Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F11616g7.346ON41541521080.0
TDEL0C020207.346ON42541418150.0
SAKL0F11286g7.346ON42340416740.0
Kpol_530.357.346ON42540816190.0
Skud_12.2667.346ON43640216160.0
Suva_10.2977.346ON43641016060.0
KLTH0H01342g7.346ON42241316020.0
Smik_12.2617.346ON43641016000.0
TPHA0F029307.346ON43640715940.0
YLR203C (MSS51)7.346ON43641015930.0
Kwal_56.246317.346ON42241315880.0
NCAS0E028807.346ON42940315530.0
Ecym_47277.346ON42941215480.0
KLLA0D12430g7.346ON41840915420.0
CAGL0A03927g7.346ON43741715250.0
KNAG0B026307.346ON43841415160.0
ACL152W7.346ON42840315080.0
NDAI0E044807.346ON44340214780.0
NCAS0A141207.346ON42740414300.0
TBLA0E005007.346ON43741314130.0
KAFR0B008407.346ON42640313970.0
KNAG0C037507.346ON42440413860.0
NDAI0A019307.346ON45041513780.0
TBLA0H002802.406ON149887770.76
Ecym_62704.207ON1348131761.0
Kwal_23.51613.220ON1489137761.0
KLTH0A03872g7.220ON62479741.3
KAFR0E035705.487ON52334695.1
CAGL0E00957g8.357ON981208687.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F11616g
         (415 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} simila...   816   0.0  
TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {O...   703   0.0  
SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} simila...   649   0.0  
Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}...   628   0.0  
Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {...   627   0.0  
Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {...   623   0.0  
KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {...   621   0.0  
Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {...   620   0.0  
TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.3...   618   0.0  
YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON} ...   618   0.0  
Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR2...   616   0.0  
NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {O...   602   0.0  
Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {O...   600   0.0  
KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]...   598   0.0  
CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly...   592   0.0  
KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {O...   588   0.0  
ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homo...   585   0.0  
NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa] ...   573   0.0  
NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON} Anc_7...   555   0.0  
TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346...   548   0.0  
KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.3...   542   0.0  
KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.3...   538   0.0  
NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {O...   535   0.0  
TBLA0H00280 Chr8 complement(43650..48146) [4497 bp, 1498 aa] {ON...    34   0.76 
Ecym_6270 Chr6 complement(512033..516079) [4047 bp, 1348 aa] {ON...    34   1.0  
Kwal_23.5161 s23 (1040608..1045077) [4470 bp, 1489 aa] {ON} YDR0...    34   1.0  
KLTH0A03872g Chr1 (326673..328547) [1875 bp, 624 aa] {ON} simila...    33   1.3  
KAFR0E03570 Chr5 (719253..720824) [1572 bp, 523 aa] {ON} Anc_5.4...    31   5.1  
CAGL0E00957g Chr5 (86682..89627) [2946 bp, 981 aa] {ON} similar ...    31   7.1  

>ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 415

 Score =  816 bits (2108), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/415 (94%), Positives = 392/415 (94%)

Query: 1   MLRSIRLCRPITQRRTIIGFVRNALGLXXXXXXXXXXXENRFHLWDQSPAGDXXXXXXXX 60
           MLRSIRLCRPITQRRTIIGFVRNALGL           ENRFHLWDQSPAGD        
Sbjct: 1   MLRSIRLCRPITQRRTIIGFVRNALGLDPPPSPDDPTPENRFHLWDQSPAGDLRERAARI 60

Query: 61  XXXXQCPVTGKEINYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGR 120
               QCPVTGKEINYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGR
Sbjct: 61  RALAQCPVTGKEINYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGR 120

Query: 121 PFPEFDFPQDLEFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQF 180
           PFPEFDFPQDLEFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQF
Sbjct: 121 PFPEFDFPQDLEFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQF 180

Query: 181 SPYSLNPKGPITLEGLKSLAALRYTLYPFENKTVAATKDRPMRLFILGARAEALLPGHVW 240
           SPYSLNPKGPITLEGLKSLAALRYTLYPFENKTVAATKDRPMRLFILGARAEALLPGHVW
Sbjct: 181 SPYSLNPKGPITLEGLKSLAALRYTLYPFENKTVAATKDRPMRLFILGARAEALLPGHVW 240

Query: 241 KQLQFLFPETAFELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDA 300
           KQLQFLFPETAFELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDA
Sbjct: 241 KQLQFLFPETAFELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDA 300

Query: 301 QDFFPYDPYLDAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINA 360
           QDFFPYDPYLDAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINA
Sbjct: 301 QDFFPYDPYLDAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINA 360

Query: 361 VMDKHSKEIDILMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIEI 415
           VMDKHSKEIDILMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIEI
Sbjct: 361 VMDKHSKEIDILMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIEI 415

>TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {ON}
           Anc_7.346 YLR203C
          Length = 425

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/414 (78%), Positives = 362/414 (87%)

Query: 2   LRSIRLCRPITQRRTIIGFVRNALGLXXXXXXXXXXXENRFHLWDQSPAGDXXXXXXXXX 61
           LR+ R  +   QRR IIGFVRNALGL           ENRFH WDQSP GD         
Sbjct: 12  LRAQRCGKVFNQRRFIIGFVRNALGLDPPPSPDDPTPENRFHPWDQSPVGDLRERAARIR 71

Query: 62  XXXQCPVTGKEINYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRP 121
              +CPVTGKEINYTCPLSGIPTHHS+EAWEQDK+YH+SKK+E+LKKVNIYEHDLRSGRP
Sbjct: 72  TLARCPVTGKEINYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRSGRP 131

Query: 122 FPEFDFPQDLEFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFS 181
           FPEFDFPQ  +FDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPI+IASVL+QFS
Sbjct: 132 FPEFDFPQGQDFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLHQFS 191

Query: 182 PYSLNPKGPITLEGLKSLAALRYTLYPFENKTVAATKDRPMRLFILGARAEALLPGHVWK 241
           PYSLNPKGP+TLEGLKSLAALRYTLYP ENKT+++TKDRPMR+FILGARAEA LPGHVWK
Sbjct: 192 PYSLNPKGPVTLEGLKSLAALRYTLYPLENKTISSTKDRPMRIFILGARAEAQLPGHVWK 251

Query: 242 QLQFLFPETAFELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQ 301
           QLQ+LFPE  FELHF+GPECL+NKEKHQYV+S  PVVKR+DET+SFVYHTD+FHV H+AQ
Sbjct: 252 QLQYLFPEQMFELHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVYHTDFFHVLHEAQ 311

Query: 302 DFFPYDPYLDAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAV 361
           DFFPYDPYLD FFCFHPGFGAPE++  WL +T+ GLLETKCAIF TG NK+ LLRD++AV
Sbjct: 312 DFFPYDPYLDVFFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRDVDAV 371

Query: 362 MDKHSKEIDILMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIEI 415
            DK+ KE+D+LMEP KN++GSTKWELND+NPQEVYQFNMYIAGFRGKRYHAIE+
Sbjct: 372 KDKYGKEVDVLMEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425

>SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 423

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/404 (74%), Positives = 343/404 (84%), Gaps = 1/404 (0%)

Query: 13  QRRTIIGFVRNALGLXXXXXXXXXXXENRFHLWDQSPAGDXXXXXXXXXXXXQCPVTGKE 72
           Q+R IIGFVRNALGL           +NRFH WDQSP+ D            +CPVTGKE
Sbjct: 20  QKRHIIGFVRNALGLDPPPSPDDPTPDNRFHPWDQSPSPDLRTRAATIRALARCPVTGKE 79

Query: 73  INYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEFDFPQDLE 132
           INYTCP SGIPTHHS+EAWEQD  YH +KK+E+LKKVNIYEHDLRSGRPFPEFDFPQD +
Sbjct: 80  INYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLRSGRPFPEFDFPQDQD 139

