Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F11594g7.344ON30930915800.0
TDEL0C020307.344ON31130611481e-159
SAKL0F11242g7.344ON30930710701e-147
KLLA0D12474g7.344ON31230710321e-141
KLTH0H01386g7.344ON30730610131e-138
Kwal_56.246247.344ON3073089951e-135
Suva_10.2997.344ON3202719691e-131
YLR205C (HMX1)7.344ON3172719531e-129
Skud_12.2687.344ON3182829481e-128
Smik_12.2637.344ON3182719481e-128
Ecym_47297.344ON3263088431e-112
NCAS0E028907.344ON3153078161e-108
Kpol_530.367.344ON3112858001e-106
TPHA0F029207.344ON3202907801e-102
NDAI0E045007.344ON3273007741e-102
CAGL0A03905g7.344ON2822647317e-96
ACL154W7.344ON3192796643e-85
KAFR0L014707.344ON3002746103e-77
KNAG0B026407.344ON3022835782e-72
KLLA0A09141g5.63ON76055780.34
CAGL0K09988g8.216ON196110730.78
TDEL0F027604.74ON45079721.5
TBLA0A017108.462ON974123703.5
Kpol_1013.507.518ON262971686.2
KLTH0E09944g8.426ON113386668.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F11594g
         (309 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar...   613   0.0  
TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON...   446   e-159
SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar...   416   e-147
KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa] ...   402   e-141
KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {O...   394   e-138
Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR20...   387   e-135
Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {O...   377   e-131
YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}  ...   371   e-129
Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {O...   369   e-128
Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {O...   369   e-128
Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON...   329   e-112
NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON...   318   e-108
Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON} ...   312   e-106
TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.34...   305   e-102
NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {...   302   e-102
CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {O...   286   7e-96
ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homol...   260   3e-85
KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.3...   239   3e-77
KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON...   227   2e-72
KLLA0A09141g Chr1 (801373..803655) [2283 bp, 760 aa] {ON} weakly...    35   0.34 
CAGL0K09988g Chr11 (977846..978436) [591 bp, 196 aa] {ON} simila...    33   0.78 
TDEL0F02760 Chr6 (505275..506627) [1353 bp, 450 aa] {ON} Anc_4.7...    32   1.5  
TBLA0A01710 Chr1 (411434..414358) [2925 bp, 974 aa] {ON} Anc_8.4...    32   3.5  
Kpol_1013.50 s1013 complement(110643..118532) [7890 bp, 2629 aa]...    31   6.2  
KLTH0E09944g Chr5 complement(898345..901746) [3402 bp, 1133 aa] ...    30   8.9  

>ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/309 (95%), Positives = 295/309 (95%)

Query: 1   MATIPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAI 60
           MATIPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAI
Sbjct: 1   MATIPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAI 60

Query: 61  EQELDRIMDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYSPEFPTESSLEQFLT 120
           EQELDRIMDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYSPEFPTESSLEQFLT
Sbjct: 61  EQELDRIMDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYSPEFPTESSLEQFLT 120

Query: 121 SGNHLAPTLQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFQ 180
           SGNHLAPTLQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFQ
Sbjct: 121 SGNHLAPTLQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFQ 180

Query: 181 HLSPRELVQRGTNFFTFSEEGSEAENKLRWRYKRGYELATRDELTEEQKQKIISVSSEIF 240
           HLSPRELVQRGTNFFTFSEEGSEAENKLRWRYKRGYELATRDELTEEQKQKIISVSSEIF
Sbjct: 181 HLSPRELVQRGTNFFTFSEEGSEAENKLRWRYKRGYELATRDELTEEQKQKIISVSSEIF 240

Query: 241 QWNMETIAEIGELNRQELMGSVSFRLLTYLHEEWKHTDKLSKNQKDXXXXXXXXXXXXXX 300
           QWNMETIAEIGELNRQELMGSVSFRLLTYLHEEWKHTDKLSKNQKD              
Sbjct: 241 QWNMETIAEIGELNRQELMGSVSFRLLTYLHEEWKHTDKLSKNQKDLLVLAVLVVQFLIV 300

Query: 301 YLVLRRILA 309
           YLVLRRILA
Sbjct: 301 YLVLRRILA 309

>TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON}
           Anc_7.344 YLR205C
          Length = 311

