Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F11660g7.348ON1981868321e-114
TPHA0F029507.348ON2161846382e-84
NDAI0A019107.348ON2141826347e-84
Kpol_530.337.348ON1951856284e-83
TDEL0C020007.348ON2131866252e-82
NCAS0A141407.348ON2241856244e-82
KNAG0C037707.348ON2231826182e-81
SAKL0F11330g7.348ON2081866103e-80
KAFR0B008607.348ON2281816105e-80
KLTH0H01298g7.348ON2141866078e-80
KLLA0D12386g7.348ON2111836033e-79
Kwal_56.246357.348ON2261846027e-79
Ecym_47257.348ON2341856038e-79
TBLA0E005207.348ON2091855963e-78
ACL150W7.348ON2191855922e-77
Smik_4.727.348ON1971825892e-77
CAGL0I03366g7.348ON2121835861e-76
YDL166C (FAP7)7.348ON1971825842e-76
Suva_4.807.348ON2061825773e-75
Skud_4.917.348ON1941825591e-72
KNAG0A023808.473ON108797682.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F11660g
         (198 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar...   325   e-114
TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.34...   250   2e-84
NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON...   248   7e-84
Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON} ...   246   4e-83
TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON...   245   2e-82
NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7....   244   4e-82
KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.34...   242   2e-81
SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar...   239   3e-80
KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.34...   239   5e-80
KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {O...   238   8e-80
KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa] ...   236   3e-79
Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL16...   236   7e-79
Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON...   236   8e-79
TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348 ...   234   3e-78
ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homol...   232   2e-77
Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON} ...   231   2e-77
CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {O...   230   1e-76
YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}  F...   229   2e-76
Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON} ...   226   3e-75
Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON} ...   219   1e-72
KNAG0A02380 Chr1 (229086..232349) [3264 bp, 1087 aa] {ON} Anc_8....    31   2.2  

>ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 198

 Score =  325 bits (832), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 161/186 (86%), Positives = 161/186 (86%)

Query: 1   MESRRYHPNVLIXXXXXXXXXXXXELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHI 60
           MESRRYHPNVLI            ELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHI
Sbjct: 1   MESRRYHPNVLITGTPGSGKSTTSELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXXXXRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTK 120
           V             RKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTK
Sbjct: 61  VDEDKLLDLLEPLLRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTK 120

Query: 121 IDENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVT 180
           IDENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVT
Sbjct: 121 IDENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVT 180

Query: 181 NELHEQ 186
           NELHEQ
Sbjct: 181 NELHEQ 186

>TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.348
           YDL166C
          Length = 216

 Score =  250 bits (638), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 121/184 (65%), Positives = 143/184 (77%)

Query: 3   SRRYHPNVLIXXXXXXXXXXXXELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHIVX 62
           SRRY PN+LI            ELLQRRLSD+ YYNISDFA+E++C+DG+DEGRKSHIV 
Sbjct: 2   SRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIVD 61

Query: 63  XXXXXXXXXXXXRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTKID 122
                       RKG  I+DWHVNDVFPERLIDLVVVLRC+NS+L+ RLK RGYH +KID
Sbjct: 62  EDKLLDELEPLLRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKID 121

Query: 123 ENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVTNE 182
           EN+DAEIMGVV+QDA +SY +EIVVEL SD+TEQM+ NVD+IV WVELW  QH +GVTNE
Sbjct: 122 ENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTNE 181

Query: 183 LHEQ 186
           L ++
Sbjct: 182 LSKK 185

>NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON}
           Anc_7.348 YDL166C
          Length = 214

 Score =  248 bits (634), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 118/182 (64%), Positives = 141/182 (77%)

Query: 3   SRRYHPNVLIXXXXXXXXXXXXELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHIVX 62
           SRRY PN+LI            ELLQRRL ++ YYNISDFA+ENDC++GYD+GRKSHIV 
Sbjct: 6   SRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSHIVD 65

Query: 63  XXXXXXXXXXXXRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTKID 122
                       RKG +I+DWHVND+FPERLIDLVVVLRC+NSIL+ RL KRGYH +KI 
Sbjct: 66  EDKLLDELEPLLRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKIQ 125

Query: 123 ENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVTNE 182
           EN+DAEIMGVV+QDA++SY++EIVVEL SD TEQME NV+RIV W ++W DQH +GVTNE
Sbjct: 126 ENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGVTNE 185

Query: 183 LH 184
           L 
Sbjct: 186 LQ 187

>Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON}
           complement(81184..81771) [588 nt, 196 aa]
          Length = 195

