Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F11638g7.347ON19119110251e-144
TDEL0C020107.347ON1911919501e-132
Suva_4.817.347ON1911919351e-130
Smik_4.737.347ON1911919231e-128
YDL165W (CDC36)7.347ON1911919211e-128
Skud_4.927.347ON1911919201e-128
NDAI0A019207.347ON1931939061e-126
KNAG0C037607.347ON1911919021e-125
Kpol_530.347.347ON1911918981e-124
KAFR0B008507.347ON1921928781e-121
NCAS0A141307.347ON1911918701e-120
CAGL0I03388g7.347ON1911918551e-118
TPHA0F029407.347ON1911918521e-117
KLTH0H01320g7.347ON1901927921e-108
Kwal_56.246347.347ON1901927891e-108
SAKL0F11308g7.347ON1911927871e-107
TBLA0E005107.347ON2871677961e-107
KLLA0D12408g7.347ON1841916881e-92
ACL151C7.347ON2081986804e-91
Ecym_47267.347ON1911986761e-90
SAKL0B08052g3.370ON576871125e-06
ZYRO0C16588g3.370ON608821045e-05
KAFR0H008603.370ON578821011e-04
CAGL0D01342g3.370ON548841011e-04
Kwal_23.39623.370ON553851002e-04
NDAI0A050803.370ON57582992e-04
Smik_16.3163.370ON56082992e-04
YPR072W (NOT5)3.370ON56082992e-04
TPHA0A035003.370ON54882993e-04
KLTH0F11880g3.370ON56385974e-04
Skud_16.3613.370ON56082965e-04
Suva_16.4013.370ON56582966e-04
Kpol_1006.73.370ON54083940.001
TBLA0H014903.370ON55283920.002
KNAG0A072903.370ON50786910.002
ADL364C3.370ON50487880.005
Ecym_34563.370ON50887880.006
KLLA0B09196g3.370ON59073840.021
TDEL0C051203.370ON56282840.023
KLTH0A03652g7.214ON77282820.039
CAGL0B01144g1.59ON391152800.062
Kpol_1070.257.214ON686103790.093
ZYRO0D16302g7.214ON82981711.00
TBLA0D042707.214ON84766711.1
CAGL0L00407g6.278ON1371159701.4
NCAS0A112103.370ON582138691.4
Kwal_47.181147.214ON76382701.5
TDEL0H023307.214ON81281691.7
KAFR0A004302.413ON87349672.7
KAFR0A013801.267ON739176655.2
NDAI0A026907.214ON84681655.8
NCAS0A025204.271ON286102646.7
KLLA0E04335g7.214ON75866648.1
SAKL0F07964g7.214ON82981639.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F11638g
         (191 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F11638g Chr6 complement(954908..955483) [576 bp, 191 aa] {O...   399   e-144
TDEL0C02010 Chr3 (348737..349312) [576 bp, 191 aa] {ON} Anc_7.34...   370   e-132
Suva_4.81 Chr4 (151849..152424) [576 bp, 191 aa] {ON} YDL165W (R...   364   e-130
Smik_4.73 Chr4 (141054..141629) [576 bp, 191 aa] {ON} YDL165W (R...   360   e-128
YDL165W Chr4 (164290..164865) [576 bp, 191 aa] {ON}  CDC36Compon...   359   e-128
Skud_4.92 Chr4 (159953..160528) [576 bp, 191 aa] {ON} YDL165W (R...   358   e-128
NDAI0A01920 Chr1 (429808..430389) [582 bp, 193 aa] {ON} Anc_7.34...   353   e-126
KNAG0C03760 Chr3 complement(741798..742373) [576 bp, 191 aa] {ON...   352   e-125
Kpol_530.34 s530 (82095..82670) [576 bp, 191 aa] {ON} (82095..82...   350   e-124
KAFR0B00850 Chr2 complement(160852..161430) [579 bp, 192 aa] {ON...   342   e-121
NCAS0A14130 Chr1 complement(2778386..2778961) [576 bp, 191 aa] {...   339   e-120
CAGL0I03388g Chr9 (288784..289359) [576 bp, 191 aa] {ON} highly ...   333   e-118
TPHA0F02940 Chr6 complement(648881..649456) [576 bp, 191 aa] {ON...   332   e-117
KLTH0H01320g Chr8 (125017..125589) [573 bp, 190 aa] {ON} highly ...   309   e-108
Kwal_56.24634 s56 complement(1082319..1082891) [573 bp, 190 aa] ...   308   e-108
SAKL0F11308g Chr6 complement(882040..882615) [576 bp, 191 aa] {O...   307   e-107
TBLA0E00510 Chr5 complement(93705..94568) [864 bp, 287 aa] {ON} ...   311   e-107
KLLA0D12408g Chr4 (1055117..1055671) [555 bp, 184 aa] {ON} simil...   269   1e-92
ACL151C Chr3 complement(87037..87663) [627 bp, 208 aa] {ON} Synt...   266   4e-91
Ecym_4726 Chr4 (1420080..1420655) [576 bp, 191 aa] {ON} similar ...   265   1e-90
SAKL0B08052g Chr2 (688482..690212) [1731 bp, 576 aa] {ON} highly...    48   5e-06
ZYRO0C16588g Chr3 (1293001..1294827) [1827 bp, 608 aa] {ON} high...    45   5e-05
KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {O...    44   1e-04
CAGL0D01342g Chr4 complement(149562..151208) [1647 bp, 548 aa] {...    44   1e-04
Kwal_23.3962 s23 complement(502287..503948) [1662 bp, 553 aa] {O...    43   2e-04
NDAI0A05080 Chr1 complement(1154530..1156257) [1728 bp, 575 aa] ...    43   2e-04
Smik_16.316 Chr16 (567157..568839) [1683 bp, 560 aa] {ON} YPR072...    43   2e-04
YPR072W Chr16 (690107..691789) [1683 bp, 560 aa] {ON}  NOT5Subun...    43   2e-04
TPHA0A03500 Chr1 complement(769721..771367) [1647 bp, 548 aa] {O...    43   3e-04
KLTH0F11880g Chr6 complement(1000583..1002274) [1692 bp, 563 aa]...    42   4e-04
Skud_16.361 Chr16 (655247..656929) [1683 bp, 560 aa] {ON} YPR072...    42   5e-04
Suva_16.401 Chr16 (697328..699025) [1698 bp, 565 aa] {ON} YPR072...    42   6e-04
Kpol_1006.7 s1006 (30700..32322) [1623 bp, 540 aa] {ON} (30700.....    41   0.001
TBLA0H01490 Chr8 complement(331583..333241) [1659 bp, 552 aa] {O...    40   0.002
KNAG0A07290 Chr1 (1139630..1141153) [1524 bp, 507 aa] {ON} Anc_3...    40   0.002
ADL364C Chr4 complement(66072..67586) [1515 bp, 504 aa] {ON} Syn...    39   0.005
Ecym_3456 Chr3 complement(853907..855433) [1527 bp, 508 aa] {ON}...    39   0.006
KLLA0B09196g Chr2 complement(803259..805031) [1773 bp, 590 aa] {...    37   0.021
TDEL0C05120 Chr3 (917832..919520) [1689 bp, 562 aa] {ON} Anc_3.3...    37   0.023
KLTH0A03652g Chr1 (314336..316654) [2319 bp, 772 aa] {ON} some s...    36   0.039
CAGL0B01144g Chr2 complement(102067..103242) [1176 bp, 391 aa] {...    35   0.062
Kpol_1070.25 s1070 complement(58286..59491,59501..59509,59592..6...    35   0.093
ZYRO0D16302g Chr4 (1357223..1359712) [2490 bp, 829 aa] {ON} simi...    32   1.00 
TBLA0D04270 Chr4 complement(1055025..1057568) [2544 bp, 847 aa] ...    32   1.1  
CAGL0L00407g Chr12 (42659..46774) [4116 bp, 1371 aa] {ON} simila...    32   1.4  
NCAS0A11210 Chr1 (2223815..2225563) [1749 bp, 582 aa] {ON} Anc_3...    31   1.4  
Kwal_47.18114 s47 (692928..695219) [2292 bp, 763 aa] {ON} YIL038...    32   1.5  
TDEL0H02330 Chr8 complement(391361..393799) [2439 bp, 812 aa] {O...    31   1.7  
KAFR0A00430 Chr1 complement(79853..82474) [2622 bp, 873 aa] {ON}...    30   2.7  
KAFR0A01380 Chr1 (268388..270607) [2220 bp, 739 aa] {ON} Anc_1.2...    30   5.2  
NDAI0A02690 Chr1 complement(603611..606151) [2541 bp, 846 aa] {O...    30   5.8  
NCAS0A02520 Chr1 complement(478202..479062) [861 bp, 286 aa] {ON...    29   6.7  
KLLA0E04335g Chr5 (391816..394092) [2277 bp, 758 aa] {ON} simila...    29   8.1  
SAKL0F07964g Chr6 (608052..610541) [2490 bp, 829 aa] {ON} some s...    29   9.9  