 Score =  446 bits (1148), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 208/306 (67%), Positives = 251/306 (82%), Gaps = 1/306 (0%)

Query: 3   TIPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAIEQ 62
           TIPAPTDVGALANRINFHTRDAHNK+NAYMSVRLAFALKHG+I+RQGILA+Y+IF A+EQ
Sbjct: 7   TIPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHIFDAVEQ 66

Query: 63  ELDRIMDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYSPEFPTESSLEQFLTSG 122
           ELDR+++  +N++E QMQ+VL +FW+ +FRRT+RIF+DL +LYSPE+    SL  F+   
Sbjct: 67  ELDRLLNDPQNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVLYSPEYSDSESLRNFV-EH 125

Query: 123 NHLAPTLQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFQHL 182
             LAP LQ+FVDSIH  VQ++ CTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKF++L
Sbjct: 126 QPLAPQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFEYL 185

Query: 183 SPRELVQRGTNFFTFSEEGSEAENKLRWRYKRGYELATRDELTEEQKQKIISVSSEIFQW 242
           +P+ELV RGTNFFTFS+EGS+AENKLRW+YK GYELATR EL+E QK +I+ VSS+IF W
Sbjct: 186 TPKELVIRGTNFFTFSDEGSDAENKLRWKYKEGYELATRQELSESQKTRILQVSSQIFDW 245

Query: 243 NMETIAEIGELNRQELMGSVSFRLLTYLHEEWKHTDKLSKNQKDXXXXXXXXXXXXXXYL 302
           NM+ I EIGE+NR ELM   SF+LLTYL EEWK++  LSK  KD              Y+
Sbjct: 246 NMDVIGEIGEMNRNELMSKFSFKLLTYLSEEWKYSTILSKRSKDSIIVMAILIQFLVAYI 305

Query: 303 VLRRIL 308
           VLR+ +
Sbjct: 306 VLRKFI 311

>SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  416 bits (1070), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 195/307 (63%), Positives = 243/307 (79%), Gaps = 1/307 (0%)

Query: 2   ATIPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAIE 61
            TIP+PTDVGALANRINFHTRD+HNKINA MSV+LAFA+KHG I+RQGILA+YYIF A+E
Sbjct: 4   TTIPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFAAVE 63

Query: 62  QELDRIMDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYSPEFPTESSLEQFLTS 121
           QE+D ++ +A    E+Q Q +L +FW  +FRR++ IFQDL LLYS E+ T + L  FL  
Sbjct: 64  QEIDNLLQNASTPLELQTQKILNQFWCEEFRRSNMIFQDLELLYSKEYSTRTELHAFL-D 122

Query: 122 GNHLAPTLQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFQH 181
            N L P  QAFV+ IH+ V+E+P TILAYCHVLYLALFAGGK+M+SN+YRHTGLFPKFQH
Sbjct: 123 DNVLPPQQQAFVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLFPKFQH 182

Query: 182 LSPRELVQRGTNFFTFSEEGSEAENKLRWRYKRGYELATRDELTEEQKQKIISVSSEIFQ 241
           L+P ++V+RGTNFFTFSEEG++AE KLRW YK+GYELATR ELTEEQKQ+II VSSEIF 
Sbjct: 183 LTPEQIVRRGTNFFTFSEEGADAEGKLRWEYKKGYELATRKELTEEQKQEIIKVSSEIFD 242

Query: 242 WNMETIAEIGELNRQELMGSVSFRLLTYLHEEWKHTDKLSKNQKDXXXXXXXXXXXXXXY 301
           WNM+ I E+GE+NR ELMG  SF+L++++ EEWK+++KLSK  K               Y
Sbjct: 243 WNMDVIGELGEINRNELMGKFSFKLVSFILEEWKYSEKLSKENKITILVIFAILQFLLAY 302

Query: 302 LVLRRIL 308
            +LR++ 
Sbjct: 303 WLLRKLF 309

>KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa]
           {ON} similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 312

 Score =  402 bits (1032), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 184/307 (59%), Positives = 239/307 (77%), Gaps = 1/307 (0%)

Query: 2   ATIPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAIE 61
            TIP+PTDVGALANRINF TRD HNKINAYMS+++AFA++HG+I+RQGI+AYYY+F AIE
Sbjct: 7   TTIPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYYVFHAIE 66