 Score =  246 bits (628), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 122/185 (65%), Positives = 140/185 (75%)

Query: 1   MESRRYHPNVLIXXXXXXXXXXXXELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHI 60
           M SRR  PN+LI            ELLQRRLSD++YYNISDFA+E+DC++GYDE RKSHI
Sbjct: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHI 60

Query: 61  VXXXXXXXXXXXXXRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTK 120
           V             R+GG+I+DWHVNDVFPERLIDLVVVLRC+NSIL+ RL  R YH +K
Sbjct: 61  VDEDKLLDELEPLLREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSK 120

Query: 121 IDENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVT 180
           I EN+DAEIMGVV+QDA +SY +EIVVEL SD+TEQME NVDRIV WVELW  QH  GVT
Sbjct: 121 IQENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVT 180

Query: 181 NELHE 185
           NEL E
Sbjct: 181 NELEE 185

>TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON}
           Anc_7.348 YDL166C
          Length = 213

 Score =  245 bits (625), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 138/186 (74%)

Query: 1   MESRRYHPNVLIXXXXXXXXXXXXELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHI 60
           ME RR+ PN+LI            ELLQRRL D++YYNISDFA+E+DC DGYDE RKS+I
Sbjct: 1   MEPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYI 60

Query: 61  VXXXXXXXXXXXXXRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTK 120
           V             R+G  I+DWHVNDVFPERLIDLVVVLRC+N+IL+ RLK R YH  K
Sbjct: 61  VDEDKLLDELEPLLREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAK 120

Query: 121 IDENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVT 180
           I EN+DAEIMGVV+QDA DSYE+EIVVEL SDSTEQME NVDRIVSW +LW  QH  G T
Sbjct: 121 IQENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQT 180

Query: 181 NELHEQ 186
           NEL E+
Sbjct: 181 NELLER 186

>NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7.348
           YDL166C
          Length = 224

 Score =  244 bits (624), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 142/185 (76%)

Query: 2   ESRRYHPNVLIXXXXXXXXXXXXELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHIV 61
           +SRRY PN+LI            ELLQRRL +++YYNISDFA+E+DC+DGYD+GRKSHIV
Sbjct: 3   KSRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSHIV 62

Query: 62  XXXXXXXXXXXXXRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTKI 121
                        R+G +IIDWHVNDVFPERLIDLV VLRC+NS+L+ RL  R YH TKI
Sbjct: 63  DEDKLLDELEPLLRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDTKI 122

Query: 122 DENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVTN 181
           +EN+DAEIMGVV+QDAL+SY KEIVVEL SD+TEQM+ NVDRIV W ++W +QH  GVTN
Sbjct: 123 EENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGVTN 182

Query: 182 ELHEQ 186
           EL ++
Sbjct: 183 ELEDK 187

>KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.348
           YDL166C
          Length = 223

 Score =  242 bits (618), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 134/182 (73%)

Query: 2   ESRRYHPNVLIXXXXXXXXXXXXELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHIV 61
           ESRR +PN+L+            ELL R L D+ YYNISDFA +N C+DGYDE RKSHIV
Sbjct: 3   ESRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSHIV 62

Query: 62  XXXXXXXXXXXXXRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTKI 121
                          GGNIIDWHVNDVFPERLIDLV VLRC++S+LF RL KR YH +KI
Sbjct: 63  DEDKLLDELEPLLHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSSKI 122

Query: 122 DENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVTN 181
           DEN+DAEIMGVV+QDALDSYE++IVVEL SD TEQM  NVDR+V+W  +W++QH  GVTN
Sbjct: 123 DENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGVTN 182

Query: 182 EL 183
           EL
Sbjct: 183 EL 184

>SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 208

 Score =  239 bits (610), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 139/186 (74%)

Query: 1   MESRRYHPNVLIXXXXXXXXXXXXELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHI 60
           ME++R  PN+L+            ELL RRLSD+ YYNISDFA+E+ C+DGYDE RKSHI
Sbjct: 1   METKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHI 60

Query: 61  VXXXXXXXXXXXXXRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTK 120
           V             RKG +I+DWHVNDVFPERLIDLVVVLRC+NSIL+ RL KRGYH +K
Sbjct: 61  VDEDKLLDELEPLLRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSK 120

Query: 121 IDENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVT 180
           I+EN+DAEIMGVVMQDA +SY +EIVVEL SD+ E M+ NVDRIV W E+W +QH +GVT
Sbjct: 121 IEENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVT 180