>ZYRO0F11638g Chr6 complement(954908..955483) [576 bp, 191 aa] {ON}
           highly similar to uniprot|P06100 Saccharomyces
           cerevisiae YDL165W CDC36 Component of the CCR4-NOT
           complex which has multiple roles in regulating mRNA
           levels including regulation of transcription and
           destabilizing mRNAs by deadenylation basal transcription
           factor
          Length = 191

 Score =  399 bits (1025), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 191/191 (100%), Positives = 191/191 (100%)

Query: 1   MDKFGLEALVPLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIPRDSKRHKVLDTFQSPW 60
           MDKFGLEALVPLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIPRDSKRHKVLDTFQSPW
Sbjct: 1   MDKFGLEALVPLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIPRDSKRHKVLDTFQSPW 60

Query: 61  AETSRSEVEPRFFIPESFVNIPNVLHSQSTPPCFNSVQQDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEPRFFIPESFVNIPNVLHSQSTPPCFNSVQQDQQRVALFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPRFFIPESFVNIPNVLHSQSTPPCFNSVQQDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFLLFYNAIM 191
           RDFLLFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>TDEL0C02010 Chr3 (348737..349312) [576 bp, 191 aa] {ON} Anc_7.347
           YDL165W
          Length = 191

 Score =  370 bits (950), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 173/191 (90%), Positives = 184/191 (96%)

Query: 1   MDKFGLEALVPLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIPRDSKRHKVLDTFQSPW 60
           M+KFGL+ALVPL+KQE+RE +  YDHS+TLGADLSSMLHSLGIPRDSKRH+VLDTFQSPW
Sbjct: 1   MEKFGLKALVPLIKQEERETASLYDHSITLGADLSSMLHSLGIPRDSKRHRVLDTFQSPW 60

Query: 61  AETSRSEVEPRFFIPESFVNIPNVLHSQSTPPCFNSVQQDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP+FFIP+SF NIP VL SQ+TPPCFNSVQ DQQRVALFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFLLFYNAIM 191
           R+FLLFYNAIM
Sbjct: 181 REFLLFYNAIM 191

>Suva_4.81 Chr4 (151849..152424) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  364 bits (935), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 170/191 (89%), Positives = 181/191 (94%)

Query: 1   MDKFGLEALVPLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIPRDSKRHKVLDTFQSPW 60
           MDKFGL+ALVPL+KQED+ELS  YDHSMTLGADLSSML+SLGIPRDS+ H+VLDTFQSPW
Sbjct: 1   MDKFGLQALVPLLKQEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 61  AETSRSEVEPRFFIPESFVNIPNVLHSQSTPPCFNSVQQDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEPRFF PESF NIP+VL S  TPPCFNS+Q DQQRVALFQDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPSVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDP MEP+VS+DGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFLLFYNAIM 191
           RDFLLFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>Smik_4.73 Chr4 (141054..141629) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  360 bits (923), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 168/191 (87%), Positives = 179/191 (93%)

Query: 1   MDKFGLEALVPLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIPRDSKRHKVLDTFQSPW 60
           M+KFGL+ALVPL+K ED+ELS  YDHSMTLGADLSSML+SLGIPRDS+ H+VLDTFQSPW
Sbjct: 1   MEKFGLQALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 61  AETSRSEVEPRFFIPESFVNIPNVLHSQSTPPCFNSVQQDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEPRFF PESF NIP VL S  TPPCFNS+Q DQQRVALFQDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDP MEP+VS+DGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFLLFYNAIM 191
           RDFLLFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>YDL165W Chr4 (164290..164865) [576 bp, 191 aa] {ON}  CDC36Component
           of the CCR4-NOT complex, which has multiple roles in
           regulating mRNA levels including regulation of
           transcription and destabilizing mRNAs by deadenylation;
           basal transcription factor
          Length = 191

 Score =  359 bits (921), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 168/191 (87%), Positives = 179/191 (93%)

Query: 1   MDKFGLEALVPLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIPRDSKRHKVLDTFQSPW 60
           M+KFGL+ALVPL+K ED+ELS  YDHSMTLGADLSSML+SLGIPRDS+ H+VLDTFQSPW
Sbjct: 1   MEKFGLKALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 61  AETSRSEVEPRFFIPESFVNIPNVLHSQSTPPCFNSVQQDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEPRFF PESF NIP VL S  TPPCFNS+Q DQQRVALFQDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPGVLQSTVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDP MEP+VS+DGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFLLFYNAIM 191
           RDFLLFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>Skud_4.92 Chr4 (159953..160528) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  358 bits (920), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 168/191 (87%), Positives = 178/191 (93%)

Query: 1   MDKFGLEALVPLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIPRDSKRHKVLDTFQSPW 60
           M+KFGL ALVPL+K ED+ELS  YDHSMTLGADLSSML+SLGIPRDS+ H+VLDTFQSPW
Sbjct: 1   MEKFGLRALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 61  AETSRSEVEPRFFIPESFVNIPNVLHSQSTPPCFNSVQQDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEPRFF PESF NIP VL S  TPPCFNS+Q DQQRVALFQDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDP MEP+VS+DGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFLLFYNAIM 191
           RDFLLFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>NDAI0A01920 Chr1 (429808..430389) [582 bp, 193 aa] {ON} Anc_7.347
           YDL165W
          Length = 193

 Score =  353 bits (906), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 169/193 (87%), Positives = 182/193 (94%), Gaps = 2/193 (1%)

Query: 1   MDKFGLEALVPLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIPRDSKRHKVLDTFQSPW 60
           MDKFGLEALVPL+K +D+ELS  YDHSMTLGADL+SMLHSLGIPRDSKRH+VLDTFQSPW
Sbjct: 1   MDKFGLEALVPLIKPDDKELSKIYDHSMTLGADLTSMLHSLGIPRDSKRHRVLDTFQSPW 60

Query: 61  AETSRSEVEPRFFIPESFVNIPNVLHSQS--TPPCFNSVQQDQQRVALFQDETLFYLFYK 118
           AETSRSEVEP FFIP+SF +IP+VL S +  TPP F+SVQ+DQQRVALFQDETLFYLFYK
Sbjct: 61  AETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFYK 120

Query: 119 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEK 178
           HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDP MEPVVS+DGLSERGSYVFFDPQRWEK
Sbjct: 121 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWEK 180