Query: 62  QELDRIMDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYSPEFPTESSLEQFLTS 121
           QE+DR+++H    ++ +++ +L +FW  +FRR+D++  DL +LY+ E+P    L++FL  
Sbjct: 67  QEIDRLLEHPVTVQDEKVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQLQEFL-D 125

Query: 122 GNHLAPTLQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFQH 181
           G  L   LQ FVD IH NVQ+EP TILAYCHVLYLALFAGG+VM+SNLYRH GLFPKF H
Sbjct: 126 GFQLPAKLQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLFPKFGH 185

Query: 182 LSPRELVQRGTNFFTFSEEGSEAENKLRWRYKRGYELATRDELTEEQKQKIISVSSEIFQ 241
           LSP+ELV+R TNFFTFSEEG + EN+LRW+YK+GYELATR ELTE +K +II VS  IFQ
Sbjct: 186 LSPKELVRRATNFFTFSEEGVDDENRLRWQYKKGYELATRTELTEAEKLRIIEVSQTIFQ 245

Query: 242 WNMETIAEIGELNRQELMGSVSFRLLTYLHEEWKHTDKLSKNQKDXXXXXXXXXXXXXXY 301
            NME +AEIGE+NR ELMG  S++L+++L EEWK+++KL+   K               Y
Sbjct: 246 RNMEVVAEIGEINRAELMGKFSYKLISFLSEEWKYSEKLTPEVKKLIVFALIVFNMVFVY 305

Query: 302 LVLRRIL 308
            +LRR++
Sbjct: 306 TILRRLI 312

>KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 307

 Score =  394 bits (1013), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 184/306 (60%), Positives = 231/306 (75%), Gaps = 1/306 (0%)

Query: 1   MATIPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAI 60
           M TIP+PTDVGALANRINFHTRD HNKI+  MS + AFA+KHG+I+RQG+LA++Y+FQAI
Sbjct: 1   MTTIPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAI 60

Query: 61  EQELDRIMDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYSPEFPTESSLEQFLT 120
           EQELDR+   A+  +E Q +++L +FW  +FRR  RI QDL LLY+ EFPT +SL  FL 
Sbjct: 61  EQELDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTSASLRTFLE 120

Query: 121 SGNHLAPTLQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFQ 180
               LAP LQ FVD +H +++  P  ILAYCHVLYLALFAGG+VMRS +YR TGLFPKF 
Sbjct: 121 ETT-LAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLFPKFP 179

Query: 181 HLSPRELVQRGTNFFTFSEEGSEAENKLRWRYKRGYELATRDELTEEQKQKIISVSSEIF 240
           +L+  E+V+RGTNFFTFS+ G +AEN+LR  YKRGYELATR  LTEEQK  I+ VS+ IF
Sbjct: 180 NLTTEEVVRRGTNFFTFSDAGVQAENQLRKNYKRGYELATRQGLTEEQKLNILDVSNAIF 239

Query: 241 QWNMETIAEIGELNRQELMGSVSFRLLTYLHEEWKHTDKLSKNQKDXXXXXXXXXXXXXX 300
           +WN   + EIGE+NRQELMG +SFRLLT++ EEW+++DKL++ QK               
Sbjct: 240 EWNTRVVTEIGEINRQELMGKLSFRLLTFVIEEWQYSDKLTRKQKSLVLATGVVLQILMM 299

Query: 301 YLVLRR 306
           Y VLR+
Sbjct: 300 YWVLRK 305

>Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR205C
           (HMX1) - Putative heme oxygenase [contig 161] FULL
          Length = 307

 Score =  387 bits (995), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 176/308 (57%), Positives = 240/308 (77%), Gaps = 1/308 (0%)

Query: 1   MATIPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAI 60
           M+TIP+PTDVGALANRINF+TRD HNKI+  MSV+ AFA+KHG+I+RQG+LA++Y+FQAI
Sbjct: 1   MSTIPSPTDVGALANRINFYTRDEHNKIDKQMSVKFAFAMKHGFIYRQGLLAFFYVFQAI 60

