

Query: 117 RATQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLG 176
             T       DG     N KG           +++Y               P   A  L 
Sbjct: 119 VWTYSTN-YEDGY----NSKG----------GYADYIRLHEHFAIPIPENIPSHLAAPLM 163

Query: 177 CGVTTGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMH 236
           CG  T +   ++     +G  V I G G +G      AKA GA ++  +    AKK    
Sbjct: 164 CGGITAFSPLLRNG-CGRGKKVGIMGIGGIGHMALIFAKAMGA-EVYAISRTSAKKDDSI 221

Query: 237 EFGATDFI--NPATDLQNGQTIVEKLIEMTDGGL-DFTFDCTGN-VKVMRDALEACHKXX 292
           + GA  FI      D          LI +    L D  FD     +KV    +  C    
Sbjct: 222 KMGADHFIATKEEPDWATKYFDTFDLIVVCSNSLTDINFDVVPRTMKVGGKIVSIC---- 277

Query: 293 XXXXXXXXXXXXQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLI--KDYQGGALKVDE 350
                       + I+ +PF L+ G     SA GGI    +M  L+  KD +   + V+ 
Sbjct: 278 -------APEQNEVINLKPFGLL-GVSISNSALGGINEIKQMLDLVSKKDLK---IWVET 326

Query: 351 FITNRRPFKQINEAFEDLHAGDSLRTVLNYTD 382
              +    K + E FE +  GD +R     TD
Sbjct: 327 VPISE---KGVKEVFERMDMGD-VRYRFTLTD 354

>TPHA0J00170 Chr10 (40911..41996) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 83/343 (24%), Positives = 128/343 (37%), Gaps = 36/343 (10%)

Query: 35  HEVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIVESVGEGVTS-VKPGDHV-V 92
            +V I+V    VC +D +  +G         ++GHE  G V  VG   T+ VK GD V V
Sbjct: 34  RDVDIKVIACGVCGSDVHCAAGRHLPLFEDCVVGHEIIGEVVKVGPKCTAGVKVGDRVGV 93

Query: 93  ALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEY 152
              +  C +C+ C +G    C          + PDG+            H        EY
Sbjct: 94  GAQSLSCLECESCIAGNEQYCKKNTVYTIASIYPDGSKAQGGFGSHVRTH--------EY 145

Query: 153 TXXXXXXXXXXXPKAPLESACLLGCGVTTGYGAAVKTANVQKGDTVAIFGAGTVGLSVAQ 212
                         APL       CG  T +   ++   V  G TV I G G +G     
Sbjct: 146 FVHPIPKELDTVNAAPLL------CGGITAFSPLLR-GQVGPGKTVGIVGIGGIGHIAIL 198

Query: 213 GAKARGASQIILVDINDAKKKYMHEFGATDFINPATDLQNGQTIVEKLIEMTDGGLDFTF 272
            AKA GA ++I +  + +KK+   + GA ++I  A     G    +K      G +DF  
Sbjct: 199 FAKAMGA-KVIAISRSASKKEDCLKLGADEYIASA----EGDDWKQKFA----GSIDFML 249

Query: 273 DCTGNV-KVMRDALEACHKXXXXXXXXXXXXXXQEISTRPFQLVTGRVWKGSAFGGIKGR 331
            C  +  K   D+L +  K                +S  P  L+  +      F  +  R
Sbjct: 250 LCNSSFSKSNFDSLFSLIKLGGEVCSIGIPDMSYRLSISPLSLLGIKF----GFSALGSR 305

Query: 332 SEMGGLIKDYQGGALKVDEFITNRRPF--KQINEAFEDLHAGD 372
           +E   + +  +   +K+        P   K ++EAFE +  GD
Sbjct: 306 NEFQKMFELVKKNNIKL---WVETLPIGEKGLHEAFERVENGD 345

>NDAI0A08470 Chr1 (1954035..1955126) [1092 bp, 363 aa] {ON} 
          Length = 363

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 54/123 (43%), Gaps = 2/123 (1%)

Query: 2   STEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEG 61
           ST       +A + ++  K     E    P   +++ I+++   VC +D +  +G   + 
Sbjct: 4   STSPAKFQGIAVLDHKDWKNPKKVEFEPKPFYPNDIDIKIECCGVCGSDIHAAAGHWGDL 63

Query: 62  AFPSILGHEGAGIVESVGEGVTS-VKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRAT 119
             P ++GHE  G V  +GE   S +K GD V V      C  C+ CKS     C S   T
Sbjct: 64  EKPLVVGHEVIGTVVRLGENCNSGLKLGDRVGVGAQVFSCLDCERCKSNNEPYCPSFVTT 123

Query: 120 QGK 122
            G+
Sbjct: 124 YGQ 126

>CAGL0M14047g Chr13 complement(1386775..1387854) [1080 bp, 359 aa]
           {ON} highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318c or uniprot|P25377 Saccharomyces
           cerevisiae YCR105w
          Length = 359

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 84/367 (22%), Positives = 135/367 (36%), Gaps = 37/367 (10%)

Query: 11  LAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHE 70
           +A V ++  K     E    P   ++V I+++   VC +D +  +G   +   P ++GHE
Sbjct: 9   IAVVDHKDWKNPKKVEFPAKPFYDNDVDIKIEACGVCGSDIHCAAGNWGQKQTPLVVGHE 68

Query: 71  GAGIVESVGEGV-TSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDG 128
             G V  VG    T +K GD V V      C +C+ CK+     C     T  +    DG
Sbjct: 69  IIGKVVKVGPKCKTGLKIGDRVGVGAQVFSCLECERCKNDNEPYCARFVTTYSQP-YEDG 127