Query: 179 CQRDFLLFYNAIM 191
           CQR+FLLFYNAIM
Sbjct: 181 CQREFLLFYNAIM 193

>KNAG0C03760 Chr3 complement(741798..742373) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  352 bits (902), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 167/191 (87%), Positives = 176/191 (92%)

Query: 1   MDKFGLEALVPLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIPRDSKRHKVLDTFQSPW 60
           MDKFGL+ALVPLV+Q D E++ KYDHSM LGADLSSMLHSLGIPRDSKR  VL TFQSPW
Sbjct: 1   MDKFGLKALVPLVRQGDPEVASKYDHSMALGADLSSMLHSLGIPRDSKRQAVLATFQSPW 60

Query: 61  AETSRSEVEPRFFIPESFVNIPNVLHSQSTPPCFNSVQQDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP F+IP SF+ I  VL S+STPPCF+SVQ+DQQRVALFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPTFYIPASFLGIDEVLQSESTPPCFDSVQRDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDP MEPVVS DGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFLLFYNAIM 191
           RDFLLFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>Kpol_530.34 s530 (82095..82670) [576 bp, 191 aa] {ON}
           (82095..82670) [576 nt, 192 aa]
          Length = 191

 Score =  350 bits (898), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 160/191 (83%), Positives = 179/191 (93%)

Query: 1   MDKFGLEALVPLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIPRDSKRHKVLDTFQSPW 60
           MDKFGLEAL+PL+KQ+D ELS KY+H+MT+G DLSSMLHSLGIPRD++R+++LDTFQSPW
Sbjct: 1   MDKFGLEALLPLIKQDDTELSKKYNHAMTIGTDLSSMLHSLGIPRDNQRYRILDTFQSPW 60

Query: 61  AETSRSEVEPRFFIPESFVNIPNVLHSQSTPPCFNSVQQDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEPRFF PESF NIPNVL S+ TPP FNS++ DQQRV LFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFKNIPNVLQSKVTPPVFNSIENDQQRVTLFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDP +EP+VS DGLSERGSY+FFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEKCQ 180

Query: 181 RDFLLFYNAIM 191
           R+F+LFYNAIM
Sbjct: 181 REFVLFYNAIM 191

>KAFR0B00850 Chr2 complement(160852..161430) [579 bp, 192 aa] {ON}
           Anc_7.347 YDL165W
          Length = 192

 Score =  342 bits (878), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 161/192 (83%), Positives = 177/192 (92%), Gaps = 1/192 (0%)

Query: 1   MDKFGLEALVPLVKQEDR-ELSGKYDHSMTLGADLSSMLHSLGIPRDSKRHKVLDTFQSP 59
           MDKFGL+AL+PL+KQ+ + E +G+YDHSMTLGADLSSML+SLGIPRD + H+VLDTFQSP
Sbjct: 1   MDKFGLKALIPLIKQDPQGEKNGQYDHSMTLGADLSSMLYSLGIPRDKQHHRVLDTFQSP 60

Query: 60  WAETSRSEVEPRFFIPESFVNIPNVLHSQSTPPCFNSVQQDQQRVALFQDETLFYLFYKH 119
           WAETSRSEVEP+F IP+SF NI NVL S  TPPCF+S+Q DQQRVALFQDETLFYLFYKH
Sbjct: 61  WAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVALFQDETLFYLFYKH 120

Query: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKC 179
           P TVIQELTYLELRKRNWRYHKTLKAWLTKDP MEP+VS DGLSE+GSYVFFDPQRWEKC
Sbjct: 121 PATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWEKC 180

Query: 180 QRDFLLFYNAIM 191
           QRDFLLFYNAIM
Sbjct: 181 QRDFLLFYNAIM 192

>NCAS0A14130 Chr1 complement(2778386..2778961) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  339 bits (870), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 160/191 (83%), Positives = 174/191 (91%)

Query: 1   MDKFGLEALVPLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIPRDSKRHKVLDTFQSPW 60
           MDKFGL+ALVPL++Q+D+ELS  YDHSMTLGADLSSM+HSLGIPRD+ RH+VLDTFQSPW
Sbjct: 1   MDKFGLKALVPLLRQDDKELSKPYDHSMTLGADLSSMIHSLGIPRDNTRHRVLDTFQSPW 60

Query: 61  AETSRSEVEPRFFIPESFVNIPNVLHSQSTPPCFNSVQQDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP FFIP+SFV I  VL S  TPP F+S Q DQQRVALFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPTFFIPDSFVGISGVLQSPVTPPRFDSAQNDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180
           GTV+QELTYLELR RNWRYH TL+AWLTKDP MEP VS+DGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFLLFYNAIM 191
           +DFLLFYNAIM
Sbjct: 181 KDFLLFYNAIM 191

>CAGL0I03388g Chr9 (288784..289359) [576 bp, 191 aa] {ON} highly
           similar to uniprot|P06100 Saccharomyces cerevisiae
           YDL165w CDC36 transcription factor
          Length = 191

 Score =  333 bits (855), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 173/191 (90%)

Query: 1   MDKFGLEALVPLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIPRDSKRHKVLDTFQSPW 60
           M KFGL+ LVPL++ ++ +    YDHSMT+G DLSSMLHSLGIPRDSK H+VLDTFQSPW
Sbjct: 1   MSKFGLQKLVPLIRADEEKDGKVYDHSMTIGTDLSSMLHSLGIPRDSKHHRVLDTFQSPW 60

Query: 61  AETSRSEVEPRFFIPESFVNIPNVLHSQSTPPCFNSVQQDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP+++IPESF NIP+VL S++TPP F+ VQ DQQRVALFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPKYYIPESFKNIPDVLQSKTTPPTFDDVQTDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHK LKAWLTKDP MEPVV++DGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFLLFYNAIM 191
           RDF LFY+AIM
Sbjct: 181 RDFPLFYSAIM 191

>TPHA0F02940 Chr6 complement(648881..649456) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  332 bits (852), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 174/191 (91%)

Query: 1   MDKFGLEALVPLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIPRDSKRHKVLDTFQSPW 60
           MDKFGLEAL+PL+KQ+D E S KY+H+MT+GADL+S+ HSLGIP ++KR++VLDTFQSPW
Sbjct: 1   MDKFGLEALLPLIKQDDPEFSKKYNHAMTIGADLTSIQHSLGIPNNNKRYRVLDTFQSPW 60

Query: 61  AETSRSEVEPRFFIPESFVNIPNVLHSQSTPPCFNSVQQDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEPR+F P+SF NIP VL S  TP  FNSV+ DQQR++LFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPRYFTPKSFTNIPKVLQSIDTPSVFNSVETDQQRISLFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHK LKAWLTKDP +EP+V++DG SERGSY+FFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKILKAWLTKDPIVEPIVTADGQSERGSYIFFDPQRWEKCQ 180

Query: 181 RDFLLFYNAIM 191
           RDF+LFYNAIM
Sbjct: 181 RDFVLFYNAIM 191

>KLTH0H01320g Chr8 (125017..125589) [573 bp, 190 aa] {ON} highly
           similar to uniprot|P06100 Saccharomyces cerevisiae
           YDL165W CDC36 Component of the CCR4-NOT complex which
           has multiple roles in regulating mRNA levels including
           regulation of transcription and destabilizing mRNAs by
           deadenylation basal transcription factor
          Length = 190

 Score =  309 bits (792), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 166/192 (86%), Gaps = 3/192 (1%)

Query: 1   MDKFGLEALVPLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIPRDS-KRHKVLDTFQSP 59
           M+K+GL AL+PL+++ED+  S  YD SMTLG DLS +LHSLGIP +   R++VLDTFQSP
Sbjct: 1   MEKYGLSALLPLIRREDQ--SPDYDSSMTLGIDLSPVLHSLGIPNNQPSRNRVLDTFQSP 58