Query: 61  EQELDRIMDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYSPEFPTESSLEQFLT 120
           EQE+DR++ +A+  +E+Q +++L +FW++ F RT RI+QDL LLY+ EFP++  L  FL 
Sbjct: 61  EQEIDRLLQNAQTAEEVQTRDILLQFWVSSFSRTPRIYQDLKLLYAKEFPSDEQLSLFLQ 120

Query: 121 SGNHLAPTLQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFQ 180
             N L P  Q FVD +H++V+  P +ILA+CHVLYLALFAGG+VMRS +YR TGLFPKF 
Sbjct: 121 Q-NTLPPEQQGFVDFVHESVRARPTSILAFCHVLYLALFAGGRVMRSTIYRSTGLFPKFP 179

Query: 181 HLSPRELVQRGTNFFTFSEEGSEAENKLRWRYKRGYELATRDELTEEQKQKIISVSSEIF 240
            L+P E+V++GTNFFTFS++G +AEN+LR  YKRGYELATR+ LTE+QK  I+ V++  F
Sbjct: 180 DLTPEEVVRKGTNFFTFSDDGVQAENQLRKEYKRGYELATREGLTEDQKLNILEVAAATF 239

Query: 241 QWNMETIAEIGELNRQELMGSVSFRLLTYLHEEWKHTDKLSKNQKDXXXXXXXXXXXXXX 300
           +WN   I+EIGE+NRQELMG +SF+L+++  +EWKHT+KL++ QK               
Sbjct: 240 EWNTRVISEIGEINRQELMGKLSFKLVSFAIDEWKHTEKLTRRQKSIVLATGAVIQILVM 299

Query: 301 YLVLRRIL 308
           Y +LR+ L
Sbjct: 300 YWMLRKFL 307

>Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {ON}
           YLR205C (REAL)
          Length = 320

 Score =  377 bits (969), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 169/271 (62%), Positives = 217/271 (80%), Gaps = 1/271 (0%)

Query: 4   IPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAIEQE 63
           IP+PTD+GALANRINFHTRDAHNKIN +M +++A A++HG+I+RQGILAYYY+F AIEQE
Sbjct: 11  IPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQE 70

Query: 64  LDRIMDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYSPEFPTESSLEQFLTSGN 123
           +DR+++ A +EKE+Q   +L +FW+ DFRR+ +I++DL LLYS  F +  SL +FL +  
Sbjct: 71  IDRLLNDAVSEKELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFE 130

Query: 124 HLAPTLQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFQHLS 183
              P LQ FVD IH N+++EPCTIL+YCHVLYLALFAGGK++RSNLYR  GLFP F+ L+
Sbjct: 131 K-PPLLQQFVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLT 189

Query: 184 PRELVQRGTNFFTFSEEGSEAENKLRWRYKRGYELATRDELTEEQKQKIISVSSEIFQWN 243
            +ELV++GTNFFTFSE G   E +L+W YK+ YELATR ELTE QK KIISV+  IF WN
Sbjct: 190 QKELVKKGTNFFTFSELGPTEETRLKWEYKKNYELATRTELTEAQKLKIISVAEGIFDWN 249

Query: 244 METIAEIGELNRQELMGSVSFRLLTYLHEEW 274
              +AEIGELNR+ELM   SF+ +TY++EEW
Sbjct: 250 FNIVAEIGELNRRELMSKFSFKCVTYVYEEW 280

>YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}
           HMX1ER localized heme oxygenase, involved in heme
           degradation during iron starvation and in the oxidative
           stress response; expression is regulated by AFT1 and
           oxidative stress; relocates to the perinuclear region in
           the presence of oxidants
          Length = 317

 Score =  371 bits (953), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 166/271 (61%), Positives = 216/271 (79%), Gaps = 1/271 (0%)

Query: 4   IPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAIEQE 63
           IP+PTDVGALANRINF TRDAHNKIN +M +++A A++HG+I+RQGILAYYY+F AIEQE
Sbjct: 9   IPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQE 68

Query: 64  LDRIMDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYSPEFPTESSLEQFLTSGN 123
           +DR+++    E+E+Q   +L +FW+ DFRR+ +I++DL LLYS  F +  SL +FL +  
Sbjct: 69  IDRLLNDPVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFQ 128