Query: 129 TSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYGAAVK 188
                         ++    ++ Y               P E A  L CG  T Y   ++
Sbjct: 128 --------------YVSQGGYANYVRVHEHFAVPIPENIPSEYAAPLLCGGLTVYSPLLR 173

Query: 189 TANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFINPAT 248
                 G  V I G G +G      AKA GA ++  +  ++AKK+   + GA  +I    
Sbjct: 174 NG-CGPGKKVGILGIGGIGHMGILFAKAMGA-EVYAISRSNAKKEDSLKLGADHYIATKE 231

Query: 249 DLQNGQTIVEKLIEMTDGGLDFTFDCTGNV-KVMRDALEACHKXXXXXXXXXXXXXXQEI 307
           +   G    +          D    C  ++  V  D +    K              + +
Sbjct: 232 EPDWGTKYFDT--------FDLIVVCASSLTDVDFDVMPKAMKVGGRIVSISVPEQDEVL 283

Query: 308 STRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQ--INEAF 365
           + +PF L+ G     S  G I   +EM  L+K      +K+        P  +  + EAF
Sbjct: 284 TMKPFGLI-GVSIANSILGSI---AEMKQLLKLVSENNIKI---WVETLPVGEAGVKEAF 336

Query: 366 EDLHAGD 372
           E +  GD
Sbjct: 337 ERMDKGD 343

>KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} similar
           to uniprot|P38230 Saccharomyces cerevisiae YBR046C ZTA1
           Zeta-crystallin homolog
          Length = 358

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 65/345 (18%), Positives = 117/345 (33%), Gaps = 68/345 (19%)

Query: 35  HEVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIVESVGEGVTSVKPGDHVVAL 94
           +E+ I+ K   + + ++Y   G  P    P +LG E +G+V + G+ VT     D V   
Sbjct: 59  NEILIKNKYAGINYIESYFRKGIYPSKK-PYVLGREASGVVVAKGDAVTKFDVNDKVA-- 115

Query: 95  YTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTX 154
                                                           ++  +TF++YT 
Sbjct: 116 ------------------------------------------------YLSSNTFAQYTK 127

Query: 155 XXXXXXXXXXPKAPLESACLLGCG----VTTGYGAAVKTANVQKGDTVAIFGAGTVGLSV 210
                     P+   +    L  G      T      +   V+KGD + ++ A       
Sbjct: 128 ISEAGTVSKVPQDSTDEQLKLYAGSLVQALTSLAFVREAYPVKKGDYILLYAAAGGAGLA 187

Query: 211 AQGAKARGASQIILVDINDAKKKYMHEFGATDFINPATDLQNGQTIVEKLIEMTDG-GLD 269
                 +  +  I V   D K +   E+GA   IN + D      ++ +++E+T+G G++
Sbjct: 188 FNQFLKKAGAHTIAVASTDEKLQLAKEYGAEFLINSSKD-----DVLARVLEITNGQGVE 242

Query: 270 FTFDCTGNVKVMRDALEACHKXXXXXXXXXXXXXXQEISTRPFQLVTGRVWKGSAFGGIK 329
             FD  G       +L+A  +                ++         ++ + S FG I 
Sbjct: 243 AAFDSVGK-DTFETSLKALKRKGTLVSFGNASGPVPPVAINILTPKNIKLLRPSLFGYIA 301

Query: 330 GRSEM----GGLIKDYQGGALKVDEFITNRRPFKQINEAFEDLHA 370
              E       L      GALK+   I+   P ++ N+A E L +
Sbjct: 302 THEEWESYSSELFDLLHSGALKI--LISKTYPLEEYNQAAEQLES 344

>CAGL0H06853g Chr8 complement(680184..681266) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318c
          Length = 360

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 88/379 (23%), Positives = 141/379 (37%), Gaps = 42/379 (11%)

Query: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPE 60
           MS+E K    +A + ++  K     E    P   H++ I++    VC +D +  +G   +
Sbjct: 1   MSSEDK-FQGIAVLDHKDWKNPKKVEFPAKPFYDHDIDIKIDACGVCGSDIHCAAGNWGK 59

Query: 61  GAFPSILGHEGAGIVESVGEGV-TSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRA 118
              P ++GHE  G V  +G    T +K GD V V      C +C  CK+     C     
Sbjct: 60  KQTPLVVGHEIIGKVVKIGPKCNTGLKVGDRVGVGAQVFSCLECDRCKNDNEPYCPKFVT 119

Query: 119 TQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCG 178
           T  +    DG              ++    ++ Y               P   A  L CG
Sbjct: 120 TYSQP-YEDG--------------YVSQGGYANYVRVHEHFAVKIPENIPDHLAAPLLCG 164

Query: 179 VTTGYGAAVKT--ANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMH 236
             T Y   ++      +K   V I G G +GL     AKA GA ++  +  ++AKK+   
Sbjct: 165 GITVYSPLLRNGCGPGKKVGIVGIGGIGHMGLLF---AKAMGA-EVYAISRSNAKKEDSL 220

Query: 237 EFGATDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNV-KVMRDALEACHKXXXXX 295
           + GA  +I    +   G+   +          D    C  ++  V  D +    K     
Sbjct: 221 KLGADHYIATKEEPNWGEKYFDT--------FDLIVVCASSLTDVDFDVMPKAMKVGGRI 272

Query: 296 XXXXXXXXXQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNR 355
                    Q ++ +PF L+ G     SA G IK   E+  L+K      +K+       
Sbjct: 273 VSISIPDEDQTLTMKPFGLL-GVSIANSALGSIK---EIEQLLKLVSEKDIKI---WVET 325