Query: 60  WAETSRSEVEPRFFIPESFVNIPNVLHSQSTPPCFNSVQQDQQRVALFQDETLFYLFYKH 119
           W ETSRSEVEP+FF+PESF NIPNVL S   PP FNSVQQD  +++LFQDETLFYLFYKH
Sbjct: 59  WVETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKISLFQDETLFYLFYKH 118

Query: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKC 179
           PG+V+QELTYLELRKRNWRYHKTLK WLTKDP MEPVV+  G SERGSYVFFDPQRWEKC
Sbjct: 119 PGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKC 178

Query: 180 QRDFLLFYNAIM 191
           QRDF+LFYNAIM
Sbjct: 179 QRDFVLFYNAIM 190

>Kwal_56.24634 s56 complement(1082319..1082891) [573 bp, 190 aa]
           {ON} YDL165W (CDC36) - nuclear protein that negatively
           regulates basal transcription [contig 161] FULL
          Length = 190

 Score =  308 bits (789), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 145/192 (75%), Positives = 167/192 (86%), Gaps = 3/192 (1%)

Query: 1   MDKFGLEALVPLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIPRD-SKRHKVLDTFQSP 59
           M+K+GL AL+PL+++ED+  S +YD SMTLG DLS +LHSLGI  + S R++VLDTFQSP
Sbjct: 1   MEKYGLSALLPLIRREDQ--SPEYDSSMTLGIDLSPVLHSLGIASNQSTRYRVLDTFQSP 58

Query: 60  WAETSRSEVEPRFFIPESFVNIPNVLHSQSTPPCFNSVQQDQQRVALFQDETLFYLFYKH 119
           W ETSRSEVEP+FF+PESF NIPNVL +   PP FNSVQQD  +++LFQDETLFYLFYKH
Sbjct: 59  WVETSRSEVEPKFFVPESFKNIPNVLQAGDKPPAFNSVQQDHAKISLFQDETLFYLFYKH 118

Query: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKC 179
           PG+V+QELTYLELRKRNWRYHKTLK WLTKDP MEPVV+  G SERGSYVFFDPQRWEKC
Sbjct: 119 PGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKC 178

Query: 180 QRDFLLFYNAIM 191
           QRDF+LFYNAIM
Sbjct: 179 QRDFVLFYNAIM 190

>SAKL0F11308g Chr6 complement(882040..882615) [576 bp, 191 aa] {ON}
           highly similar to uniprot|P06100 Saccharomyces
           cerevisiae YDL165W CDC36 Component of the CCR4-NOT
           complex which has multiple roles in regulating mRNA
           levels including regulation of transcription and
           destabilizing mRNAs by deadenylation basal transcription
           factor
          Length = 191

 Score =  307 bits (787), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 168/192 (87%), Gaps = 4/192 (2%)

Query: 1   MDKFGLEALVPLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIPRDSK-RHKVLDTFQSP 59
           ++K+GL+AL+PL+KQE    + +YD +MT+G DLSSMLHSLGI  + + + +VLDTF SP
Sbjct: 3   VEKYGLKALLPLIKQETG--NAEYDPAMTMGMDLSSMLHSLGIDSNQEYKTRVLDTFPSP 60

Query: 60  WAETSRSEVEPRFFIPESFVNIPNVLHSQSTPPCFNSVQQDQQRVALFQDETLFYLFYKH 119
           W ETSRSEVEP+FF PESFVNIPNVL S S PP FNSVQQD  ++ALFQDETLFYLFYKH
Sbjct: 61  WVETSRSEVEPKFFTPESFVNIPNVLQSPS-PPSFNSVQQDHPKIALFQDETLFYLFYKH 119

Query: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKC 179
           PGTV+QE+TYLELRKRNWRYHKTLK WLTKDP MEPVVS DGLSERGSYVFFDPQRWEKC
Sbjct: 120 PGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRWEKC 179

Query: 180 QRDFLLFYNAIM 191
           QRDF+LFYNAIM
Sbjct: 180 QRDFVLFYNAIM 191

>TBLA0E00510 Chr5 complement(93705..94568) [864 bp, 287 aa] {ON}
           Anc_7.347 YDL165W
          Length = 287

 Score =  311 bits (796), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 138/167 (82%), Positives = 155/167 (92%)

Query: 25  DHSMTLGADLSSMLHSLGIPRDSKRHKVLDTFQSPWAETSRSEVEPRFFIPESFVNIPNV 84
           DHS+T+GADLSSMLHSLG+PRD+KRH++LDTFQSPWAETSRSEV+PRFFIP SF NI NV
Sbjct: 121 DHSLTIGADLSSMLHSLGLPRDNKRHRILDTFQSPWAETSRSEVQPRFFIPSSFSNISNV 180

Query: 85  LHSQSTPPCFNSVQQDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLK 144
           L   +TPP FN+++ DQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWR+HK LK
Sbjct: 181 LQCNTTPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILK 240

Query: 145 AWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQRDFLLFYNAIM 191
            WLTKDP MEP+V++DG SERGSYVFFDPQRWEKCQR+F+LFYNAIM
Sbjct: 241 TWLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287

>KLLA0D12408g Chr4 (1055117..1055671) [555 bp, 184 aa] {ON} similar
           to uniprot|P06100 Saccharomyces cerevisiae YDL165W CDC36
           Component of the CCR4-NOT complex which has multiple
           roles in regulating mRNA levels including regulation of
           transcription and destabilizing mRNAs by deadenylation
           basal transcription factor
          Length = 184

 Score =  269 bits (688), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 129/191 (67%), Positives = 153/191 (80%), Gaps = 7/191 (3%)

Query: 1   MDKFGLEALVPLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIPRDSKRHKVLDTFQSPW 60
           M+K+GL+ LVP+++ +       YD +MTLG DL+S+L+SL I +D+K H  LD F+SPW
Sbjct: 1   MEKYGLKDLVPVLRHD-----PTYDANMTLGIDLNSLLNSLDITKDTKSHHCLDAFESPW 55

Query: 61  AETSRSEVEPRFFIPESFVNIPNVLHSQSTPPCFNSVQQDQQRVALFQDETLFYLFYKHP 120
            ETSRSEV+P FFIPESF NI  +L +      F SV +DQ R++L QDETLFYLFYKHP
Sbjct: 56  VETSRSEVQPTFFIPESFKNIKGMLGTDQVE--FTSVNRDQPRISLLQDETLFYLFYKHP 113

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180
           G+VIQELTYLELRKRNWRYHKTLK WLTKDP MEPVV+ D +SERGSYVFFDPQRWEKCQ
Sbjct: 114 GSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKCQ 173

Query: 181 RDFLLFYNAIM 191
           RDF+L YNAIM
Sbjct: 174 RDFVLHYNAIM 184

>ACL151C Chr3 complement(87037..87663) [627 bp, 208 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL165W
           (CDC36)
          Length = 208

 Score =  266 bits (680), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 150/198 (75%), Gaps = 14/198 (7%)

Query: 1   MDKFGLEALVPLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIPRD-------SKRHKVL 53
           MDK+GL+ L+P++K E      +YD  MTLG D+SS+LHSL +          S  H  L
Sbjct: 18  MDKYGLKGLLPVIKHEK-----QYDAFMTLGVDVSSLLHSLQVSSKDGYNTALSNGHHAL 72