Query: 133 FDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSLNPKGPIT 192
           +DR VNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYP T+ SVL++FSPY+LNPKGPIT
Sbjct: 140 YDRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPYALNPKGPIT 199

Query: 193 LEGLKSLAALRYTLYPFENKTV-AATKDRPMRLFILGARAEALLPGHVWKQLQFLFPETA 251
           LEGLKSLAALRYTLYP +++ V AATKDRPMR+FILGARAEA LPGHVWKQ QFLFPE  
Sbjct: 200 LEGLKSLAALRYTLYPQQHRKVSAATKDRPMRIFILGARAEAQLPGHVWKQFQFLFPEIN 259

Query: 252 FELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQDFFPYDPYLD 311
           FELHFIGPE   ++EK +Y++S  P+V+R+DETLSFVYHTDYFHV+H+AQDFFPYDPYLD
Sbjct: 260 FELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYLD 319

Query: 312 AFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVMDKHSKEIDI 371
            FFCFHPGF APEST+ W+ KT+ GLLETKCAIF TG N+  L+RD+ AV +K+  E+D+
Sbjct: 320 IFFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVRDMTAVREKYGNEMDM 379

Query: 372 LMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIEI 415
           LMEP +N++GSTKWELND+NPQEVYQFNMYIAGFRGKRYHAIE+
Sbjct: 380 LMEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 423

>Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}
           complement(83032..84309) [1278 nt, 426 aa]
          Length = 425

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/408 (69%), Positives = 340/408 (83%), Gaps = 3/408 (0%)

Query: 11  ITQRRTIIGFVRNALGLXXXXXXXXXXXENRFHLWDQSPAGDXXXXXXXXXXXXQCPVTG 70
           + Q+R+++GFVRNALGL           ENRFH WDQSP  D            +CPVT 
Sbjct: 18  LIQKRSLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPCVDLRERAAKIRTLAKCPVTH 77

Query: 71  KEINYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEFDFPQD 130
           K+INYTCPLSGIPTHH KEAW  DK YHESK++E+LKKVNIYEHDLRSGRPFPEFDFPQD
Sbjct: 78  KDINYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFDFPQD 137

Query: 131 LEFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSLNPKGP 190
            ++DR +N+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYPITI S+L+QFSPYSLNPKGP
Sbjct: 138 QDYDRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLNPKGP 197

Query: 191 ITLEGLKSLAALRYTLYPFENKTVAA---TKDRPMRLFILGARAEALLPGHVWKQLQFLF 247
           +TLEGLKSLAALRYTLYP++NK+      T+DRPMR+FILGARAEA LPGHVWKQ Q+LF
Sbjct: 198 VTLEGLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVWKQFQYLF 257

Query: 248 PETAFELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQDFFPYD 307
           PE  FE+HFIGPEC +NKEK+QY++S  P+VK++D+TL  V+H DYFHV+H+AQDFFPYD
Sbjct: 258 PEQEFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYFHVFHEAQDFFPYD 317

Query: 308 PYLDAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVMDKHSK 367
           P+LD FF FHPG+  PE+T++WL +T+  LL+TKCAIF TG +K  LLRDI+ V +++  
Sbjct: 318 PFLDVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDVVKNRYGN 377

Query: 368 EIDILMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIEI 415
           E+D+LM+P KN++GSTKWELND+NPQEVYQFNMYIAGFRGKRYHAIE+
Sbjct: 378 ELDMLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425

>Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/402 (71%), Positives = 333/402 (82%), Gaps = 1/402 (0%)

Query: 14  RRTIIGFVRNALGLXXXXXXXXXXXENRFHLWDQSPAGDXXXXXXXXXXXXQCPVTGKEI 73
           RR ++GFVRNALGL           ENRFH WDQSP+ D             CPVTGK+I
Sbjct: 33  RRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92

Query: 74  NYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEFDFPQDLEF 133
           NYTCPLSGIPTHHS+EAWE DK YH+SKK+E+LKKVNIYEHDLRSGRPFPEFDFPQ   +
Sbjct: 93  NYTCPLSGIPTHHSREAWEMDKTYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152

Query: 134 DRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSLNPKGPITL 193
           D+ VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYPITI SVL++FSPYSLNPKGPITL
Sbjct: 153 DKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHKFSPYSLNPKGPITL 212

Query: 194 EGLKSLAALRYTLYPFENKTV-AATKDRPMRLFILGARAEALLPGHVWKQLQFLFPETAF 252
           EGLKSLAALRYTLYP EN++V A TK+R MR+FILGARAEA LPGHVWKQLQFLFPE  F
Sbjct: 213 EGLKSLAALRYTLYPLENRSVLATTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNF 272

Query: 253 ELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQDFFPYDPYLDA 312
           E+HF+GPECL  ++K +YV S  PVV+R+DETL F++HTD+F V+H+AQDFFPYDPY+D 
Sbjct: 273 EIHFVGPECLYKRDKQEYVKSATPVVQRVDETLRFIHHTDFFDVFHEAQDFFPYDPYMDV 332

Query: 313 FFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVMDKHSKEIDIL 372
           FF FHPG+ +PES   W+ +T+  LLETKCAIF TG NK  L+ DINAV  K+ KE+DIL
Sbjct: 333 FFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKDLMDDINAVKSKYGKEMDIL 392

Query: 373 MEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIE 414
           M+P +N++GSTKWELND+NPQEVYQFNMYIAGFRGKRYH I+
Sbjct: 393 MDPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/410 (70%), Positives = 332/410 (80%), Gaps = 1/410 (0%)

Query: 6   RLCRPITQRRTIIGFVRNALGLXXXXXXXXXXXENRFHLWDQSPAGDXXXXXXXXXXXXQ 65
           RL      RR ++GFVRNALGL           ENRFH WDQSP+ D             
Sbjct: 25  RLVVSHQTRRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAH 84

Query: 66  CPVTGKEINYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEF 125
           CPVTGK+INYTCPLSGIPTHHS+EAWE DK YH+SKK+E+LKKVNIYEHDLRSGRPFPEF
Sbjct: 85  CPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEF 144

Query: 126 DFPQDLEFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSL 185
           DFPQ   +D+ VN+TNWDLF YTR FYSMDTEFQLAAVTKMLSYPITI S+L++FSPYSL
Sbjct: 145 DFPQQQGYDKAVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSL 204

Query: 186 NPKGPITLEGLKSLAALRYTLYPFENKTV-AATKDRPMRLFILGARAEALLPGHVWKQLQ 244
           NPKGPITLEGLKSLAALRYTLYP EN++V A T++R MR+FILGARAEA LPGHVWKQLQ
Sbjct: 205 NPKGPITLEGLKSLAALRYTLYPLENRSVLATTRNRAMRIFILGARAEAQLPGHVWKQLQ 264

Query: 245 FLFPETAFELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQDFF 304
           FLFPE  FE+HFIGPECL  ++K +YV S  PVV+RIDETL F +HTD+F V+H+AQDFF
Sbjct: 265 FLFPEQNFEIHFIGPECLYKRDKQEYVKSATPVVQRIDETLKFFHHTDFFQVFHEAQDFF 324

Query: 305 PYDPYLDAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVMDK 364
           PYDPY+D FF FHPG+ +PES   W+ +T+  LLETKCAIF TG NK  L+ DIN V  K
Sbjct: 325 PYDPYMDVFFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKKDLMDDINLVKSK 384

Query: 365 HSKEIDILMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIE 414
           + KE+DILM+P KN++GSTKWELND+NPQEVYQFNMYIAGFRGKRYH I+
Sbjct: 385 YGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {ON}
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 422

 Score =  621 bits (1602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/413 (69%), Positives = 338/413 (81%), Gaps = 1/413 (0%)