Query: 356 RPFKQ--INEAFEDLHAGD 372
            P  +  + EAFE +  GD
Sbjct: 326 LPVGEAGVKEAFERMDKGD 344

>Kwal_26.9050 s26 (1055019..1056113) [1095 bp, 364 aa] {ON} YCR105W
           - Hypothetical ORF [contig 68] FULL
          Length = 364

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 43/94 (45%), Gaps = 5/94 (5%)

Query: 25  EEITVDPPK--AHEVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIVESVGEGV 82
           E+ +  PP     ++ + ++   VC +D + ++G       P  +GHE  G + ++GE V
Sbjct: 22  EKFSYSPPLLGPEDIELEIEACGVCGSDIHAVAGDWGRLYKPFAVGHEIVGKISAMGEQV 81

Query: 83  TSVK--PGDHV-VALYTAECGKCKFCKSGKTNLC 113
              K   GD V V      CGKC  C  G+   C
Sbjct: 82  NKEKFHLGDRVGVGAQIDSCGKCTRCSRGRQQNC 115

>KLTH0B04972g Chr2 (408153..409235) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|Q04894 Saccharomyces cerevisiae
           YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 360

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 85/371 (22%), Positives = 140/371 (37%), Gaps = 52/371 (14%)

Query: 25  EEITVDPPK--AHEVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIVESVGEGV 82
           ++I+ +P K   ++V + ++   +C +D +  SG     + P ++GHE  G V  VG   
Sbjct: 22  KKISYEPKKFDDYDVDVEIEACGICGSDTHCASGNWGPKSLPLVVGHEVIGRVVRVGPKC 81

Query: 83  -TSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFKNKKGETL 140
            T VK GD V V    + C  C  C S     C     T  +   PDG            
Sbjct: 82  HTGVKVGDRVGVGAQVSSCLDCDRCNSDFEPYCAEFITTYSQP-YPDG------------ 128

Query: 141 LHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYGAAVKT--ANVQKGDTV 198
             ++    ++ +             K P   A  L CG  T +   +       +K   V
Sbjct: 129 --YVSQGGYASHIRAHEHFVIPIPEKIPTHLAAPLLCGGITVFSPLINNDCGPNKKVGIV 186

Query: 199 AIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFI----NPATDLQNGQ 254
            I G G +GL     AKA GA ++  +  + AKK+   + GA  FI     P  + +   
Sbjct: 187 GIGGIGHMGLIF---AKALGA-EVYAISRSSAKKEDAMKLGADHFIATKEEPDWEKKYAS 242

Query: 255 TIVEKLIEMTDGGLDFTFDCTGNV-KVMRDALEACHKXXXXXXXXXXXXXXQEISTRPFQ 313
           T            LD    C  ++ ++  + L    +              +E++ +PFQ
Sbjct: 243 T------------LDLVIVCASSLTEINLEQLIKTMRIKGRIISICVPKETEELNLKPFQ 290

Query: 314 LVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQ--INEAFEDLHAG 371
           L +G     S  G    R E+  L++      LK+        P  +  +++AF  +  G
Sbjct: 291 L-SGITIGNSQLG---SRKELIQLLQLVADKDLKI---WVETLPISEESVHDAFVRMEKG 343

Query: 372 DSLRTVLNYTD 382
           D +R     TD
Sbjct: 344 D-VRYRFTLTD 353

>Smik_26.3 Chr26 (2136..2513) [378 bp, 125 aa] {ON} YMR318C (REAL)
          Length = 125

 Score = 38.9 bits (89), Expect = 0.004,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 4/93 (4%)

Query: 25  EEITVDPPKAH--EVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIVESVGEGV 82
           ++I+ +P   +  +V I+V+   VC +D +  +G       P + GHE  G +  +G   
Sbjct: 22  KKISYEPKSFYPEDVEIKVEACGVCGSDIHCAAGHWGPRNDPLVAGHEIVGRIVRMGSRC 81

Query: 83  TSVKPGDHVVAL--YTAECGKCKFCKSGKTNLC 113
           +S    D  V +   T  C KC  CK G+ N C
Sbjct: 82  SSQLKVDMRVGMGAITFSCLKCSGCKKGEENYC 114

>KLLA0E19889g Chr5 (1770061..1771161) [1101 bp, 366 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 366

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 51/121 (42%), Gaps = 6/121 (4%)

Query: 13  AVAYEAGKPLSVEEITVDPPK---AHEVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGH 69
           AV     K LS E++ V P K     +V I ++   VC +D +   G   E   P ++GH
Sbjct: 11  AVVDSHKKWLSPEKV-VYPAKQFNPRDVDIEIEACGVCGSDVHCAKGNWGEMKLPLVVGH 69

Query: 70  EGAGIVESVGEGV-TSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPD 127
           E  G V  +G+   T +K GD V V    + C  C  C +     C     T  +    D
Sbjct: 70  EIIGKVVRLGDKCDTGLKVGDRVGVGAQVSACLDCNRCNNDNEQYCPKFVTTYSQPYFED 129

Query: 128 G 128
           G
Sbjct: 130 G 130

>KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly
           similar to uniprot|P53912 Saccharomyces cerevisiae or
           YLR460C uniprot|P54007 Saccharomyces cerevisiae YLR460C
           Hypothetical ORFs
          Length = 382

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 79/218 (36%), Gaps = 47/218 (21%)