Query: 54  DTFQSPWAETSRSEVEPRFFIPESFVNIPNVLHSQSTPPCFNSVQQDQQRVALFQDETLF 113
           DTF SPW ETSRSEVEP+FFIPESF NI  VL   ST   F SV +D  R++L QDETLF
Sbjct: 73  DTFPSPWVETSRSEVEPKFFIPESFCNIGGVLGQASTD--FTSVARDHPRISLLQDETLF 130

Query: 114 YLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDP 173
           YLFYKHPGTV+QELTYLELRKRNWRYHKTLK WLTKDP MEP+VS D  SERGSYVFFDP
Sbjct: 131 YLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDP 190

Query: 174 QRWEKCQRDFLLFYNAIM 191
           QRWEKCQRDF+L Y+AIM
Sbjct: 191 QRWEKCQRDFILNYSAIM 208

>Ecym_4726 Chr4 (1420080..1420655) [576 bp, 191 aa] {ON} similar to
           Ashbya gossypii ACL151C
          Length = 191

 Score =  265 bits (676), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 152/198 (76%), Gaps = 14/198 (7%)

Query: 1   MDKFGLEALVPLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIP-RDS------KRHKVL 53
           M K+GL++L+P++K +      +YD SMTLG DL S+LHSL +  RDS        H  L
Sbjct: 1   MSKYGLKSLLPVIKHDK-----QYDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTL 55

Query: 54  DTFQSPWAETSRSEVEPRFFIPESFVNIPNVLHSQSTPPCFNSVQQDQQRVALFQDETLF 113
           DTF SPW ETSRSEVEP+FFIPESF NI  VL   ST   F SV +D  R++L QDETLF
Sbjct: 56  DTFPSPWVETSRSEVEPKFFIPESFKNIVGVLGQPST--YFTSVARDHPRISLLQDETLF 113

Query: 114 YLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDP 173
           YLFYKHPGTV+QELTYLELRKRNWRYHKTLK WLTKDP MEP+VS D  SERGSYVFFDP
Sbjct: 114 YLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDP 173

Query: 174 QRWEKCQRDFLLFYNAIM 191
           QRWEKCQRDF+L YNAIM
Sbjct: 174 QRWEKCQRDFILNYNAIM 191

>SAKL0B08052g Chr2 (688482..690212) [1731 bp, 576 aa] {ON} highly
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 576

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 49/87 (56%), Gaps = 6/87 (6%)

Query: 104 VALFQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRYHKTLKAWLTKDPKMEP--VVSSD 160
            + F  +TLF++FY + GT  Q L   EL + RNW+++K    W  K+ +  P  VVSS+
Sbjct: 481 TSKFDLDTLFFIFYHYQGTYEQFLAARELSQNRNWQFNKLNHCWFYKEVEKLPPGVVSSE 540

Query: 161 GLSERGSYVFFDPQR-W--EKCQRDFL 184
              E  S+ +FD Q+ W   +C  DF+
Sbjct: 541 NKQEEISWRYFDYQKSWLARRCGSDFV 567

>ZYRO0C16588g Chr3 (1293001..1294827) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 608

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 45/82 (54%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPKMEPVVSSDGLSER 165
           F  +TLF++FY + GT  Q L   EL K R W+++K  + W  K+  +E +      SE 
Sbjct: 519 FDLDTLFFIFYHYQGTYEQFLAARELAKNRKWKFNKVDRCWYYKE--VEKLPPGMAQSEE 576

Query: 166 GSYVFFDPQR-W--EKCQRDFL 184
            S+ +FD QR W   +C  DF+
Sbjct: 577 ESWRYFDYQRSWLARRCNSDFI 598

>KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {ON}
           Anc_3.370 YPR072W
          Length = 578

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPKMEPVVSSDGLSER 165
           F  +TLF++FY + GT  Q L+  EL K RNW+++K  + W  K+  +E +      SE 
Sbjct: 490 FDLDTLFFIFYHYQGTYEQFLSSRELNKNRNWQFNKVDRCWYYKE--IEKLPPGMNKSEE 547

Query: 166 GSYVFFDPQR-W--EKCQRDFL 184
            S+ +FD ++ W   +C  DF+
Sbjct: 548 ESWRYFDYKKSWLARRCSPDFV 569

>CAGL0D01342g Chr4 complement(149562..151208) [1647 bp, 548 aa] {ON}
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072w NOT5
          Length = 548

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 48/84 (57%), Gaps = 8/84 (9%)

Query: 106 LFQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKD-PKMEPVVSSDGLS 163
           +F  +TLF++FY + GT  Q L   EL K RNW+++K  + W  K+  K+ P ++    S
Sbjct: 459 MFDLDTLFFIFYHYQGTYEQFLAARELAKIRNWQFNKKDRCWYYKEIEKLPPGMTK---S 515

Query: 164 ERGSYVFFD-PQRW--EKCQRDFL 184
           E  S+ +FD  + W   +C  DF+
Sbjct: 516 EEESWRYFDFKKSWLSRRCGSDFV 539

>Kwal_23.3962 s23 complement(502287..503948) [1662 bp, 553 aa] {ON}
           YPR072W (NOT5) - member of the NOT complex, a global
           negative regulator of transcription [contig 255] FULL
          Length = 553

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 7/85 (8%)

Query: 104 VALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKD-PKMEPVVSSDGL 162
           ++ F  +TLF++FY + GT  Q L   EL  R W+++K  + W  K+  K+ P +     
Sbjct: 463 MSKFDLDTLFFIFYHYQGTHEQFLAARELTMRGWQFNKVNRCWFYKEVEKLPPGMEQ--- 519

Query: 163 SERGSYVFFDPQR-W--EKCQRDFL 184
           SE  S+ +FD Q+ W   +C  DF+
Sbjct: 520 SEEISWRYFDYQKSWLARRCGTDFV 544

>NDAI0A05080 Chr1 complement(1154530..1156257) [1728 bp, 575 aa]
           {ON} Anc_3.370
          Length = 575

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 45/82 (54%), Gaps = 4/82 (4%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPKMEPVVSSDGLSER 165
           F  +TLF++FY + GT  Q L   EL K R+W+Y+K    W  K+ +  P  ++    E 
Sbjct: 485 FDLDTLFFIFYHYQGTYDQFLASRELSKNRDWKYNKVDYCWYYKEIEKLPPGANYNKDEE 544

Query: 166 GSYVFFDPQR-W--EKCQRDFL 184
            S+ +FD ++ W   +C  DF+
Sbjct: 545 ESWRYFDYKKSWLSRRCGNDFV 566

>Smik_16.316 Chr16 (567157..568839) [1683 bp, 560 aa] {ON} YPR072W
           (REAL)
          Length = 560

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSER 165
           F  +TLF++FY + G+  Q L   EL + RNW ++K  + W  K+  +E +    G SE 
Sbjct: 472 FDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNKVDRCWYYKE--IEKLPPGMGKSEE 529

Query: 166 GSYVFFDPQR-W--EKCQRDFL 184
            S+ +FD ++ W   +C  DF+
Sbjct: 530 ESWRYFDYKKSWLARRCGNDFV 551

>YPR072W Chr16 (690107..691789) [1683 bp, 560 aa] {ON}  NOT5Subunit
           of the CCR4-NOT complex, which is a global
           transcriptional regulator with roles in transcription
           initiation and elongation and in mRNA degradation
          Length = 560

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSER 165
           F  +TLF++FY + G+  Q L   EL + RNW ++K  + W  K+  +E +    G SE 
Sbjct: 472 FDLDTLFFIFYHYQGSYEQFLAARELFKNRNWLFNKVDRCWYYKE--IEKLPPGMGKSEE 529