Query: 4   SIRLCRPITQRRTIIGFVRNALGLXXXXXXXXXXXENRFHLWDQSPAGDXXXXXXXXXXX 63
           ++R C+   Q+R I+GFVRNALGL           ENRFH WDQSP+ D           
Sbjct: 10  TVRSCQHNVQKRHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRERAATIRAL 69

Query: 64  XQCPVTGKEINYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFP 123
            +CPVTG+EINYTCP SGIPTH+S+EAWE D +Y +SK+ E+LKKVNIYEHDLRSGRPFP
Sbjct: 70  AKCPVTGREINYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLRSGRPFP 129

Query: 124 EFDFPQDLEFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPY 183
           EFDFP D +FDR VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYP+TI SVL+QFSPY
Sbjct: 130 EFDFPLDQDFDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSVLHQFSPY 189

Query: 184 SLNPKGPITLEGLKSLAALRYTLYPFENKTVAA-TKDRPMRLFILGARAEALLPGHVWKQ 242
           SLNPKGP+TLEGLKSLAALRYTLYP +N+ V + TK+ P+R+FILGARAEA LPGHVWKQ
Sbjct: 190 SLNPKGPVTLEGLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEAQLPGHVWKQ 249

Query: 243 LQFLFPETAFELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQD 302
           LQF+FPET  ELHF+GPE   ++ K +YV S +P+V+R+DETLSFVYHTDYFHV+H+AQD
Sbjct: 250 LQFMFPETNIELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDYFHVFHEAQD 309

Query: 303 FFPYDPYLDAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVM 362
           FFPYDPY D FFCFHPGF APES + W+ KT+  LLETKCA+F TG N+  L RD+  V+
Sbjct: 310 FFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLRRDVGTVV 369

Query: 363 DKHSKEIDILMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIEI 415
            KH KE+D+LMEP  N +GSTKWELND+NPQEVYQFNM+IAGFRGKRYHAIE+
Sbjct: 370 GKHGKELDMLMEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIEV 422

>Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/410 (70%), Positives = 333/410 (81%), Gaps = 1/410 (0%)

Query: 6   RLCRPITQRRTIIGFVRNALGLXXXXXXXXXXXENRFHLWDQSPAGDXXXXXXXXXXXXQ 65
           RL      RR ++GFVRNALGL           ENRFH WDQSP+ D             
Sbjct: 25  RLVLSHQTRRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAH 84

Query: 66  CPVTGKEINYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEF 125
           CPVTGK+INYTCPLSGIPTHHS+EAWE DK YH+SKK+E+LKKVNIYEHDLRSGRPFPEF
Sbjct: 85  CPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEF 144

Query: 126 DFPQDLEFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSL 185
           DFPQ+  +D+ VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYPITI S+L++FSPYSL
Sbjct: 145 DFPQNQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSL 204

Query: 186 NPKGPITLEGLKSLAALRYTLYPFENKT-VAATKDRPMRLFILGARAEALLPGHVWKQLQ 244
           NPKGPITLEGLKSLAALRYTLYP EN++ + ATK+R MR+FILGARAEA LPGHVWKQLQ
Sbjct: 205 NPKGPITLEGLKSLAALRYTLYPLENRSLLTATKNRAMRIFILGARAEAQLPGHVWKQLQ 264

Query: 245 FLFPETAFELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQDFF 304
           FLFPE  FE+HFIGPECL  ++K +YV S  PVV+R+DETL F++ TD+F V+H+AQDFF
Sbjct: 265 FLFPEQNFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIHRTDFFEVFHEAQDFF 324

Query: 305 PYDPYLDAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVMDK 364
           PYDPY+D FF FHPG+ +PES   W+ +T+  LLETKCAIF TG NK  L  D+N V  K
Sbjct: 325 PYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDLNLVKSK 384

Query: 365 HSKEIDILMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIE 414
           + KE+DILM+P KN++GSTKWELND+NPQEVYQFNMYIAGFRGKRYH I+
Sbjct: 385 YGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.346
           YLR203C
          Length = 436

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/407 (69%), Positives = 331/407 (81%), Gaps = 2/407 (0%)

Query: 10  PITQRRTIIGFVRNALGLXXXXXXXXXXXENRFHLWDQSPAGDXXXXXXXXXXXXQCPVT 69
           P +Q+R+++GFV+NALGL           ENRFH WDQSP+ D            +CPVT
Sbjct: 29  PSSQKRSLMGFVKNALGLDPSPSPDDPTPENRFHPWDQSPSPDLRERAARIRTLAKCPVT 88

Query: 70  GKEINYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEFDFPQ 129
            KEINYTCPLSGIPTHHS+EAWE DK YH+SK++E+LKKVNIYEHDLRSGRPFPEFDFP 
Sbjct: 89  KKEINYTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEHDLRSGRPFPEFDFPL 148

Query: 130 DLEFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSLNPKG 189
           D   DR VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYP+TI S+L+QFSPYSLNPKG
Sbjct: 149 DQIHDRVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILHQFSPYSLNPKG 208

Query: 190 PITLEGLKSLAALRYTLYPFENKTVAATK--DRPMRLFILGARAEALLPGHVWKQLQFLF 247
           PITLEGLKSLAALRY+LYPF+ K+  + K  DRPMR+FILGARAEA LPGHVWKQLQFLF
Sbjct: 209 PITLEGLKSLAALRYSLYPFQRKSNISLKLHDRPMRIFILGARAEAQLPGHVWKQLQFLF 268

Query: 248 PETAFELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQDFFPYD 307
           P+  FE+HFIG ECL+N EK++Y+ S  PVVK+IDET+  +YH+DYFHVYH+AQDF PYD
Sbjct: 269 PDQTFEIHFIGTECLLNNEKNKYIKSAIPVVKKIDETMKLIYHSDYFHVYHEAQDFVPYD 328

Query: 308 PYLDAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVMDKHSK 367
           PYLD FF FHPGF APE++ LW+  T+  LLETKCAIF TG NK  +  D+  V  ++ K
Sbjct: 329 PYLDVFFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITNDVEIVKARYGK 388

Query: 368 EIDILMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIE 414
           E+D LM+P KN YGSTKWELND+NPQE++QFNMY+AGFRGKRYH I+
Sbjct: 389 EMDTLMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIK 435

>YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON}
           MSS51Specific translational activator for the
           mitochondrial COX1 mRNA; loosely associated with the
           matrix face of the mitochondrial inner membrane;
           influences both COX1 mRNA translation and Cox1p assembly
           into cytochrome c oxidase
          Length = 436

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/410 (70%), Positives = 332/410 (80%), Gaps = 1/410 (0%)

Query: 6   RLCRPITQRRTIIGFVRNALGLXXXXXXXXXXXENRFHLWDQSPAGDXXXXXXXXXXXXQ 65
           RL      RR ++GFVRNALGL           ENRFH WDQSP+ D             
Sbjct: 25  RLVVSHQTRRHLMGFVRNALGLDPPPSPEDPTPENRFHPWDQSPSVDLRERAAKIRTLAH 84

Query: 66  CPVTGKEINYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEF 125
           CPVTGK+INYTCPLSGIPTHHS+EAWE DK YH+SKK+E+LKKVNIYEHDLRSGRPFPEF
Sbjct: 85  CPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEF 144

Query: 126 DFPQDLEFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSL 185
           DFPQ   +D+ VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYPITI S+L++FSPYSL
Sbjct: 145 DFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSL 204

Query: 186 NPKGPITLEGLKSLAALRYTLYPFENKTV-AATKDRPMRLFILGARAEALLPGHVWKQLQ 244
           NPKGPITLEGLKSLAALRYTLYP EN+++   TK+R MR+FILGARAEA LPGHVWKQLQ
Sbjct: 205 NPKGPITLEGLKSLAALRYTLYPLENRSLPTTTKNRAMRIFILGARAEAQLPGHVWKQLQ 264