Query: 181 NELHEQ 186
           NEL  +
Sbjct: 181 NELEPE 186

>KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.348
           YDL166C
          Length = 228

 Score =  239 bits (610), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 115/181 (63%), Positives = 139/181 (76%)

Query: 2   ESRRYHPNVLIXXXXXXXXXXXXELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHIV 61
           ESRRY PN+L+            ELL RRL D+ Y+NIS+FA+++ C+DGYDE RKSHIV
Sbjct: 7   ESRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSHIV 66

Query: 62  XXXXXXXXXXXXXRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTKI 121
                        R+G +IIDWHVNDVFPERLIDLVVVLRC+NSILF RL  RGYH++KI
Sbjct: 67  DDDKLLDELEPLLRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKI 126

Query: 122 DENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVTN 181
            EN+DAEIMGVV+QDALDSYE+EIVVEL S+STE+M+ NV+RIV+W E+W  QH +GVTN
Sbjct: 127 QENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGVTN 186

Query: 182 E 182
           E
Sbjct: 187 E 187

>KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {ON}
           similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 214

 Score =  238 bits (607), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 115/186 (61%), Positives = 136/186 (73%)

Query: 1   MESRRYHPNVLIXXXXXXXXXXXXELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHI 60
           M S R+ PN+L+            ELLQRRL D  YYNISDFAQ+++C+DGYDE RKSHI
Sbjct: 1   MLSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHI 60

Query: 61  VXXXXXXXXXXXXXRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTK 120
           V             RKGG I+DWHVND+FPERLIDLVVVLR +N++L+ RLK RGYH+ K
Sbjct: 61  VDEDRLLDELEPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAK 120

Query: 121 IDENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVT 180
           I ENIDAEIMGVV+QDA DSYEKEIVVEL SD+ +QM+ NVDRI SW   W +Q+  GVT
Sbjct: 121 IQENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVT 180

Query: 181 NELHEQ 186
           NEL E+
Sbjct: 181 NELVER 186

>KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa]
           {ON} similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 211

 Score =  236 bits (603), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 136/183 (74%)

Query: 1   MESRRYHPNVLIXXXXXXXXXXXXELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHI 60
           ME  R+ PN+++            ELL RRL ++ YYNISDFA+E+DC+DGYD+ RKS+I
Sbjct: 1   MEPVRFKPNIIVSGTPGCGKSTTCELLSRRLPEYTYYNISDFAKEHDCYDGYDDARKSNI 60

Query: 61  VXXXXXXXXXXXXXRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTK 120
           V             RKGG IIDWHVNDVFPERL+DLVVVLRC+N IL+ RL KRGYH  K
Sbjct: 61  VDDDKLLDELEPLLRKGGCIIDWHVNDVFPERLVDLVVVLRCDNGILYDRLNKRGYHNAK 120

Query: 121 IDENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVT 180
           I+EN+DAEIMGVV+QDA DSY +EIVVEL SD+TE+M+ NVDRI++W E+W  QH  GVT
Sbjct: 121 IEENMDAEIMGVVLQDAHDSYAQEIVVELQSDTTEEMDKNVDRIIAWQEIWLKQHKKGVT 180

Query: 181 NEL 183
           NEL
Sbjct: 181 NEL 183

>Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL166C
           (FAP7) - Nuclear protein involved in oxidative stress
           response [contig 161] FULL
          Length = 226

 Score =  236 bits (602), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 132/184 (71%)

Query: 1   MESRRYHPNVLIXXXXXXXXXXXXELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHI 60
           M S R  PN+L+            ELLQRRL   +YYNISDFA+E  C+DGYDE RKSHI
Sbjct: 1   MASTRTSPNILVTGTPGCGKTSTCELLQRRLEGSKYYNISDFAKEYKCYDGYDEARKSHI 60

Query: 61  VXXXXXXXXXXXXXRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTK 120
           V             R GG I+DWHVNDVFPERLIDLVVVLR +NS LF RL KRGYH+ K
Sbjct: 61  VDEDKLLDELEPLLRAGGAIVDWHVNDVFPERLIDLVVVLRTDNSALFDRLSKRGYHEAK 120

Query: 121 IDENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVT 180
           I ENIDAEIMGVVM DA DSY +EIVVEL SD+TEQM+ NVDRIV+W + W++QH  GVT
Sbjct: 121 IQENIDAEIMGVVMHDARDSYAQEIVVELQSDTTEQMDENVDRIVTWRDAWREQHPEGVT 180