Query: 33  KAHEVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIVESVGEGVTSVKPGDHVV 92
           K +E+ I+ K   + H D  +        +FP + G E +GIV   GE V   K      
Sbjct: 72  KPYEILIKNKYIGLNHVDWKSKKYRFSIYSFPWVNGRESSGIVVRRGEKVDEEK------ 125

Query: 93  ALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEY 152
                                            P G   F      T    +  STF EY
Sbjct: 126 --------------------------------FPLGGEVFI---ASTTYRDLRTSTFQEY 150

Query: 153 TXXXXXXXXXXXPKAPLESACLLGCGVTTGYGAAVKTANV----QKGDTVAIFGAGT-VG 207
           T            +  L+ A  +G  + T   A     NV    ++  ++ I+G  T VG
Sbjct: 151 TVFDSRLVWRVPERIGLDFASGIGVSLVTAGAALASKRNVKVQPEEKKSIVIWGGSTGVG 210

Query: 208 LSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFIN 245
           + V Q AK+ G ++II +  +   ++Y+   GAT  I+
Sbjct: 211 IFVVQLAKSLGFTKIITIT-SKKHEQYLLSLGATHIIH 247

>NDAI0H02940 Chr8 complement(717073..718158) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 54/130 (41%), Gaps = 3/130 (2%)

Query: 1   MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPE 60
           MS E +    +  + ++  K     E    P    +V I+++   VC +D +  SG   +
Sbjct: 1   MSNEKEMFKGIGVLDHKDWKNPQRVEFPPKPFHDRDVDIKIECCGVCGSDIHAASGHWGD 60

Query: 61  GAFPSILGHEGAGIVESVGEGVTS-VKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRA 118
              P I+GHE  G V  +G    + +K GD V +      C KC  C +   + C     
Sbjct: 61  IEKPLIVGHEIIGTVVKLGSKCENGLKLGDRVGMGAQCYSCLKCDRCLNNNESYCQHFVT 120

Query: 119 TQGKGVMPDG 128
           T G    PDG
Sbjct: 121 TYGMN-YPDG 129

>ZYRO0A03366g Chr1 (271779..272828) [1050 bp, 349 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C ZTA1 Zeta-crystallin homolog
          Length = 349

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 64/143 (44%), Gaps = 18/143 (12%)

Query: 143 FMGCSTFSEYTXXXXXXXXXXXPK-APLESACLLGCGVTTGYGAAV---KTANVQKGDTV 198
           ++  S F++YT           PK A  E+  L   G+     A     +  NV+KGD +
Sbjct: 109 YLSGSAFAQYTKVDAAGKVVKLPKDANDETLKLYAAGLLQSLTALTFIDEAYNVKKGDFI 168

Query: 199 AIFGA-GTVGLSVAQGAKARGASQIILVDINDA---KKKYMHEFGATDFINPATDLQNGQ 254
             + A G VGL + Q  K RGA  I +V   +     KK+  E+G          + + +
Sbjct: 169 LNYAAAGGVGLILDQLLKERGAHTIAVVSTEEKLELAKKHGAEYGI---------ISSKE 219

Query: 255 TIVEKLIEMTDG-GLDFTFDCTG 276
            IV ++ E+T+  G+D  FD  G
Sbjct: 220 DIVTRVKEITNNQGVDAAFDSIG 242

>SAKL0H00374g Chr8 (45725..47011) [1287 bp, 428 aa] {ON} weakly
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3 Alcohol dehydrogenase isoenzyme III, shows
           a high affinity for alcohols with a double bond
           conjugated to the alcohol group
          Length = 428

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 46/102 (45%), Gaps = 11/102 (10%)

Query: 17  EAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAG-IV 75
           E  K   +E   V   K H+  +++K   +CH+D   L G  P     + +GHE  G +V
Sbjct: 93  ENNKLEYLENYRVQSLKPHQGLLKIKAVGLCHSDLTILKGGFPASQRYA-MGHEICGELV 151

Query: 76  ESVGEGVTSVKPGDHVVALYT----AECGKCKFCKSGKTNLC 113
           ++  +     +P   V  LYT    A CG C  CK G  + C
Sbjct: 152 QTYAD-----EPKYAVGELYTVVGNAPCGGCDSCKKGWESCC 188

>TDEL0A00140 Chr1 (23016..24233) [1218 bp, 405 aa] {ON} 
          Length = 405

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 66/151 (43%), Gaps = 24/151 (15%)

Query: 144 MGCSTFSEYTXXXXXXXXXX----------XPKAPLESACLLGCGVTTGYGAAVKT---- 189
           +  STF EYT                      +  LE A  +G G+ T  G+A+ +    
Sbjct: 141 LETSTFQEYTVFDSRLVWKLPQYRLPNGRLHKRFDLEFAAGVGVGLVTA-GSAISSLVDL 199

Query: 190 -----ANVQKGDTVAIFG-AGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDF 243
                A+ QK   + I+G + +VGL V Q AKA    + I+V      K+Y+ E GA+  
Sbjct: 200 SLRDQADHQKLGNIVIWGGSSSVGLYVIQLAKASKMFEKIVVVSASKHKEYLLELGASCI 259

Query: 244 INPATDLQNGQTIVEKLIEMTDGGLDFTFDC 274
           I+     Q+ + I++ ++     G+DF  D 
Sbjct: 260 IDRH---QSEEEILDDILSHCPEGIDFGIDV 287

>SAKL0C00264g Chr3 complement(17429..18508) [1080 bp, 359 aa] {ON}
           highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 359

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 42/93 (45%), Gaps = 4/93 (4%)