Query: 245 FLFPETAFELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQDFF 304
           FLFPE +FE+HFIGPECL  ++K +YV S  PVV+R+DETL F+Y T++F V+H+AQDFF
Sbjct: 265 FLFPEQSFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIYRTNFFEVFHEAQDFF 324

Query: 305 PYDPYLDAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVMDK 364
           PYDPY+D FF FHPG+ +PES   W+ +T+  LLETKCAIF TG NK  L  DIN V  K
Sbjct: 325 PYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDINLVKSK 384

Query: 365 HSKEIDILMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIE 414
           + KE+D+LMEP +N++GSTKWELND+NPQEVYQFNMYIAGFRGKRYH I+
Sbjct: 385 YGKEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR203C
           (MSS51) - involved in maturation of COX1 and COB mRNA
           [contig 161] FULL
          Length = 422

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/413 (69%), Positives = 338/413 (81%), Gaps = 1/413 (0%)

Query: 4   SIRLCRPITQRRTIIGFVRNALGLXXXXXXXXXXXENRFHLWDQSPAGDXXXXXXXXXXX 63
           S+R      Q+R I+GFVRNALGL           ENRFH WDQSP+ D           
Sbjct: 10  SLRNSHCSLQKRHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRERAATIRAL 69

Query: 64  XQCPVTGKEINYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFP 123
            +CPVTG+EINYTCP SGIPTHHS+EAWE+D  Y +SK+ E+LKKVNIYEHDLRSGRPFP
Sbjct: 70  AKCPVTGREINYTCPKSGIPTHHSREAWEKDLDYQQSKRPEILKKVNIYEHDLRSGRPFP 129

Query: 124 EFDFPQDLEFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPY 183
           EFDFP D +FDR VN+TNWDLFFYTR F+SMDTEFQLAAVTKMLSYPITI SVL+QFSPY
Sbjct: 130 EFDFPLDQDFDRMVNLTNWDLFFYTRGFFSMDTEFQLAAVTKMLSYPITIGSVLHQFSPY 189

Query: 184 SLNPKGPITLEGLKSLAALRYTLYPFENKTVAA-TKDRPMRLFILGARAEALLPGHVWKQ 242
           SLNPKGPITLEGLKSLAALRYTLYP +N+ V +  K+ P+R+F+LGARAEA LPGHVWKQ
Sbjct: 190 SLNPKGPITLEGLKSLAALRYTLYPDQNRRVTSIAKNSPLRIFVLGARAEAQLPGHVWKQ 249

Query: 243 LQFLFPETAFELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQD 302
           LQF+FPET  E+HF+GPE   ++ K +YV S AP+++R+DETL+FVYHTDYFHV+H+AQD
Sbjct: 250 LQFMFPETQMEIHFVGPESYYDRNKREYVHSAAPIIRRVDETLNFVYHTDYFHVFHEAQD 309

Query: 303 FFPYDPYLDAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVM 362
           FFPYDPY D FFCFHPGF APES + W+ KT+  LLETKCAIF TG N+  L RD++AV+
Sbjct: 310 FFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAIFTTGFNEVDLQRDLDAVV 369

Query: 363 DKHSKEIDILMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIEI 415
            ++ KE+DI+M+P KN +GSTKWELNDVNPQEVYQFNM++AGFRGKRYHAIE+
Sbjct: 370 AEYGKELDIIMDPAKNAFGSTKWELNDVNPQEVYQFNMFMAGFRGKRYHAIEV 422

>NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {ON}
           Anc_7.346 YLR203C
          Length = 429

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/403 (69%), Positives = 325/403 (80%), Gaps = 1/403 (0%)

Query: 13  QRRTIIGFVRNALGLXXXXXXXXXXXENRFHLWDQSPAGDXXXXXXXXXXXXQCPVTGKE 72
           Q R ++GFVRNALGL           ENRFH WDQSP+ D            +CPVTGKE
Sbjct: 26  QTRHLMGFVRNALGLDPPTSPDDPTPENRFHPWDQSPSPDLRERAARIRTLARCPVTGKE 85

Query: 73  INYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEFDFPQDLE 132
           INYTCP+SGIPTHHS+EAWEQDK+YH SK++ELLKKVNIYEHDLRSGRPFPEFDFP+D  
Sbjct: 86  INYTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLRSGRPFPEFDFPRDQG 145

Query: 133 FDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSLNPKGPIT 192
            DR VNMTNWDLF YTR FYSMDTEFQ+AAVTKMLSYPITI SVL+QFSPYSL PKGPI+
Sbjct: 146 QDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVLHQFSPYSLQPKGPIS 205

Query: 193 LEGLKSLAALRYTLYPFENK-TVAATKDRPMRLFILGARAEALLPGHVWKQLQFLFPETA 251
           LEGLKSLAALRYTLYP +N+  ++ TK RPMR+FILGARAE+ LPGHVWKQLQ+LFPE  
Sbjct: 206 LEGLKSLAALRYTLYPMQNRLVISTTKARPMRIFILGARAESQLPGHVWKQLQYLFPEQT 265

Query: 252 FELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQDFFPYDPYLD 311
           FE+HFIGPE   +K+K +Y+    P+ + +DETL  +YHT+YFH  H+AQDFFPYDPY+D
Sbjct: 266 FEIHFIGPESYYDKDKKKYIQLTTPITESVDETLKLIYHTEYFHKLHEAQDFFPYDPYMD 325

Query: 312 AFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVMDKHSKEIDI 371
            FF FHPGF + E  + W++ T+ GLL+TKCAIF TG  K+ LL DI  V DK+ KE+DI
Sbjct: 326 VFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLEDIAVVQDKYGKELDI 385

Query: 372 LMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIE 414
           LM+PTKN++GSTKWELND+NPQEVYQFNMYIAGFRGKRY  I+
Sbjct: 386 LMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIK 428

>Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {ON}
           similar to Ashbya gossypii ACL152W
          Length = 429

 Score =  600 bits (1548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/412 (66%), Positives = 332/412 (80%), Gaps = 1/412 (0%)

Query: 4   SIRLCRPITQRRTIIGFVRNALGLXXXXXXXXXXXENRFHLWDQSPAGDXXXXXXXXXXX 63
           S R+C    QRR I+GFVRNALGL           +NRFH WDQSP+ +           
Sbjct: 19  SSRVCGK-QQRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWDQSPSPELRERAARIKAL 77

Query: 64  XQCPVTGKEINYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFP 123
            +CPVTGK I ++C  SGIPTHHS+EAW+ D +YHESK++ LLKKVNIYEHDLRSGRPF 
Sbjct: 78  AKCPVTGKNIQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLLKKVNIYEHDLRSGRPFL 137

Query: 124 EFDFPQDLEFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPY 183
           EFDFP+  ++DR VNM NWDL+FYTR F+SMDTEFQLAAVTKMLSYPITI S+L+Q+SPY
Sbjct: 138 EFDFPEQQDYDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKMLSYPITIGSILHQYSPY 197

Query: 184 SLNPKGPITLEGLKSLAALRYTLYPFENKTVAATKDRPMRLFILGARAEALLPGHVWKQL 243
           SLNPKGPITLEGLKSLAALRYTLYP +N+ V + +D+P+R+FILGARAEA LPGHVWKQL
Sbjct: 198 SLNPKGPITLEGLKSLAALRYTLYPEQNRRVRSIQDKPLRVFILGARAEAQLPGHVWKQL 257

Query: 244 QFLFPETAFELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQDF 303
           Q+LFPE+  ELHF+GPE   ++EK +YV+S  PVVKRID+T+   YHTDYFHV+H+AQDF
Sbjct: 258 QYLFPESLIELHFVGPESNYDREKREYVTSSIPVVKRIDDTMKMHYHTDYFHVFHEAQDF 317