Query: 181 NELH 184
           NEL+
Sbjct: 181 NELN 184

>Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON}
           similar to Ashbya gossypii ACL150W
          Length = 234

 Score =  236 bits (603), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 135/185 (72%)

Query: 1   MESRRYHPNVLIXXXXXXXXXXXXELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHI 60
           M+S R  PN+++            ELLQRRL D +YYNISDFA+E+DC++GYDEGRKSHI
Sbjct: 15  MDSTRLRPNIIVTGTPGCGKTTTCELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHI 74

Query: 61  VXXXXXXXXXXXXXRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTK 120
           V             RKGG IIDWHVNDVFPERLIDLVVVLRC+NS L+ RL KRGYH  K
Sbjct: 75  VDEDKLLDELEPLLRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAK 134

Query: 121 IDENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVT 180
           I+ENIDAEIMGVV+QDA+DSY  +IVVEL S++  QME NV RIV+W   W  QH +GVT
Sbjct: 135 IEENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVT 194

Query: 181 NELHE 185
           NEL +
Sbjct: 195 NELQQ 199

>TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348
           YDL166C
          Length = 209

 Score =  234 bits (596), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 112/185 (60%), Positives = 140/185 (75%)

Query: 1   MESRRYHPNVLIXXXXXXXXXXXXELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHI 60
           M+SRRY PN+LI            ELL+R L D++Y NISDFA+E +C+DG+D+GRKSHI
Sbjct: 1   MKSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHI 60

Query: 61  VXXXXXXXXXXXXXRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTK 120
           V             R+G NI+DWHVNDVFPERLIDLVV+LR +NS+L+ RL+ R YH  K
Sbjct: 61  VDEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAK 120

Query: 121 IDENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVT 180
           + EN+DAEIMGVV+QDA+DSY +EIV+EL S++TE+M +NVDRIVSWVELW+ QH  GVT
Sbjct: 121 VQENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVT 180

Query: 181 NELHE 185
           NEL E
Sbjct: 181 NELGE 185

>ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL166C (FAP7)
          Length = 219

 Score =  232 bits (592), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 135/185 (72%)

Query: 1   MESRRYHPNVLIXXXXXXXXXXXXELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHI 60
           M+  R  PN+L+            ELLQR L D+QY+NISDFA+E++C+DGYDE RKSHI
Sbjct: 1   MQQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHI 60

Query: 61  VXXXXXXXXXXXXXRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTK 120
           V             R+GG I+DWHVND+FPERLIDLVVVLRC+N+IL  RL+KRGYH +K
Sbjct: 61  VDEDRLLDELEPLLRRGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSK 120

Query: 121 IDENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVT 180
           I+ENIDAEIMGVV+QDALDSY +EIVVEL SD TEQM+ NVDRI +W   W  +H  GV+
Sbjct: 121 IEENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVS 180

Query: 181 NELHE 185
           N L +
Sbjct: 181 NALQQ 185

>Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON}
           YDL166C (REAL)
          Length = 197

 Score =  231 bits (589), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 137/182 (75%)

Query: 1   MESRRYHPNVLIXXXXXXXXXXXXELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHI 60
           MESRRY PN+++            ELL+ +L D++YYNISDFA+++DCF+GYDEGRKSHI
Sbjct: 1   MESRRYGPNIIVTGTPGCGKSSMCELLKNKLKDYKYYNISDFAKDHDCFEGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXXXXRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTK 120
           V             R+G +I+DWHVND+FPERLIDLVVVLRC+NS L+ RL  RGYH +K
Sbjct: 61  VDEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSK 120

Query: 121 IDENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVT 180
           I+EN+DAEIMGVV QDA++SYE  IVVEL SD+ E ME+NV RI++W ++W +QH  GVT
Sbjct: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVT 180

Query: 181 NE 182
           NE
Sbjct: 181 NE 182

>CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {ON}
           highly similar to uniprot|Q12055 Saccharomyces
           cerevisiae YDL166c
          Length = 212

 Score =  230 bits (586), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 111/183 (60%), Positives = 137/183 (74%)

Query: 1   MESRRYHPNVLIXXXXXXXXXXXXELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHI 60
           M SRR+HPN+++            ELLQRRL  ++YYNIS+FA+E+ C+DGYDEGRKSHI
Sbjct: 1   MGSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXXXXRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTK 120
           V              +G +IIDWHVNDVFPERLIDLVVVLR EN  L+ RLK RGYH +K
Sbjct: 61  VDEDKLLDELEPLLLEGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSK 120