Query: 25  EEITVDPPKAHE--VRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIVESVGEGV 82
           ++I  DP   ++  V I +    VC +D +  +G   +   P ++GHE  G V  VG   
Sbjct: 22  KKIEYDPKPFYDNDVDIEIDACGVCGSDVHCAAGHWGDTQKPLVVGHEVIGRVVRVGPKC 81

Query: 83  -TSVKPGDHV-VALYTAECGKCKFCKSGKTNLC 113
            T VK GD V V      C KC  CKS     C
Sbjct: 82  HTGVKIGDRVGVGAQVYSCLKCDRCKSDNEPYC 114

>Ecym_1093 Chr1 complement(195854..197005) [1152 bp, 383 aa] {ON}
           similar to Saccharomyces cerevisiae YMR318C ADH6 /
           YCR105W ADH7
          Length = 383

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 59/130 (45%), Gaps = 9/130 (6%)

Query: 4   EGKPVTSLAAVA---YEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPE 60
           E K +T +A V    + + K +S +  TV    A ++ ++V+   VC +D +  +G    
Sbjct: 26  ELKEITGIAVVEGTEWTSPKKVSFKPKTV---YARDIVLKVEACGVCGSDIHCAAGHWGP 82

Query: 61  GAFPSILGHEGAGIVESVGEGVTS-VKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRA 118
              P ++GHE  G V  VG G    +K GD V V      C +C  C+S     C ++  
Sbjct: 83  RNNPLVVGHEIIGRVIEVGSGCKEGLKVGDRVGVGAQALSCLECSRCESENEQYCSNMTG 142

Query: 119 TQGKGVMPDG 128
           T      PDG
Sbjct: 143 TYNFP-YPDG 151

>Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON}
           YJR159W (REAL)
          Length = 68

 Score = 35.4 bits (80), Expect = 0.021,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 186 AVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFI 244
           AV+   V+ GD V +     +GL V    +  G  +++L+   D+KK+   +FG T FI
Sbjct: 11  AVRLPQVKYGDCVVVISVRAIGLLVDAVFREFGVDKVVLMSTQDSKKQ-SEQFGGTGFI 68

>Smik_13.535 Chr13 complement(893727..894809) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 39/85 (45%), Gaps = 2/85 (2%)

Query: 31  PPKAHEVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIVESVGEGVTS-VKPGD 89
           P   H+V I+++   VC +D +  +G       P ++GHE  G V  +G+   S +K G 
Sbjct: 30  PFYDHDVDIKIEACGVCGSDVHCAAGHWGNMKMPLVVGHEIVGKVVRLGDKSNSGLKVGQ 89

Query: 90  HV-VALYTAECGKCKFCKSGKTNLC 113
            V V      C +C  CKS     C
Sbjct: 90  RVGVGAQVFSCLECDRCKSDNEPYC 114

>Skud_13.494 Chr13 complement(884038..885120) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 37.7 bits (86), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 2/85 (2%)

Query: 31  PPKAHEVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIVESVGEGVTS-VKPGD 89
           P   H+V I+++   VC +D +  +G       P ++GHE  G V  +G    S +K G 
Sbjct: 30  PFYDHDVDIKIEACGVCGSDVHCAAGHWGNKQLPLVVGHEIVGKVVKLGPKSNSGLKIGQ 89

Query: 90  HV-VALYTAECGKCKFCKSGKTNLC 113
            V V      C +C  CKS     C
Sbjct: 90  RVGVGAQVFSCLECNRCKSDNEPYC 114

>SAKL0D14938g Chr4 complement(1235542..1236678) [1137 bp, 378 aa]
           {ON} similar to uniprot|Q04894 Saccharomyces cerevisiae
           YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 378

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 67/183 (36%), Gaps = 19/183 (10%)

Query: 66  ILGHEGAGIVESVGEGVTSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 124
           ++GHE  G V +VG  VT    G+ V +      C KC  C +G    C     T     
Sbjct: 79  VVGHEIVGHVVNVGNKVTKFHKGERVAMGAQCGSCMKCNRCINGYEQFCTGCIETYCSE- 137

Query: 125 MPDGTSRFKNKKGETLLHFMGCSTFSEYTXXXXXXXXXXXPKAPLESACLLGCGVTTGYG 184
            PDG              ++    ++ +            P+   +    L CG  T Y 
Sbjct: 138 YPDG--------------YVSQGGYASHVRAHEHYIVHVPPQLDSKHVAPLQCGGLTVYS 183

Query: 185 AAVKTAN--VQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATD 242
              +       K   VAI G G +G      +KA    ++  +  +D+KK+   + GA  
Sbjct: 184 PIKRALKDVTDKKPRVAIIGIGGLGHMAIMISKALDC-EVWALSTSDSKKEDAKKMGADH 242

Query: 243 FIN 245
           F+N
Sbjct: 243 FVN 245

>Suva_13.513 Chr13 complement(894394..895476) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 37.7 bits (86), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 42/94 (44%), Gaps = 2/94 (2%)

Query: 31  PPKAHEVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIVESVGEGVTS-VKPGD 89
           P   H+V I+++   VC +D +  +G   +   P ++GHE  G V  +G    S ++ G 
Sbjct: 30  PFYDHDVDIKIEACGVCGSDIHCAAGNWGKKKMPLVVGHEIVGTVVKLGSKSNSGLQVGQ 89

Query: 90  HV-VALYTAECGKCKFCKSGKTNLCGSVRATQGK 122
            V +      C +C  CKS     C     T G+
Sbjct: 90  RVGMGAQVFSCLECDRCKSDNEPYCTKFVTTYGQ 123

>KNAG0B06990 Chr2 (1393058..1394134) [1077 bp, 358 aa] {ON} 
          Length = 358