Query: 304 FPYDPYLDAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVMD 363
           FPYDPY D FFCFHPGFG+PE+   W+  T+  LL+TKCAIF TG NK  L+ D+ AV +
Sbjct: 318 FPYDPYNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFTTGFNKKDLMDDLQAVKE 377

Query: 364 KHSKEIDILMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIEI 415
           K+  E+D+L++PTKN++GSTKWELND+NP EVYQFNMYIAGFRGKRYHAIE+
Sbjct: 378 KYGDELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHAIEL 429

>KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]
           {ON} similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 418

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/409 (68%), Positives = 327/409 (79%), Gaps = 3/409 (0%)

Query: 8   CRPITQRRTIIGFVRNALGLXXXXXXXXXXXENRFHLWDQSPAGDXXXXXXXXXXXXQCP 67
            +P+T  R I+GFVRNALGL           ENRFH WDQSP+ D             CP
Sbjct: 12  AKPMT--RPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCP 69

Query: 68  VTGKEINYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEFDF 127
           VT K+I +TCPLSGIPTHHS+EAWE+D +YH+SK++ELLKKVNIYEHDLRSGRPFPEFDF
Sbjct: 70  VTHKDIQFTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDF 129

Query: 128 PQDLEFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSLNP 187
           PQD ++DR VNM+NWDLFFYTR FYSMDTEFQLAAVTKMLSYPITI SVL+Q+SPYSLNP
Sbjct: 130 PQDQDYDRMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNP 189

Query: 188 KGPITLEGLKSLAALRYTLYPFENKTVAATKDRPMRLFILGARAEALLPGHVWKQLQFLF 247
           KGPITLEGLKSLAALRYTLYP ++    A +D P+R+FILG RAEA LPGHVWKQLQ+L 
Sbjct: 190 KGPITLEGLKSLAALRYTLYPEQSGRFRAGQDTPIRIFILGTRAEAQLPGHVWKQLQYLI 249

Query: 248 PETAFELHFIGPECLVNKEKHQYV-SSPAPVVKRIDETLSFVYHTDYFHVYHDAQDFFPY 306
           P+T+ ELHF+GPE   ++EK  YV SS   +VKRIDE +   YHTD+FHV+H+AQDFFPY
Sbjct: 250 PDTSIELHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVFHEAQDFFPY 309

Query: 307 DPYLDAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVMDKHS 366
           DPY D FFCFHPGF APE+ + W+  T+  L++TKCA+F TG +K  LLRDI+ V DK+ 
Sbjct: 310 DPYNDVFFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQDKYG 369

Query: 367 KEIDILMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIEI 415
            E+D+LMEP  N++GSTKWELND NP EVYQFNMYIAGFRGKRYHAIE+
Sbjct: 370 SELDMLMEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIEL 418

>CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203c MSS51
          Length = 437

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/417 (66%), Positives = 322/417 (77%), Gaps = 15/417 (3%)

Query: 14  RRTIIGFVRNALGLXXXXXXXXXXXENRFHLWDQSPAGDXXXXXXXXXXXXQCPVTGKEI 73
           +R ++GFVRNALGL           +NRFH WDQSPA D            +CPVT K I
Sbjct: 21  KRQLMGFVRNALGLDPPPSPDEPTEQNRFHPWDQSPAVDLRERAARIKTLAKCPVTHKPI 80

Query: 74  NYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEFDFPQDLEF 133
            YTCP+SGIPTHHS+EAWEQDK+YH SKK+E+LKKVNIYEHDLRSGRPFPEFDFP+D   
Sbjct: 81  QYTCPISGIPTHHSREAWEQDKEYHASKKYEILKKVNIYEHDLRSGRPFPEFDFPRDQGP 140

Query: 134 DRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSLNPKGPITL 193
           DRTVN+TNWDLF YTR FYSMDTEFQLAAVTKMLSYPITI SVL+QFSPYSLNPKGPITL
Sbjct: 141 DRTVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQFSPYSLNPKGPITL 200

Query: 194 EGLKSLAALRYTLYPFENKTVAAT-KDRPMRLFILGARAEALLPGHVWKQLQFLFPETAF 252
           EGLKSLAALRYTLYP +N+ V  T K++PMR+FILGARAEA LPGHVWKQLQFLFP+  F
Sbjct: 201 EGLKSLAALRYTLYPLQNRAVTTTAKNKPMRIFILGARAEAQLPGHVWKQLQFLFPQQNF 260

Query: 253 ELHFIGPECLVNKEKHQYV--------------SSPAPVVKRIDETLSFVYHTDYFHVYH 298
           E+HFIGPE L ++E+++Y+              +S  PV KRIDET+ F YHTDYFH  H
Sbjct: 261 EIHFIGPESLYDRERNEYIRSATANGETAADGTTSSIPVTKRIDETMKFFYHTDYFHTLH 320

Query: 299 DAQDFFPYDPYLDAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDI 358
            AQDFFPYDPY D FF FHPG  +PES   W++ T+ GLL+TKCAIF TG NK  +  DI
Sbjct: 321 TAQDFFPYDPYQDVFFMFHPGLASPESKDTWMKDTVKGLLDTKCAIFTTGFNKKDMADDI 380

Query: 359 NAVMDKHSKEIDILMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIEI 415
             + D + KE+D+LM P KN++GSTKWEL+D +P  VYQFNMYIAGFRGKRYH I++
Sbjct: 381 QILQDTYGKEMDMLMNPVKNVFGSTKWELDDSDPHSVYQFNMYIAGFRGKRYHPIKV 437

>KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {ON}
           Anc_7.346 YLR203C
          Length = 438

 Score =  588 bits (1516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/414 (66%), Positives = 321/414 (77%), Gaps = 9/414 (2%)

Query: 10  PITQRRTIIGFVRNALGLXXXXXXXXXXXENRFHLWDQSPAGDXXXXXXXXXXXXQCPVT 69
           P   RR ++GFVRNALGL           ENRFH WDQSP               +CPVT
Sbjct: 24  PCIARRQLMGFVRNALGLEPPPSPMDPTPENRFHPWDQSPVDALRERAARIKTLAKCPVT 83

Query: 70  GKEINYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEFDFPQ 129
           G  + YTCPLSGIPTHHS+EAWEQD +YH +K++E LKKVNIYEHDLRSGRPFPEFDFPQ
Sbjct: 84  GLNVEYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLRSGRPFPEFDFPQ 143

Query: 130 DLEFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSLNPKG 189
           +  +D+ VNMTNWDLFFYTR FYSMDTEFQLAAVTKMLSYP+TIAS+L QFSPYSLNPKG
Sbjct: 144 EQGYDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLLAQFSPYSLNPKG 203

Query: 190 PITLEGLKSLAALRYTLYP--FENK-------TVAATKDRPMRLFILGARAEALLPGHVW 240
           PITLEGLKSLAA+RYTLY   F N        T  A K+RPMRLF+LGARAEA LPGHVW
Sbjct: 204 PITLEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLGARAEAQLPGHVW 263

Query: 241 KQLQFLFPETAFELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDA 300
           KQL +LFPE +FE+ FIGPE   ++ + QYV SP PVV+++DETL F+++TDYFHV H++
Sbjct: 264 KQLSYLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFIHYTDYFHVLHES 323

Query: 301 QDFFPYDPYLDAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINA 360
           QDFFPYDPY D FF FHPGF +PE+   WL  T+P LL+TKCAIF TG ++  L+ D+  
Sbjct: 324 QDFFPYDPYFDCFFTFHPGFASPENRDTWLSNTLPALLDTKCAIFTTGFDRDDLMNDVAL 383