Query: 124 HLAPTLQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFQHLS 183
              P LQ F+++IH+N+ +EPCTIL+YCHVLYLALFAGGK++RSNLYR  GLFP F+ LS
Sbjct: 129 K-PPLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLS 187

Query: 184 PRELVQRGTNFFTFSEEGSEAENKLRWRYKRGYELATRDELTEEQKQKIISVSSEIFQWN 243
            +ELV++GTNFFTFS+ G   E +L+W YK+ YELATR ELTE QK +IISV+  IF WN
Sbjct: 188 QKELVKKGTNFFTFSDLGPTEETRLKWEYKKNYELATRTELTEAQKLQIISVAEGIFDWN 247

Query: 244 METIAEIGELNRQELMGSVSFRLLTYLHEEW 274
              +AEIGELNR+ELMG  SF+ +TYL+EEW
Sbjct: 248 FNIVAEIGELNRRELMGKFSFKCITYLYEEW 278

>Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  369 bits (948), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 172/282 (60%), Positives = 220/282 (78%), Gaps = 2/282 (0%)

Query: 4   IPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAIEQE 63
           IP+PTDVGALANRINFHTRDAHNKIN +M +R+A A++HG+I+RQGILAYYY+F AIEQE
Sbjct: 9   IPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYYVFDAIEQE 68

Query: 64  LDRIMDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYSPEFPTESSLEQFLTSGN 123
           +DR++     EKE+Q   +L +FW+ DFRR+ +I++DL LLYS  F +  SL +FL    
Sbjct: 69  IDRLLHDPVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTESLNEFLAKFE 128

Query: 124 HLAPTLQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFQHLS 183
              P LQ FV+ IH+N+++EPCTIL+YCHVLYLALFAGGK++RSNLYR  GLFP F+ LS
Sbjct: 129 K-PPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFERLS 187

Query: 184 PRELVQRGTNFFTFSEEGSEAENKLRWRYKRGYELATRDELTEEQKQKIISVSSEIFQWN 243
            +ELV++GTNFFTFS+ G   E +L+  YK+ YELATR ELTE QK +IISV+  IF WN
Sbjct: 188 QKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAGGIFDWN 247

Query: 244 METIAEIGELNRQELMGSVSFRLLTYLHEEWKHTDKLSKNQK 285
              +AEIGELNR+ELMG  SF+ +TY++EEW  +DK S  +K
Sbjct: 248 FHIVAEIGELNRRELMGKFSFKCVTYVYEEW-MSDKDSAFRK 288

>Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  369 bits (948), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 166/271 (61%), Positives = 216/271 (79%), Gaps = 1/271 (0%)

Query: 4   IPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAIEQE 63
           IP+PTD+GALANRINFHTRDAHNKIN +M +++A A++HG+I+RQGILAYYY+F AIEQE
Sbjct: 9   IPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQE 68

Query: 64  LDRIMDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYSPEFPTESSLEQFLTSGN 123
           +DR+++     KE+Q   +L +FW+ DFRR+ +I++DL LLYS  F +  SL +FL +  
Sbjct: 69  IDRLLNDPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFE 128

Query: 124 HLAPTLQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFQHLS 183
              P LQ FV++IH+N+Q+EPCTIL+YCHVLYLALFAGGK++RSNLYR  GLFP F+ LS
Sbjct: 129 K-PPVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLS 187

Query: 184 PRELVQRGTNFFTFSEEGSEAENKLRWRYKRGYELATRDELTEEQKQKIISVSSEIFQWN 243
            +ELV++GTNFFTFS+ G   E +L+  YK+ YELATR ELTE QK +IISV+  IF WN
Sbjct: 188 QKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAEGIFDWN 247

Query: 244 METIAEIGELNRQELMGSVSFRLLTYLHEEW 274
              +AEIGELNR+ELMG  SF+ +TY++EEW
Sbjct: 248 FNIVAEIGELNRRELMGKFSFKCVTYVYEEW 278

>Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON}
           similar to Ashbya gossypii ACL154W
          Length = 326

 Score =  329 bits (843), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 159/308 (51%), Positives = 211/308 (68%), Gaps = 1/308 (0%)

Query: 1   MATIPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAI 60
           +  IP+PTDVGALANRINF TRD H K +A++  ++A A++HG+I+RQGILA+YYIF A+
Sbjct: 19  VGMIPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRHGFIYRQGILAFYYIFHAV 78