 Score = 37.0 bits (84), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 38/90 (42%), Gaps = 2/90 (2%)

Query: 35  HEVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIVESVGEGVTS-VKPGDHV-V 92
           H++ IRV    VC +D +  SG   E   P ++GHE  GIV   G    S +K  D V V
Sbjct: 34  HDIDIRVLACGVCGSDIHCASGHWGEIPKPLVVGHEIIGIVVKTGPRCDSGLKVEDRVGV 93

Query: 93  ALYTAECGKCKFCKSGKTNLCGSVRATQGK 122
                 C  C  C       C +  +T  K
Sbjct: 94  GAQALSCLDCDRCTHDNEPYCPNRVSTYAK 123

>KNAG0K02680 Chr11 complement(531173..532252) [1080 bp, 359 aa] {ON}
           
          Length = 359

 Score = 36.6 bits (83), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 39/87 (44%), Gaps = 2/87 (2%)

Query: 35  HEVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIVESVGEGVTS-VKPGDHV-V 92
           H++ I+++   VC +D +  SG   +   P ++GHE  G +  +G    S  K GD V +
Sbjct: 34  HDIDIKIEACGVCGSDVHCASGNWGDTPKPLVVGHEIIGTIVKMGPKCNSGYKIGDRVGM 93

Query: 93  ALYTAECGKCKFCKSGKTNLCGSVRAT 119
                 C +C  C +     C  V  T
Sbjct: 94  GAQAMSCLECDRCINDNEPYCAKVVCT 120

>CAGL0H09944g Chr8 complement(971519..972520) [1002 bp, 333 aa] {ON}
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046c ZTA1
          Length = 333

 Score = 36.6 bits (83), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 60/247 (24%), Positives = 87/247 (35%), Gaps = 63/247 (25%)

Query: 36  EVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIVESVGEGVTSVKPGDHVVALY 95
           +V ++ K   V   +AY   G  P    P +LG E +G V  VG  V   K GD V    
Sbjct: 36  DVLVKNKYAGVNFIEAYFRKGYYP-CELPYVLGREASGEVVQVGSEVKDFKIGDKVA--- 91

Query: 96  TAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTXX 155
                                                          ++G STF++YT  
Sbjct: 92  -----------------------------------------------YLGGSTFAQYTKK 104

Query: 156 XXXXXXXXXPKA-PLESACLLGCGVT---TGYGAAVKTANVQKGDTVAIFGA-GTVGLSV 210
                     ++ P E   L G  +    T      +   V +GD + ++ A G VG  +
Sbjct: 105 STENHIMNLGQSCPDEDLKLYGSSLVQCLTAISFIDEAYKVMEGDYILVYAASGGVGSIL 164

Query: 211 AQGAKARGASQIILVDINDAKKKYMHEFGATDFINPATDLQNGQTIVEKLIEMTDG-GLD 269
            Q    R A  +I V  +  K     E GA   IN A D      I+EK+++ T+G G+ 
Sbjct: 165 CQLISQRKA-HVIAVASSAEKLAMAKENGAEFLINYAED-----DILEKVMQYTNGKGVH 218

Query: 270 FTFDCTG 276
             FD  G
Sbjct: 219 AAFDSIG 225

>TPHA0A00140 Chr1 (14857..15945) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 43/95 (45%), Gaps = 4/95 (4%)

Query: 25  EEITVDPPK--AHEVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIVESVGEGV 82
           ++I+ DP K   ++V I+++   VC +D +  S          ++GHE  G V  +G   
Sbjct: 22  KKISYDPKKFDDYDVDIKIEACGVCGSDVHRASSNWGPVKANQVVGHEIVGRVVKLGPKC 81

Query: 83  -TSVKPGDHV-VALYTAECGKCKFCKSGKTNLCGS 115
              +K GD V V      C  CK CKS     C S
Sbjct: 82  KLGLKVGDRVGVGAQAKSCLNCKRCKSDNEPYCKS 116

>KAFR0C01550 Chr3 complement(318350..319429) [1080 bp, 359 aa] {ON} 
          Length = 359

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 43/93 (46%), Gaps = 4/93 (4%)

Query: 25  EEITVDPP--KAHEVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIVESVG-EG 81
           +++T DP    +H+V I ++   VC +D +  +    E     ++GHE  G V  VG E 
Sbjct: 22  KKVTYDPKPFDSHDVDIEIECCGVCGSDIHCAASHWSEVREDLVVGHEVIGRVVKVGPEC 81

Query: 82  VTSVKPGDHV-VALYTAECGKCKFCKSGKTNLC 113
            T +K GD V V      C +C  CK      C
Sbjct: 82  NTGLKLGDRVGVGAQVFSCLECDRCKEDNEPYC 114

>Kpol_1057.24 s1057 (53467..54549) [1083 bp, 360 aa] {ON}
           (53467..54549) [1083 nt, 361 aa]
          Length = 360

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 46/93 (49%), Gaps = 4/93 (4%)

Query: 25  EEITVDPPKAHE--VRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIVESVGEGV 82
           +++T +P + ++  V I+++   VC +D +  +      A   ++GHE  G V  VG   
Sbjct: 22  KKVTFEPKQFNDKDVDIKIEACGVCGSDVHCAASHWGPVAEKQVVGHEIIGRVLKVGPKC 81

Query: 83  TS-VKPGDHV-VALYTAECGKCKFCKSGKTNLC 113
           T+ +K GD V V      C +C  CKS   + C
Sbjct: 82  TTGIKVGDRVGVGAQAWSCLECSRCKSDNESYC 114