Query: 361 VMDKHSKEIDILMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIE 414
           + +K   E+DILMEPTKN++GSTKWELND+NP EVYQFNMYIAGFRGKRYH I+
Sbjct: 384 LNEKFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHTIK 437

>ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR203C (MSS51)
          Length = 428

 Score =  585 bits (1508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/403 (66%), Positives = 319/403 (79%), Gaps = 1/403 (0%)

Query: 13  QRRTIIGFVRNALGLXXXXXXXXXXXENRFHLWDQSPAGDXXXXXXXXXXXXQCPVTGKE 72
           QRR I+GFVRNALGL           ENRFH+W+QSP+ D            +CPVTGK+
Sbjct: 27  QRRPIMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDLRERAARIRALARCPVTGKD 86

Query: 73  INYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEFDFPQDLE 132
           I Y+C  SGIPTHHS+EAWEQD++YH SK+W  L+KVN+YEHDLRSGRPF EFDFPQ+  
Sbjct: 87  IRYSCERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQEQG 146

Query: 133 FDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSLNPKGPIT 192
            DR VNM NWDLF YTRQFYSMDT+FQLAAVTKMLSYPITI S+L+QFSPY+L P+GPIT
Sbjct: 147 RDRMVNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGPIT 206

Query: 193 LEGLKSLAALRYTLYPFENKTVAATKDRPMRLFILGARAEALLPGHVWKQLQFLFPETAF 252
           LEGLKSLAALRYTLYP E+++  A + +PMR+FILGARAEA LPGHVWKQLQ+LFP +  
Sbjct: 207 LEGLKSLAALRYTLYP-ESESARAVRSKPMRIFILGARAEAQLPGHVWKQLQYLFPGSNM 265

Query: 253 ELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQDFFPYDPYLDA 312
           E+HFIGPE L ++++ +YV S  PV KR+D TL  V+HTDY HV+H+AQDFFPYDPY D 
Sbjct: 266 EIHFIGPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHVFHEAQDFFPYDPYNDV 325

Query: 313 FFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVMDKHSKEIDIL 372
           FFCFHPGF + E    W++KT+P LLETKCAIF TG ++  +  D  A+   H  E+D+L
Sbjct: 326 FFCFHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALRASHDAEMDVL 385

Query: 373 MEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIEI 415
           M PTKNI+GSTKWELND+NP EVYQFNMYIAGFRGKRYHAI++
Sbjct: 386 MHPTKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQV 428

>NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa]
           {ON} Anc_7.346 YLR203C
          Length = 443

 Score =  573 bits (1478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/402 (65%), Positives = 318/402 (79%), Gaps = 1/402 (0%)

Query: 15  RTIIGFVRNALGLXXXXXXXXXXXENRFHLWDQSPAGDXXXXXXXXXXXXQCPVTGKEIN 74
           R+++GFVRNALGL           ENRFH WDQSP  D             CPVT KEIN
Sbjct: 42  RSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKIRTLAHCPVTNKEIN 101

Query: 75  YTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEFDFPQDLEFD 134
           YTCP+SGIPTHHSK AWE D+ YH +K +E+LKKVNIYEHDLRSGRPFPEF FPQD +FD
Sbjct: 102 YTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGRPFPEFVFPQDQDFD 161

Query: 135 RTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSLNPKGPITLE 194
           R +NMTNWDLF YTR FYSMDTEFQ+AAVTKMLSYPITI S+L+QFSPYSL PKGPITLE
Sbjct: 162 RMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQFSPYSLQPKGPITLE 221

Query: 195 GLKSLAALRYTLYPFENKT-VAATKDRPMRLFILGARAEALLPGHVWKQLQFLFPETAFE 253
           GLKS+AALRYTLYPF NK+ +  TK+RPMR+F+LGARAEA LPGH+WKQLQ+LFPE  FE
Sbjct: 222 GLKSMAALRYTLYPFHNKSFMTLTKNRPMRIFLLGARAEAQLPGHIWKQLQYLFPEQKFE 281

Query: 254 LHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQDFFPYDPYLDAF 313
           L FIGPE   +KEK QY+    P+++ ID+TL   + T+YFH  H++QD FPYDPY+D F
Sbjct: 282 LFFIGPEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHESQDLFPYDPYMDVF 341

Query: 314 FCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVMDKHSKEIDILM 373
           F FHPGF A E+T+ W+  T+  LLET+CAIF TG +++ +L D+N + +K+  ++DILM
Sbjct: 342 FIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMNILDEKYKNDLDILM 401

Query: 374 EPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIEI 415
           +P KN++GSTKWELND+NPQ+VYQFNMYIAGFRGKRY  +E+
Sbjct: 402 KPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVEL 443

>NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON}
           Anc_7.346 YLR203C
          Length = 427

 Score =  555 bits (1430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/404 (63%), Positives = 314/404 (77%), Gaps = 3/404 (0%)

Query: 11  ITQRRTIIGFVRNALGLXXXXXXXXXXXENRFHLWDQSPAGDXXXXXXXXXXXXQCPVTG 70
           I+  RT++GFV+NALG+            NRF+ WD+SP+              +CPVTG
Sbjct: 26  ISSHRTLVGFVKNALGIDPPPLPTEPVFANRFYPWDESPSPAIRERAARIKAQAKCPVTG 85

Query: 71  KEINYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEFDFPQD 130
           KEI +TCPLSGIPTH+SKEAWE D  YH++K +E L+KVNIYEHDLRSGRPFPEFDFP +
Sbjct: 86  KEIRFTCPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKVNIYEHDLRSGRPFPEFDFPGE 145

Query: 131 LEFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSLNPKGP 190
              D TVNMTNWDLFFYTRQFYSMDTEFQLA VTKMLSYPITI S+L ++SPY+L PKGP
Sbjct: 146 QARDSTVNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSYPITIGSILYKYSPYNLIPKGP 205

Query: 191 ITLEGLKSLAALRYTLYPFENKTVAATKDRPMRLFILGARAEALLPGHVWKQLQFLFPET 250
           +TLEGLKSLAALRYTL    N   A TK RPMR+FILGARAE+ LP H+WKQLQFLFP  
Sbjct: 206 VTLEGLKSLAALRYTL---RNNAFATTKTRPMRIFILGARAESQLPIHIWKQLQFLFPAQ 262

Query: 251 AFELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQDFFPYDPYL 310
           AFE++FIGPEC + ++   Y+SS + +VKR+DE+L+  Y+ DYF  +H AQDFFPYDPY 
Sbjct: 263 AFEINFIGPECSLLEQDSNYLSSDSRIVKRVDESLTLAYYPDYFDKFHKAQDFFPYDPYN 322

Query: 311 DAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVMDKHSKEID 370
           D FF FHPGF +PES+K W+  T+  LL+TKCAIF TG ++  +++DI +V D + +E+D
Sbjct: 323 DIFFTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTGFSQDDIMKDITSVQDTYGEEVD 382

Query: 371 ILMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIE 414
           +LM P KN++GSTKWELND+NPQ+VYQFNMYIAGFRGKRYH ++
Sbjct: 383 MLMNPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGKRYHTVK 426

>TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346
           YLR203C
          Length = 437

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/413 (61%), Positives = 314/413 (76%), Gaps = 13/413 (3%)

Query: 13  QRRTIIGFVRNALGLXXXXXXXXXXXENRFHLWDQSPAGDXXXXXXXXXXXXQCPVTGKE 72
            +R ++GFVR+ LGL           ENRFH W+ SP  D            +CPV+  +
Sbjct: 23  SKRNLMGFVRSTLGLDPPPSPNDPTPENRFHPWETSPCDDLRERAARIKTMAKCPVSNLD 82

Query: 73  INYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEFDFPQDLE 132
           INYTCP+SGIPTHHS++ WE D  YH++   ++LKKVNIYEHDLRSGRPFPEFDFP++ E
Sbjct: 83  INYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYEHDLRSGRPFPEFDFPREQE 142