Query: 166 GSYVFFDPQR-W--EKCQRDFL 184
            S+ +FD ++ W   +C  DF+
Sbjct: 530 ESWRYFDYKKSWLARRCGNDFV 551

>TPHA0A03500 Chr1 complement(769721..771367) [1647 bp, 548 aa] {ON}
           Anc_3.370 YPR072W
          Length = 548

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 45/82 (54%), Gaps = 8/82 (9%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKD-PKMEPVVSSDGLSE 164
           F  +TLF++FY + GT  Q L   EL K RNW+Y+K  + W  K+  K  P ++    +E
Sbjct: 460 FDLDTLFFIFYHYQGTYEQFLVARELSKCRNWKYNKVDRNWYFKEVTKSAPDMAQ---TE 516

Query: 165 RGSYVFFDPQR-W--EKCQRDF 183
             ++ +FD Q  W   +C  DF
Sbjct: 517 EETWRYFDYQNSWLARRCNHDF 538

>KLTH0F11880g Chr6 complement(1000583..1002274) [1692 bp, 563 aa]
           {ON} highly similar to uniprot|Q12514 Saccharomyces
           cerevisiae YPR072W NOT5 Subunit of global
           transcriptional regulator
          Length = 563

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 48/85 (56%), Gaps = 7/85 (8%)

Query: 104 VALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKD-PKMEPVVSSDGL 162
           ++ F  +TLF++FY + GT  Q L+  EL  R W+++K  + W  K+  K+ P +     
Sbjct: 473 MSKFDLDTLFFIFYHYQGTYEQFLSARELSIRGWQFNKVNRCWFYKEVEKLPPGMEQ--- 529

Query: 163 SERGSYVFFDPQR-W--EKCQRDFL 184
           SE  S+ +FD Q+ W   +C  +F+
Sbjct: 530 SEEISWRYFDYQKSWLARRCGAEFV 554

>Skud_16.361 Chr16 (655247..656929) [1683 bp, 560 aa] {ON} YPR072W
           (REAL)
          Length = 560

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSER 165
           F  +TLF++FY + G+  Q L   EL + RNW +++  + W  K+  +E +    G SE 
Sbjct: 472 FDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNRVDRCWYYKE--IEKLPPGMGKSEE 529

Query: 166 GSYVFFDPQR-W--EKCQRDFL 184
            S+ +FD ++ W   +C  DF+
Sbjct: 530 ESWRYFDYKKSWLARRCGNDFV 551

>Suva_16.401 Chr16 (697328..699025) [1698 bp, 565 aa] {ON} YPR072W
           (REAL)
          Length = 565

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSER 165
           F  +TLF++FY + G+  Q L   EL + RNW +++  + W  K+  +E +    G SE 
Sbjct: 477 FDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNRVDRCWYYKE--IEKLPPGMGKSEE 534

Query: 166 GSYVFFDPQR-W--EKCQRDFL 184
            S+ +FD ++ W   +C  DF+
Sbjct: 535 ESWRYFDYKKSWLARRCGNDFV 556

>Kpol_1006.7 s1006 (30700..32322) [1623 bp, 540 aa] {ON}
           (30700..32322) [1623 nt, 541 aa]
          Length = 540

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 44/83 (53%), Gaps = 10/83 (12%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPKMEPVVSSDGL--S 163
           F  +TLF++FY + GT  Q L   EL K RNW+++K  + W  K    E   S  G+  +
Sbjct: 452 FDLDTLFFIFYHYQGTYEQFLVARELAKHRNWKFNKINRNWYYK----EVTKSPPGMQQA 507

Query: 164 ERGSYVFFDPQR-W--EKCQRDF 183
           E  ++ +FD Q  W   +C  DF
Sbjct: 508 EEETWRYFDYQNSWLARRCNSDF 530

>TBLA0H01490 Chr8 complement(331583..333241) [1659 bp, 552 aa] {ON}
           Anc_3.370 YPR072W
          Length = 552

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 46/83 (55%), Gaps = 10/83 (12%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPKMEPVVSSDGL--S 163
           F  +TLF++FY + GT  Q L+  EL K RNW ++K  + W  ++ +  P     GL  S
Sbjct: 463 FDLDTLFFIFYHYQGTYDQFLSARELAKNRNWEFNKVDRRWYYREVEKLPP----GLPQS 518

Query: 164 ERGSYVFFDPQR-W--EKCQRDF 183
           E  S+ +FD Q+ W   +C  +F
Sbjct: 519 EEISWRYFDYQKSWLSRRCNSNF 541

>KNAG0A07290 Chr1 (1139630..1141153) [1524 bp, 507 aa] {ON}
           Anc_3.370 YPR072W
          Length = 507

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 47/86 (54%), Gaps = 8/86 (9%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELR-KRNWRYHKTLKAWLTKDPKMEPVVSSDGLSER 165
           F  +TLF++FY + GT  Q L   EL   R+W+++K  + W  K+  +E +      SE 
Sbjct: 419 FDLDTLFFIFYHYQGTYEQFLAARELSINRDWQFNKKDRCWYYKE--IEKLPPGMNKSEE 476

Query: 166 GSYVFFDPQR-W--EKCQRDFLLFYN 188
            S+ +FD ++ W   +C  DF+  YN
Sbjct: 477 ESWRYFDYKKSWLARRCNSDFV--YN 500

>ADL364C Chr4 complement(66072..67586) [1515 bp, 504 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR072W
           (NOT5)
          Length = 504

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 44/87 (50%), Gaps = 5/87 (5%)

Query: 102 QRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDG 161
           Q +  F  +TLF++FY + GT  Q L   EL  R W +++  + W  K+  +E +     
Sbjct: 412 QIMTKFDLDTLFFIFYHYQGTYDQFLAARELIIRGWIFNRVNRCWFYKE--VEKLPPGMD 469

Query: 162 LSERGSYVFFDPQR-W--EKCQRDFLL 185
             E  S+ +FD Q+ W   +C  DF+ 
Sbjct: 470 QKEEVSWRYFDYQKSWLARRCGPDFVF 496

>Ecym_3456 Chr3 complement(853907..855433) [1527 bp, 508 aa] {ON}
           similar to Ashbya gossypii ADL364C
          Length = 508

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 45/87 (51%), Gaps = 7/87 (8%)

Query: 102 QRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKD-PKMEPVVSSD 160
           Q +  F  +TLF++FY + GT  Q L   EL  R W +++  + W  ++  K+ P +   
Sbjct: 416 QILTKFDLDTLFFIFYHYQGTYEQFLAARELNIRGWLFNRVNRCWFYREVEKLPPGMEQ- 474

Query: 161 GLSERGSYVFFDPQR-W--EKCQRDFL 184
              E  S+ +FD Q+ W   +C  DF+
Sbjct: 475 --KEEVSWRYFDYQKSWLARRCGPDFV 499

>KLLA0B09196g Chr2 complement(803259..805031) [1773 bp, 590 aa] {ON}
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 590

 Score = 37.0 bits (84), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 39/73 (53%), Gaps = 4/73 (5%)

Query: 104 VALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKD-PKMEPVVSSDGL 162
           ++ F  +TLF++FY + G+  Q L   EL  R W ++K  + W  K+  K+ P +     
Sbjct: 499 MSKFALDTLFFIFYHYQGSYDQFLASRELSLRGWTFNKVNRCWFHKEVEKLPPGIEG--- 555

Query: 163 SERGSYVFFDPQR 175
            E  ++ +FD Q+
Sbjct: 556 KEEVTWRYFDYQK 568

>TDEL0C05120 Chr3 (917832..919520) [1689 bp, 562 aa] {ON} Anc_3.370
           YPR072W
          Length = 562