>ZYRO0G10318g Chr7 (831554..832684) [1131 bp, 376 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 376

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 41/92 (44%), Gaps = 11/92 (11%)

Query: 34  AHEVRIRVKKTAVCHTDAYTLSG---ADP-------EGAFPSILGHEGAGIVESVGEGVT 83
           AH+V I V+   +C ++ ++L     ++P        G    ++GHE  G V +VG+ V+
Sbjct: 35  AHDVDIEVECCGICASELFSLKNEWSSEPLTCMTSSYGPKSQVVGHEVVGKVVAVGDKVS 94

Query: 84  SVKPGDHV-VALYTAECGKCKFCKSGKTNLCG 114
             K GD + +    + C  C  C       C 
Sbjct: 95  LCKVGDRIGLGAQASSCMSCPRCHGNNEQYCA 126

>TDEL0F02300 Chr6 complement(421372..422511) [1140 bp, 379 aa] {ON} 
          Length = 379

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 38/90 (42%), Gaps = 11/90 (12%)

Query: 35  HEVRIRVKKTAVCHTDAYTLSG----------ADPEGAFPSILGHEGAGIVESVGEGVTS 84
           H++ I V+   +C ++ ++L            +   G    ++GHE  G V  VGE VT 
Sbjct: 38  HDIDIEVECCGICASELFSLKNEWSNAPLACLSSSYGPKSQVVGHEVIGKVVKVGEKVTL 97

Query: 85  VKPGDHV-VALYTAECGKCKFCKSGKTNLC 113
            K G  V +    + C +C  C S     C
Sbjct: 98  AKLGQRVGLGAQASSCMQCGRCSSNNEQYC 127

>Kpol_526.18 s526 (51360..52445) [1086 bp, 361 aa] {ON}
           (51360..52445) [1086 nt, 362 aa]
          Length = 361

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 43/98 (43%), Gaps = 3/98 (3%)

Query: 33  KAHEVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIVESVG-EGVTSVKPGDHV 91
           K  +V I ++   VC +D +  SG   E     ++GHE  G V  +G E  T +K GD V
Sbjct: 32  KECDVDIEIEACGVCGSDIHCASGDWGERRDKLVVGHEVIGRVIKLGPECHTGLKIGDRV 91

Query: 92  -VALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDG 128
            V    A C  C+ C+      C     T  +   PDG
Sbjct: 92  GVGAQVASCLDCERCEHDNEPYCPKFVTTYNQA-YPDG 128

>SAKL0D03872g Chr4 (316127..317173) [1047 bp, 348 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C
          Length = 348

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 40/86 (46%), Gaps = 2/86 (2%)

Query: 25  EEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIVESVGEGVTS 84
           E+  V    A EV I+ K + +   ++Y   G  P    P +LG E AG V + G+ V+ 
Sbjct: 40  EDFPVPNINADEVLIKNKFSGINFIESYFRKGLYPSQK-PYVLGREAAGTVVAKGDAVSK 98

Query: 85  VKPGDHVVALYTAECGK-CKFCKSGK 109
              GD V  L      +  K+ ++GK
Sbjct: 99  FNIGDKVAYLSPGTFAQYTKYPENGK 124

>KAFR0H03770 Chr8 complement(715399..716496) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 44/96 (45%), Gaps = 5/96 (5%)

Query: 32  PKA---HEVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIVESVG-EGVTSVKP 87
           PKA   H+V I ++   VC +D +T +    E     ++GHE  G +  +G E  + +K 
Sbjct: 34  PKAFGPHDVDIEIECCGVCGSDIHTAASHWRELRDKMVVGHEIVGRIVKLGPECDSGLKI 93

Query: 88  GDHV-VALYTAECGKCKFCKSGKTNLCGSVRATQGK 122
           GD V V   +  C +C  CK      C    +T  +
Sbjct: 94  GDRVGVGAQSFSCLECDRCKENNEPYCPKFVSTYNR 129

>YMR318C Chr13 complement(911061..912143) [1083 bp, 360 aa] {ON}
           ADH6NADPH-dependent medium chain alcohol dehydrogenase
           with broad substrate specificity; member of the cinnamyl
           family of alcohol dehydrogenases; may be involved in
           fusel alcohol synthesis or in aldehyde tolerance
          Length = 360

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 38/85 (44%), Gaps = 2/85 (2%)

Query: 31  PPKAHEVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIVESVGEGVTS-VKPGD 89
           P   H++ I+++   VC +D +  +G       P ++GHE  G V  +G    S +K G 
Sbjct: 30  PFYDHDIDIKIEACGVCGSDIHCAAGHWGNMKMPLVVGHEIVGKVVKLGPKSNSGLKVGQ 89

Query: 90  HV-VALYTAECGKCKFCKSGKTNLC 113
            V V      C +C  CK+     C
Sbjct: 90  RVGVGAQVFSCLECDRCKNDNEPYC 114

>TPHA0E00730 Chr5 (139190..142126) [2937 bp, 978 aa] {ON} Anc_7.413
           YER114C
          Length = 978

 Score = 33.9 bits (76), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 1/60 (1%)

Query: 46  VCHTDAYTLSGADPEGAFPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFC 105
           V  T  +TL G      F S       G+++  G  V   K  D +V+LY A  GK ++C
Sbjct: 773 VWKTRFFTLHGTR-LSYFSSTTDTREKGLIDITGHRVVPAKDDDKIVSLYAASTGKGRYC 831

>NCAS0I01730 Chr9 (319449..320498) [1050 bp, 349 aa] {ON} Anc_3.253
          Length = 349