Query: 133 FDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSLNPKGPIT 192
           +D  +N+ NWDL+FYTR F+SMDTEFQLAAVTKMLSYP+TIASVL+QFSPYSL PKGP+T
Sbjct: 143 YDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTIASVLHQFSPYSLTPKGPVT 202

Query: 193 LEGLKSLAALRYTLY----------PFENKTVAAT-KDRPMRLFILGARAEALLPGHVWK 241
           LEGLKSLAALRYTL             ++ T+ AT K+RPMR+FILGARAEA LP HVWK
Sbjct: 203 LEGLKSLAALRYTLNNNSLSDTSSGNSDSTTITATSKNRPMRIFILGARAEAQLPPHVWK 262

Query: 242 QLQFLFPETAFELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQ 301
           QLQ+LFP + FE+HFIGPE L++K+K  YV+S  P+ KRID+++S VYHTDYFHVYH AQ
Sbjct: 263 QLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITKRIDDSMSLVYHTDYFHVYHKAQ 322

Query: 302 DFFPYDPYLDAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAV 361
           DF+PYDPY D FF FHPG  A + T  WL +T+ GLL++KC IF TG ++  +  DI+ +
Sbjct: 323 DFYPYDPYFDIFFMFHPGLAATKET--WLNETMQGLLDSKCPIFMTGFHEKDITADISVL 380

Query: 362 MDKHSKEIDILMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIE 414
               SK++DILM+P KN++GSTKWELND NPQEVYQFNMYIAG+RGKRYHA E
Sbjct: 381 NKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYRGKRYHATE 433

>KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.346
           YLR203C
          Length = 426

 Score =  542 bits (1397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/403 (63%), Positives = 305/403 (75%), Gaps = 3/403 (0%)

Query: 15  RTIIGFVRNALGLXXXXXXXXXXXENRFHLWDQSPAGDXXXXXXXXXXXXQCPVTGKEIN 74
           RT++GFVRNALGL            NRF+ WDQSP+ +            +CP+TGKEIN
Sbjct: 25  RTLVGFVRNALGLEPPPTPDEPRVSNRFYPWDQSPSPELRERAAKIKAMARCPITGKEIN 84

Query: 75  YTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEFDFPQDLEFD 134
           YTCP+SGIPTHHS+EAWEQD+ YH +K  ++LKKVNIYEHDLRSGR FPEFDFP D  FD
Sbjct: 85  YTCPISGIPTHHSREAWEQDEAYHRNKIPDILKKVNIYEHDLRSGRSFPEFDFPSDQTFD 144

Query: 135 RTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSLNPKGPITLE 194
           R VN+ NWDL+FYTR FYSMDTEFQLA VTKMLSYPITIASVL+Q+SPYSL P GPITLE
Sbjct: 145 RAVNLANWDLYFYTRSFYSMDTEFQLATVTKMLSYPITIASVLHQYSPYSLYPHGPITLE 204

Query: 195 GLKSLAALRYTLYPFENKTVAAT--KDRPMRLFILGARAEALLPGHVWKQLQFLFPETAF 252
           GLKS+AALRY+LYP ++K+  +   K RPMR+FILGARAE+ LPGHVWKQ Q+LFP   F
Sbjct: 205 GLKSIAALRYSLYPSQHKSSRSVLNKTRPMRIFILGARAESQLPGHVWKQFQYLFPLQTF 264

Query: 253 ELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQDFFPYDPYLDA 312
           E+ FIGPEC + +E    V     +VKRID+T+S VYH   FH  H AQDFFPYDPY D 
Sbjct: 265 EIIFIGPECQL-REPSNSVGGANNIVKRIDDTISLVYHPKLFHDIHKAQDFFPYDPYNDV 323

Query: 313 FFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVMDKHSKEIDIL 372
           FF FHPGF +PE+ +LW+  T+  LL+TKCA+F TG +K  L  D+  +   +  ++D L
Sbjct: 324 FFVFHPGFASPETKELWMNDTVKALLDTKCAVFHTGFSKKDLSNDVKLLNKMYGDKLDTL 383

Query: 373 MEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIEI 415
           M P KN++GSTKWELND+NPQEVYQFNMYI+ FRGKRYH IEI
Sbjct: 384 MTPVKNLFGSTKWELNDLNPQEVYQFNMYISAFRGKRYHPIEI 426

>KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.346
           YLR203C
          Length = 424

 Score =  538 bits (1386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/404 (62%), Positives = 304/404 (75%), Gaps = 5/404 (1%)

Query: 12  TQRRTIIGFVRNALGLXXXXXXXXXXXENRFHLWDQSPAGDXXXXXXXXXXXXQCPVTGK 71
           T  RTI+G+VRNA GL            NRFH W++SP  D            +CPVTGK
Sbjct: 26  TFHRTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCPVTGK 85

Query: 72  EINYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEFDFPQDL 131
            INYTCP+SGIPTHHS++AWE D  YH++K +E LKKVNIYEHDLRSGR FPEFDFP + 
Sbjct: 86  NINYTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDFPAEQ 145

Query: 132 EFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSLNPKGPI 191
             DR VN+ NWDLF YTRQFYSMDTEF LA VTKMLSYPITIASVL++FSPY L P+GP+
Sbjct: 146 GRDRAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQPRGPV 205

Query: 192 TLEGLKSLAALRYTLYPFENKTVAATKDRPMRLFILGARAEALLPGHVWKQLQFLFPETA 251
           TLEGLKS+AALRYTLYP   KT + + + PMR+FI+G RAE+ LPGHVWKQLQ+LF E  
Sbjct: 206 TLEGLKSIAALRYTLYPKLGKT-SLSNNSPMRIFIVGTRAESQLPGHVWKQLQYLFSERI 264

Query: 252 FELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQDFFPYDPYLD 311
           FE+HFIGPEC + + K    ++  P++K++D+TLS +YH  YFH  H + D FPY+PY D
Sbjct: 265 FEIHFIGPECQLKEPK----NTSTPLIKKVDDTLSLIYHPQYFHELHKSGDLFPYNPYKD 320

Query: 312 AFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVMDKHSKEIDI 371
            FF FHPGF  P++ KLWL++TIP LLETKCAIF TG N+  +  D+  +   +  EID+
Sbjct: 321 VFFIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVTLIDKCYRNEIDV 380

Query: 372 LMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIEI 415
           LM+P KN++GS KWELND+NPQEVYQFNMYIAGFRGKRYH I+I
Sbjct: 381 LMKPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPIKI 424

>NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {ON}
           Anc_7.346 YLR203C
          Length = 450

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/415 (60%), Positives = 315/415 (75%), Gaps = 17/415 (4%)

Query: 15  RTIIGFVRNALGLXXXXXXXXXXXENRFHLWDQSPAGDXXXXXXXXXXXXQCPVTGKEIN 74
           R  +GFV+NALG+           ENRFH WDQSP+ D            +CPVTGKEIN
Sbjct: 39  RHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDLRERAARIRALAKCPVTGKEIN 98

Query: 75  YTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEFDFPQDLEFD 134
           YTCP+SGIPTHHSKEAWE D  YH++K +++LKKVN++EHDLRSGR FPEF+FPQ  + D
Sbjct: 99  YTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRSFPEFEFPQSQDHD 158

Query: 135 RTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSLNPKGPITLE 194
             V+M NWD+FFYTRQF SMD+EFQLA VTKMLSYPITIAS+L+++ PY+L P GPITLE
Sbjct: 159 CAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYCPYALEPNGPITLE 218

Query: 195 GLKSLAALRYTLYPFENKTVAATKDRPMRLFILGARAEALLPGHVWKQLQFLFPETAFEL 254
           GLKS+AAL+Y+L   E +T   TK+RPMR+FILGARAE+ LP H+WKQ  +LFP   FE+
Sbjct: 219 GLKSIAALKYSLRHNEFET---TKERPMRIFILGARAESQLPEHIWKQFSYLFPFQNFEI 275