 Score = 37.0 bits (84), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 43/82 (52%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPKMEPVVSSDGLSER 165
           F  +TLF++FY + GT  Q L   EL K R W+++K  + W  K+  +E +      +E 
Sbjct: 473 FDLDTLFFIFYHYQGTYDQFLAARELSKNRKWKFNKIDRCWYYKE--VEKLPPGMLQAEE 530

Query: 166 GSYVFFDPQ-RW--EKCQRDFL 184
            S+ +FD Q  W   +C  D +
Sbjct: 531 ESWRYFDYQGSWLARRCNNDVV 552

>KLTH0A03652g Chr1 (314336..316654) [2319 bp, 772 aa] {ON} some
           similarities with uniprot|P06102 Saccharomyces
           cerevisiae YIL038C NOT3 Subunit of the CCR4-NOT complex
           which is a global transcriptional regulator with roles
           in transcription initiation and elongation and in mRNA
           degradation
          Length = 772

 Score = 36.2 bits (82), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 39/82 (47%), Gaps = 8/82 (9%)

Query: 112 LFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKD--PKMEPVVSSDGLSERGSYV 169
           LFY FY     + QE+ Y  L +RNW+  KT + W ++   PK      S+ L E   + 
Sbjct: 667 LFYCFYYSITPLEQEIAYTLLGERNWKVSKTGENWFSRHSLPKF-----SNELCEVADFK 721

Query: 170 FFDPQRWEKCQR-DFLLFYNAI 190
            F+   W    + +F L Y+ +
Sbjct: 722 IFNLDDWTVTDKLNFKLDYSIL 743

>CAGL0B01144g Chr2 complement(102067..103242) [1176 bp, 391 aa] {ON}
           similar to uniprot|Q06263 Saccharomyces cerevisiae
           YLR181c
          Length = 391

 Score = 35.4 bits (80), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 65/152 (42%), Gaps = 8/152 (5%)

Query: 10  VPLVKQEDRE---LSGKYDHSMTLGADLSSMLHSLGIPRDSKRHKVLDTFQSPWAETSRS 66
           VPL K E+ E   L G    +     D+  +++ L +  +   ++  D ++S   E   S
Sbjct: 210 VPLDKSEEEEVNKLVGDSQDNAVTEDDVDDLINKLKMADEDSENEPDDLYRSQADENGGS 269

Query: 67  EVEPRFFIPESFVNIPNVLHSQSTPPCFNSVQQDQQRVALFQ--DETLFYLFYKHPGTVI 124
           E      +P++  NIP+      TP   +S  +DQ   A  +  D+ +  + +     + 
Sbjct: 270 EEPSNLGLPDTPANIPS--RKLDTPAFVDSSDEDQGSDADVEEKDDAVEPVVHTSSTPME 327

Query: 125 QELTYLELRKRNWRYHKTLKAWLTKDPKMEPV 156
           QEL  LE  K  +  +  L   + K  K+E +
Sbjct: 328 QELEELETSKPTYTKND-LANMMDKADKIEKI 358

>Kpol_1070.25 s1070
           complement(58286..59491,59501..59509,59592..60437) [2061
           bp, 686 aa] {ON}
           complement(58286..59491,59501..59509,59592..60437) [2061
           nt, 687 aa]
          Length = 686

 Score = 35.0 bits (79), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 55/103 (53%), Gaps = 9/103 (8%)

Query: 95  NSVQQDQQRVAL--FQDETLFYLFYKH--PGTVIQ-ELTYLELRKRNWRYHKTLKAWLTK 149
           ++  +D+ R+ L  F+   +F LFY +  P T +Q +++ + L +R+W+  K    W  K
Sbjct: 543 DNTNEDKLRLVLERFRPTEIFTLFYHYYFPLTPLQKQISSILLIERDWKLLKNGTMWFLK 602

Query: 150 DPKMEPVVSSDGLSERGSYVFFDPQRWEKCQR-DFLLFYNAIM 191
             + EP  S++   E G+Y  F    W   ++ +F L +N++M
Sbjct: 603 --QGEPKFSNESF-EVGNYKIFKADDWTVIEKFNFKLDFNSLM 642

>ZYRO0D16302g Chr4 (1357223..1359712) [2490 bp, 829 aa] {ON} similar
           to uniprot|P06102 Saccharomyces cerevisiae YIL038C NOT3
           Subunit of the CCR4-NOT complex which is a global
           transcriptional regulator with roles in transcription
           initiation and elongation and in mRNA degradation
          Length = 829

 Score = 32.0 bits (71), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 4/81 (4%)

Query: 111 TLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVF 170
           TLFY +Y     + QE+  + L +R+W+  K    W  +  + +    ++ L E   Y  
Sbjct: 712 TLFYNYYFAVTPLEQEIASIILSERDWKVSKNCAMWFLRQSETK---FANELCEVADYKI 768

Query: 171 FDPQRWEKCQR-DFLLFYNAI 190
           F    W    R +F L Y A+
Sbjct: 769 FKLDDWTVIDRLNFKLDYAAL 789

>TBLA0D04270 Chr4 complement(1055025..1057568) [2544 bp, 847 aa]
           {ON} Anc_7.214 YIL038C
          Length = 847

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 111 TLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVF 170
           TLFY +Y     + +E++ + L +R+WR       W ++  + +    SD L E G Y  
Sbjct: 725 TLFYNYYFSVTPLEKEVSMVVLAERDWRITNNETMWFSRQGEAKL---SDELYEIGDYRI 781

Query: 171 FDPQRW 176
           F  + W
Sbjct: 782 FSLEDW 787

>CAGL0L00407g Chr12 (42659..46774) [4116 bp, 1371 aa] {ON} similar
           to uniprot|P35187 Saccharomyces cerevisiae YMR190c SGS1
           DNA helicase
          Length = 1371

 Score = 31.6 bits (70), Expect = 1.4,   Method: Composition-based stats.
 Identities = 36/159 (22%), Positives = 67/159 (42%), Gaps = 12/159 (7%)

Query: 11  PLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIPRDSKRHKVLDTFQSPWAETSRSEVEP 70
           P +K +  E+        TL  ++ ++ H L    D     V    +S   ++ R+ +  
Sbjct: 217 PKIKSKQSEIEKMELKLETLSQEIKNISHILS---DISNENVFKNIKSQKFDSQRASITA 273

Query: 71  R-----FFIPESFVNIPNVLHSQSTPPCFNSVQQDQQ-RVALFQDETLFYLFYKHPGTVI 124
                   I E F N     +    P   NSV + QQ  ++ FQ+E+L+   Y  P T  
Sbjct: 274 NNSLTDLQINEGFNNNITKNNRDFNPIPDNSVIRGQQVNMSSFQEESLYIDSYNEPNTQS 333

Query: 125 QELTYLELRKR---NWRYHKTLKAWLTKDPKMEPVVSSD 160
           +     ++R R   N+R  +  + +  +  K++P ++SD
Sbjct: 334 RAPYTRQMRDRHQINYRIPEADEPFEYRVGKLQPTIASD 372

>NCAS0A11210 Chr1 (2223815..2225563) [1749 bp, 582 aa] {ON}
           Anc_3.370 YPR072W
          Length = 582

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 60/138 (43%), Gaps = 24/138 (17%)

Query: 71  RFFIPESFV--NIPNVLHSQSTPPCFNSVQQDQQRVAL------FQDETLFYLFYKHPGT 122
           RF  P   +  N  N+  +  T     SV+    R +L      F  +TLF++FY + GT
Sbjct: 436 RFTYPYEVIKSNQGNLNPNDKTHASHQSVEDIYSRTSLAKIFSKFDLDTLFFIFYHYQGT 495