 Score = 33.5 bits (75), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 45/91 (49%), Gaps = 6/91 (6%)

Query: 16  YEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIV 75
           Y+  K  +++  TV+   ++E+ I+   + +   +AY   G  P    P + G E +GIV
Sbjct: 36  YDVIKYKTIQTPTVE--NSNEMVIKNSYSGINFIEAYFRKGIYP-CELPYLPGREASGIV 92

Query: 76  ESVGEGVTSVKPGDHVVALY---TAECGKCK 103
             VG+ V + + GD V  L+    AE  K K
Sbjct: 93  AEVGKDVKNFQIGDKVAYLHGETMAEFTKIK 123

>ABL090W Chr2 (230699..231703) [1005 bp, 334 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR046C (ZTA1)
          Length = 334

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 43/107 (40%), Gaps = 8/107 (7%)

Query: 25  EEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEGAFPSILGHEGAGIVESVGEGVTS 84
           E+  V   +  ++ I+ +   V   + Y  +G  P    P +LG E  G+V ++G  V  
Sbjct: 26  EDYPVPEVRGSDILIKNRYAGVNFIETYFRTGLYP-CEKPYVLGREAVGVVAAIGADVRR 84

Query: 85  VKPGDHVVAL-------YTAECGKCKFCKSGKTNLCGSVRATQGKGV 124
            K GD V  L       YTA   K    K       G ++A  G  V
Sbjct: 85  FKVGDRVACLSSGTFAQYTAVSEKSNVLKLPDDIQDGELQAVAGSLV 131

>SAKL0A10560g Chr1 (928213..929442) [1230 bp, 409 aa] {ON} similar
           to gnl|GLV|KLLA0F00638g Kluyveromyces lactis
           KLLA0F00638g and weakly similar to uniprot|P53912
           Saccharomyces cerevisiae YNL134C
          Length = 409

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 36/79 (45%), Gaps = 3/79 (3%)

Query: 195 GDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATDFINPATDLQNGQ 254
           G  V   G+ +VG+ V Q A+A G    I+   +     Y+ E G T  I+    LQ   
Sbjct: 219 GSLVIWGGSSSVGIFVIQLARASGKFDKIVAISSKKNASYLKELGTTHVID---RLQPED 275

Query: 255 TIVEKLIEMTDGGLDFTFD 273
            IVE++ E    G+ +  D
Sbjct: 276 RIVEQVSESCPEGVRYGID 294

>SAKL0F12958g Chr6 complement(1019015..1022098) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P39969 Saccharomyces cerevisiae
           YER114C BOI2 Protein implicated in polar growth
           functionally redundant with Boi1p interacts with bud-
           emergence protein Bem1p contains an SH3 (src homology 3)
           domain and a PH (pleckstrin homology) domain
          Length = 1027

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 20/43 (46%)

Query: 63  FPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFC 105
           F SI      G+++     V   K  D  VALY A  GK ++C
Sbjct: 808 FSSINDTRERGLIDITAHRVVPAKEDDKFVALYAASTGKGRYC 850

>Skud_86.1 Chr86 complement(469..738) [270 bp, 89 aa] {ON} YJR159W
           (REAL)
          Length = 89

 Score = 29.3 bits (64), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 220 SQIILVDINDAKKKYMHEFGATDFINPAT-DLQNGQTIVEKLIEMTDG-GLDFTFDCTG 276
           S +I VD+ D K +   +FGAT   N +   +   Q + ++L ++  G   D  F+C+G
Sbjct: 1   SDVIFVDVFDNKLQRAKDFGATGTFNSSKFSVDEAQQLADELEKLLGGHQADVVFECSG 59

>Kpol_1018.107 s1018 complement(282640..286023) [3384 bp, 1127 aa]
           {ON} complement(282640..286023) [3384 nt, 1128 aa]
          Length = 1127

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 19/33 (57%)

Query: 73  GIVESVGEGVTSVKPGDHVVALYTAECGKCKFC 105
           G+++  G  V   K  D +++LY A  GK ++C
Sbjct: 894 GLIDITGHRVVPAKEDDKLISLYAASTGKGRYC 926

>CAGL0C01881g Chr3 (196299..199298) [3000 bp, 999 aa] {ON} similar
           to uniprot|P38041 Saccharomyces cerevisiae YBL085w BOB1
           BEM1 protein-binding protein or uniprot|P39969
           Saccharomyces cerevisiae YER114c BOI2
          Length = 999

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 21/43 (48%)

Query: 63  FPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFC 105
           F S+   +  G+++     V      D +VALY A  GK +FC
Sbjct: 835 FASVNDTKERGLIDITAHRVVPANEDDKLVALYAASVGKGRFC 877

>YKL027W Chr11 (387562..388905) [1344 bp, 447 aa] {ON} Protein of
           unknown function, localized to the mitochondrial outer
           membrane
          Length = 447

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 27/61 (44%), Gaps = 8/61 (13%)

Query: 232 KKYMHEFGA---TDFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEAC 288
           +++M E       D IN    LQNG+ +      + +G  DF  DC  N+    D LE  
Sbjct: 146 RRHMREIAPWCEIDPINELWTLQNGERLT-----LGNGTPDFIVDCIDNIDTKVDLLEFA 200

Query: 289 H 289
           +
Sbjct: 201 Y 201

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,593,979
Number of extensions: 1361314
Number of successful extensions: 3563
Number of sequences better than 10.0: 198
Number of HSP's gapped: 3421
Number of HSP's successfully gapped: 233
Length of query: 382
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 271
Effective length of database: 40,753,473
Effective search space: 11044191183
Effective search space used: 11044191183
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)