Query: 255 HFIGPECLV-------NKEKHQYVSS-------PAPVVKRIDETLSFVYHTDYFHVYHDA 300
           +FIGPEC V       N E+    +S       P  +VKRIDE L+ VYHTD+FH  H+A
Sbjct: 276 NFIGPECSVLMNNNNMNAEETNTTTSGSMTEIRPNRIVKRIDERLNLVYHTDFFHTLHNA 335

Query: 301 QDFFPYDPYLDAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINA 360
           +DFFPYD Y D FF FHPGF +PE+TK W+ +T+  LL+TKCAIF TG NK  LL+DI+ 
Sbjct: 336 RDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTTGFNKQDLLKDIDI 395

Query: 361 VMDKHSKEIDILMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIEI 415
           V + + KE+D+LM+PTKN++GSTKWELND++PQEVYQ+NMYIAGFRGKRYHA+++
Sbjct: 396 VQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRGKRYHAVKV 450

>TBLA0H00280 Chr8 complement(43650..48146) [4497 bp, 1498 aa] {ON}
           Anc_2.406 YMR129W
          Length = 1498

 Score = 34.3 bits (77), Expect = 0.76,   Method: Composition-based stats.
 Identities = 21/87 (24%), Positives = 44/87 (50%), Gaps = 7/87 (8%)

Query: 306 YDPYLDAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDIN-AVMDK 364
           ++P+ D+F  F+P F  PE         +P  + +  +I    +N   L ++ N  +++ 
Sbjct: 371 FNPFHDSFCQFNPTFATPEFI------NVPIRINSTSSIKFIQLNYKDLSKNSNEQLLNF 424

Query: 365 HSKEIDILMEPTKNIYGSTKWELNDVN 391
            +K+  ++ +PTK +   TK +L  +N
Sbjct: 425 TNKDFKLIKDPTKLLSKKTKQQLQQIN 451

>Ecym_6270 Chr6 complement(512033..516079) [4047 bp, 1348 aa] {ON}
            similar to Ashbya gossypii AFR573C
          Length = 1348

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 53/131 (40%), Gaps = 20/131 (15%)

Query: 277  VVKRIDETLSFVYHTDYFHVYHDAQDFFPYDPYLDAFFCFHPGFGAPESTKLWLEKT-IP 335
            ++K   E L  ++ TD  H YHD  D       L+  F    G      T L+     +P
Sbjct: 900  ILKGFLEALIELHSTDIVHAYHDRSDGGLLVTLLEMAFASRCGMEITAETSLYSGDAFVP 959

Query: 336  GLLETKCAIFATGVNKSALLRDINAVMDKH----------------SKEIDILMEPTKNI 379
               E   A+F    +K   +++  +++++H                S  I IL +  + I
Sbjct: 960  LFNEELGAVFQISSSK---IKEFKSIIERHGVPASSVTVVAKPNFNSNSITILTDSGEQI 1016

Query: 380  YGSTKWELNDV 390
            + ST+ +L +V
Sbjct: 1017 FESTRGKLQEV 1027

>Kwal_23.5161 s23 (1040608..1045077) [4470 bp, 1489 aa] {ON} YDR011W
           (SNQ2) - ABC transporter [contig 8] FULL
          Length = 1489

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 58/137 (42%), Gaps = 16/137 (11%)

Query: 147 YTRQFYSMDTEFQLAAVTKMLSYPITIASVLN-QFSPYSLNPKGPITLEGLKSLAALRYT 205
           Y  Q  SM   F+  +  + L Y  +  S+LN +F    ++ KG +   G        Y 
Sbjct: 668 YMIQLGSMHPWFKWISYVQPLRY--SFESMLNAEFHAREMDCKGNVIPYGPS------YA 719

Query: 206 LYPFENKTVAATKDRPMRLFILGARAEALLPG----HVWKQLQFLFPETAFELHFIGPEC 261
               EN+  A    RP + F+ G        G    H W+ L F+F   AF L ++  +C
Sbjct: 720 NVSTENQVCAFVGSRPGQPFVTGDDYINTNYGYKYSHTWRNLGFMF---AFFLFYLSLKC 776

Query: 262 LVNKEKHQYVSSPAPVV 278
           ++ + KH  V +   +V
Sbjct: 777 IITEFKHSSVGTGDTLV 793

>KLTH0A03872g Chr1 (326673..328547) [1875 bp, 624 aa] {ON} similar
           to uniprot|P40032 Saccharomyces cerevisiae YER049W
           Hypothetical ORF
          Length = 624

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 39/79 (49%), Gaps = 11/79 (13%)

Query: 322 APESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVMDKHSKEIDILMEPTKNIYG 381
           +P S ++ + +  PG    K    AT +NK+ALL+D+  +       +D ++E T  +  
Sbjct: 480 SPISEQVLIRRFRPG----KDFTLATQLNKNALLKDVEGL-------VDAVLEGTLCLTP 528

Query: 382 STKWELNDVNPQEVYQFNM 400
           S  WE  +V   E+Y  N 
Sbjct: 529 SNGWESGEVGGYELYMDNQ 547

>KAFR0E03570 Chr5 (719253..720824) [1572 bp, 523 aa] {ON} Anc_5.487
           YOR149C
          Length = 523

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 10/34 (29%), Positives = 22/34 (64%)

Query: 363 DKHSKEIDILMEPTKNIYGSTKWELNDVNPQEVY 396
           D+H + ++I+M+   ++ G+T WE +++N    Y
Sbjct: 44  DEHFQSLEIMMKKFMDVSGTTAWEFDNMNAARSY 77

>CAGL0E00957g Chr5 (86682..89627) [2946 bp, 981 aa] {ON} similar to
           uniprot|P89102 Saccharomyces cerevisiae YDR166c SEC5
          Length = 981

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 79/208 (37%), Gaps = 22/208 (10%)

Query: 65  QCPVTGKEINYTCPLSGIPTHHSKEAWEQDK-----KYHESKKWELLKKVNIYEHDLR-S 118
           Q  +T K I     L+ I    S  A    K      +H+ + WE  + VN  + DL  S
Sbjct: 630 QLKITPKSIEIPKKLASIIIGRSVSAISSTKLRDIANFHKLENWEKYEFVNARKDDLNDS 689

Query: 119 GRPFPEFDFPQDLE-FDRTVNMTNWDLFFYTRQF----------YSMDTEFQLAAVTKML 167
              +    FP  ++ F      T  D+ F   +           Y          + +++
Sbjct: 690 NYEYAITQFPTIIKSFQELSIKTIRDIVFSFEKLPTIGGVSIIEYPSKKVLTGIEIQQII 749

Query: 168 SYPITIASVLNQFSPYSLNPKGPITLEGLKSLAALRYTLYP-----FENKTVAATKDRPM 222
           S    + S+L   +    NP+ P T+  L +L  +R + +P     F++      K + +
Sbjct: 750 SMEAVLESILKNAAKDKDNPRNPHTILTLTNLQCIRESTFPDILQFFDDCFEWNLKTKNL 809

Query: 223 RLFILGARAEALLPGHVWKQLQFLFPET 250
            LF L A+ E  + G+    L+    +T
Sbjct: 810 ELFNLLAKMEQSIFGNYLSDLKISLRDT 837

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.139    0.438 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,088,686
Number of extensions: 1920409
Number of successful extensions: 4175
Number of sequences better than 10.0: 33
Number of HSP's gapped: 4226
Number of HSP's successfully gapped: 33
Length of query: 415
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 303
Effective length of database: 40,638,807
Effective search space: 12313558521
Effective search space used: 12313558521
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)