Query: 123 VIQELTYLEL-RKRNWRYHKTLKAWLTKD-PKMEPVVS-----------SDGLSERGSYV 169
             Q L   EL + R+W ++K    W  ++  K+ P ++                E  S+ 
Sbjct: 496 YDQFLAARELSQNRHWLFNKVDSCWYFREIEKLPPTINMSNTIPNNKREDSNSDEEESWR 555

Query: 170 FFDPQR-W--EKCQRDFL 184
           +FD ++ W   +C  DF+
Sbjct: 556 YFDYKKSWLARRCGPDFV 573

>Kwal_47.18114 s47 (692928..695219) [2292 bp, 763 aa] {ON} YIL038C
           (NOT3) - CCR4 trascriptional complex component [contig
           198] FULL
          Length = 763

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 40/82 (48%), Gaps = 8/82 (9%)

Query: 112 LFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKD--PKMEPVVSSDGLSERGSYV 169
           LFY FY     + +E+ Y  L +R+W+  K+  +W ++   PK      S+ L E   + 
Sbjct: 674 LFYCFYYSITPLEREIAYTLLIERSWKVSKSGDSWFSRHGVPKF-----SNELCEVADFK 728

Query: 170 FFDPQRWEKCQR-DFLLFYNAI 190
            F+   W   ++ +F L Y+ +
Sbjct: 729 IFNLDDWTVSEKLNFKLDYSIL 750

>TDEL0H02330 Chr8 complement(391361..393799) [2439 bp, 812 aa] {ON}
           Anc_7.214 YIL038C
          Length = 812

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 4/81 (4%)

Query: 111 TLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVF 170
           TLFY +Y     + Q +  L L +RNW+  K+   W  +  + EP  +++ + E   Y  
Sbjct: 692 TLFYNYYFAVTPLEQTIASLVLSERNWKVSKSGTLWFLR--QGEPKFANE-VCEVADYKI 748

Query: 171 FDPQRWEKCQR-DFLLFYNAI 190
           F    W    + +F L Y A+
Sbjct: 749 FKLDDWTVADKPNFKLDYAAL 769

>KAFR0A00430 Chr1 complement(79853..82474) [2622 bp, 873 aa] {ON}
           Anc_2.413 YMR125W
          Length = 873

 Score = 30.4 bits (67), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 25/49 (51%)

Query: 18  RELSGKYDHSMTLGADLSSMLHSLGIPRDSKRHKVLDTFQSPWAETSRS 66
           R LS    +   LG+DL  +  +L I  D K + +++   S W + S++
Sbjct: 658 RSLSHANKYISDLGSDLKEVFDTLEIEEDIKEYTIIEAVLSYWVKNSQT 706

>KAFR0A01380 Chr1 (268388..270607) [2220 bp, 739 aa] {ON} Anc_1.267
           YJL099W
          Length = 739

 Score = 29.6 bits (65), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 39/176 (22%), Positives = 76/176 (43%), Gaps = 34/176 (19%)

Query: 3   KFGLEALVPLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIPRDSKRHKVLDT------F 56
           K G+ A++    ++D EL  +   ++     L S+L +L  PRDS   ++L+        
Sbjct: 285 KIGIIAILEQSGEKDLELIKRLHETL---EPLLSILDTLE-PRDSNSFQLLNCISILLDL 340

Query: 57  QSPW-----------------AETSRSEVEPRFFIPESFVNIP---NVLHSQSTPPCFNS 96
           Q+ +                  E S    E  +++ + ++N+      L + ++ P   +
Sbjct: 341 QAKFLIRRNDFELALSVAITSTELSLDSFECWYYLAKCYINLGEFDKALGAINSMPNLPA 400

Query: 97  VQQDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPK 152
           V   ++++    +ET+ Y FYK P    +EL  L+ R+  +    T+K W   D K
Sbjct: 401 VDNIKKKIL---NETVLYDFYKRPLGRSRELNELDSREF-YNLGSTMKKWRESDLK 452

>NDAI0A02690 Chr1 complement(603611..606151) [2541 bp, 846 aa] {ON}
           Anc_7.214
          Length = 846

 Score = 29.6 bits (65), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 36/81 (44%), Gaps = 4/81 (4%)

Query: 111 TLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVF 170
           TLFY +Y     + +E+  + L +RNW+       W     +  P+   + L E G Y  
Sbjct: 719 TLFYNYYFAVTPLEKEIANVILNERNWKVSFDETMWFL---RQGPIKFQNELCELGDYKI 775

Query: 171 FDPQRWEKCQR-DFLLFYNAI 190
           F    W    + +F L Y+++
Sbjct: 776 FKLDEWLVVDKINFKLDYSSL 796

>NCAS0A02520 Chr1 complement(478202..479062) [861 bp, 286 aa] {ON}
           Anc_4.271 YDL076C
          Length = 286

 Score = 29.3 bits (64), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 22/102 (21%), Positives = 43/102 (42%), Gaps = 2/102 (1%)

Query: 36  SMLHSLGIPRDSKRHKVLDTFQSPWAETSRSEVEPRFFIPESF--VNIPNVLHSQSTPPC 93
           ++L S    ++SK     +   SP  ET+  ++EP+     S   +N+   LH    P  
Sbjct: 31  TILDSTKKAKESKTESPNEGHSSPKQETTTPDIEPKQTTVNSLPILNLNEELHHGQAPSF 90

Query: 94  FNSVQQDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKR 135
             S++ +  +V  F +       ++ P  ++ E  +L    R
Sbjct: 91  LGSLEYNSHKVGNFNNSKTSSEVFQPPYVILSEEHFLSHMPR 132

>KLLA0E04335g Chr5 (391816..394092) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q75AN0 Ashbya gossypii ADL108C ADL108Cp and
           some similarites with YIL038C uniprot|P06102
           Saccharomyces cerevisiae YIL038C NOT3 Subunit of the
           CCR4- NOT complex which is a global transcriptional
           regulator with roles in transcription initiation and
           elongation and in mRNA degradation
          Length = 758

 Score = 29.3 bits (64), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 27/66 (40%), Gaps = 3/66 (4%)

Query: 111 TLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVF 170
           TLFY +Y     + Q +  L L++R WR  KT   W     +   V  S+   E   Y  
Sbjct: 641 TLFYHYYFSVTPLEQRICALLLKQREWRVLKTGDCWFL---RQGAVKFSNDQCEVADYKI 697

Query: 171 FDPQRW 176
           F    W
Sbjct: 698 FKMDIW 703

>SAKL0F07964g Chr6 (608052..610541) [2490 bp, 829 aa] {ON} some
           similarities with uniprot|P06102 Saccharomyces
           cerevisiae YIL038C NOT3 Subunit of the CCR4-NOT complex
           which is a global transcriptional regulator with roles
           in transcription initiation and elongation and in mRNA
           degradation
          Length = 829

 Score = 28.9 bits (63), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 35/81 (43%), Gaps = 4/81 (4%)

Query: 111 TLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVF 170
           TLFY +Y     + +++    L++RNW+  K    W  +    +    S+ L E   Y  
Sbjct: 707 TLFYSYYYSITPLERKIAMALLKERNWKISKGGNTWFLRQSATK---FSNELCEVADYKI 763

Query: 171 FDPQRWEKCQR-DFLLFYNAI 190
           F    W    + +F L Y+ +
Sbjct: 764 FKLDDWTVVDKLNFKLDYSVL 784

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,520,998
Number of extensions: 903662
Number of successful extensions: 2253
Number of sequences better than 10.0: 61
Number of HSP's gapped: 2235
Number of HSP's successfully gapped: 61
Length of query: 191
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 88
Effective length of database: 41,670,801
Effective search space: 3667030488
Effective search space used: 3667030488
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 62 (28.5 bits)