Query: 121 IDENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVT 180
           I+EN+DAEIMGVV+QDA +SYE EIVVEL S++TE MENNVDRI +WV+ W ++H  GV+
Sbjct: 121 IEENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVS 180

Query: 181 NEL 183
           +EL
Sbjct: 181 SEL 183

>YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}
           FAP7Essential NTPase required for small ribosome subunit
           synthesis, mediates processing of the 20S pre-rRNA at
           site D in the cytoplasm but associates only transiently
           with 43S preribosomes via Rps14p, may be the
           endonuclease for site D
          Length = 197

 Score =  229 bits (584), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 135/182 (74%)

Query: 1   MESRRYHPNVLIXXXXXXXXXXXXELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHI 60
           ME+RRY PN+++            E L+ +L D++YYNISDFA++NDCF+GYDEGRKSHI
Sbjct: 1   MEARRYGPNIIVTGTPGCGKSSTCEFLKNKLKDYKYYNISDFAKDNDCFEGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXXXXRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTK 120
           V             R+G +I+DWHVNDVFPERLIDLVVVLRC+NS L+ RL  RGYH +K
Sbjct: 61  VDEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120

Query: 121 IDENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVT 180
           I+EN+DAEIMGVV QDA++SYE  IVVEL SD+ E M +NV RIV+W ++W +QH  GVT
Sbjct: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVT 180

Query: 181 NE 182
           NE
Sbjct: 181 NE 182

>Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON}
           YDL166C (REAL)
          Length = 206

 Score =  226 bits (577), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 134/182 (73%)

Query: 1   MESRRYHPNVLIXXXXXXXXXXXXELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHI 60
           MESRRY PN+++            ELL+  L  ++YYNISDFA++NDCF+GYDEGRKSHI
Sbjct: 1   MESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXXXXRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTK 120
           V             R+G +IIDWHVNDVFPERLIDLVVVLRC+NS L+ RL  RGYH +K
Sbjct: 61  VDEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSK 120

Query: 121 IDENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVT 180
           I+EN+DAEIMGVV QDA+DSYE  IVVEL SD+ + + +NV RI++W ++W +QH  GVT
Sbjct: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVT 180

Query: 181 NE 182
           NE
Sbjct: 181 NE 182

>Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON}
           YDL166C (REAL)
          Length = 194

 Score =  219 bits (559), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 130/182 (71%)

Query: 1   MESRRYHPNVLIXXXXXXXXXXXXELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHI 60
           ME RR+ PN+++            ELL+  L  ++YYNISDFA++NDCF+ YDE RKSHI
Sbjct: 1   MELRRFGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEAYDEARKSHI 60

Query: 61  VXXXXXXXXXXXXXRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTK 120
           V             R+G +IIDWHVNDVFPERLIDLVVVLRC+NS L+ RL  RGYH +K
Sbjct: 61  VDEDKLLDKLEPLLRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120

Query: 121 IDENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVT 180
           I+EN+DAEIMGVV QDA+DSYE  IVVEL  D+ E M +NV RIV+W ++W +QH  GVT
Sbjct: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQGDTKEDMVSNVARIVAWEKMWLEQHSDGVT 180

Query: 181 NE 182
           NE
Sbjct: 181 NE 182

>KNAG0A02380 Chr1 (229086..232349) [3264 bp, 1087 aa] {ON} Anc_8.473
           YPL022W
          Length = 1087

 Score = 30.8 bits (68), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 45/97 (46%), Gaps = 19/97 (19%)

Query: 109 KRLKKRGYHQTKIDENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQ------------ 156
           KR + RG       E +     G  ++ A+DSY+    +ELT    E+            
Sbjct: 581 KRRRTRGASFVAAVERLRNAGAGEDIEGAIDSYDLGKELELTEQGAEEDEFDELIPYSPE 640

Query: 157 -----MENNV--DRIVSWVELWQDQHHSGVTNELHEQ 186
                 EN++  D+++ + E++QD   SG+T+EL E+
Sbjct: 641 SFVVKPENDLESDQLLPYEEVFQDAQKSGLTSELWEE 677

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,397,907
Number of extensions: 700699
Number of successful extensions: 2054
Number of sequences better than 10.0: 27
Number of HSP's gapped: 2082
Number of HSP's successfully gapped: 27
Length of query: 198
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 94
Effective length of database: 41,556,135
Effective search space: 3906276690
Effective search space used: 3906276690
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)