Query: 61  EQELDRIMDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYSPEFPTESSLEQFLT 120
           EQ++DR+++    ++E+Q+  +L +FW  +FRR+ R+ +DL   Y  E+PT++ L+QFL 
Sbjct: 79  EQQIDRLLETPSTKEELQISAILRQFWCEEFRRSGRLLRDLEFFYHHEYPTQNELQQFLN 138

Query: 121 SGNHLAPTLQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFQ 180
               L P LQ FVD I     E P TILAYCHVLY ALFAGGKVMRSN+YR+ GLFPK +
Sbjct: 139 DF-ELPPKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGKVMRSNIYRNIGLFPKPK 197

Query: 181 HLSPRELVQRGTNFFTFSEEGSEAENKLRWRYKRGYELATRDELTEEQKQKIISVSSEIF 240
            +S  E  + GTNFFTFS++G + ENKLRW+YK+ YELATR+ L E QK +II VS   F
Sbjct: 198 GISAAESSRNGTNFFTFSDDGVDEENKLRWQYKKNYELATREGLDENQKLEIIDVSIANF 257

Query: 241 QWNMETIAEIGELNRQELMGSVSFRLLTYLHEEWKHTDKLSKNQKDXXXXXXXXXXXXXX 300
           Q  M+ + EIGE N++ELM   SF+LLT+L  EW++  KLS   K               
Sbjct: 258 QAVMDILGEIGETNKKELMNIFSFKLLTFLSNEWRYNQKLSSEVKQALAIAVFFINFLMI 317

Query: 301 YLVLRRIL 308
           Y  LR I 
Sbjct: 318 YFTLRTIF 325

>NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON}
           Anc_7.344 YLR205C
          Length = 315

 Score =  318 bits (816), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 144/307 (46%), Positives = 210/307 (68%), Gaps = 2/307 (0%)

Query: 4   IPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAIEQE 63
           IP+PTD  ALANRINF TRDAHNKIN  MS++LA AL+HG+I+RQGIL YYYIF+ +E+E
Sbjct: 9   IPSPTDTKALANRINFQTRDAHNKINKKMSIKLAIALRHGFIYRQGILTYYYIFKVVEEE 68

Query: 64  LDRIMDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYSPEFPTESSLEQFL-TSG 122
           + ++       +E+++ N+L K W+ +F RT+ + +DL LLY  E+PT+ +L+ FL T+ 
Sbjct: 69  IIKLTTSPTTSEEVKIGNLLSKTWIPEFNRTENLLKDLQLLYHDEYPTKEALQLFLETNA 128

Query: 123 NHLAPTLQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFQHL 182
             L P L +F+  IH+++ E PC+I AYCHVLYLALFAGGK++RS +Y++ G  P F HL
Sbjct: 129 TELPPVLDSFIKYIHQSILENPCSIFAYCHVLYLALFAGGKIIRSKIYKNLGFLPNFNHL 188

Query: 183 SPRELVQRGTNFFTFSEEGSEAENKLRWRYKRGYELATRDELTEEQKQKIISVSSEIFQW 242
           S +E+ ++GTNFF F  +G   E KL+  +K+ YEL TR+ L E++K  II  S +IF +
Sbjct: 189 SSKEVFEKGTNFFKFGSDGVIEETKLKLEFKKNYELNTRESLNEKEKSIIIETSKKIFDY 248

Query: 243 NMETIAEIGELNRQELMGSVSFRLLTYLHEEWKHTDK-LSKNQKDXXXXXXXXXXXXXXY 301
           N+  + E+G +N+++LM  ++F+++TYL EEWK  D  LSK  K               +
Sbjct: 249 NLMAMEELGSINKEQLMSKLNFKMVTYLLEEWKFNDNFLSKRGKHLIMVVMVLLHMLFAF 308

Query: 302 LVLRRIL 308
            +L+R L
Sbjct: 309 FILKRFL 315

>Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON}
           complement(84853..85788) [936 nt, 312 aa]
          Length = 311

 Score =  312 bits (800), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 145/285 (50%), Positives = 206/285 (72%), Gaps = 8/285 (2%)

Query: 2   ATIPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAIE 61
           +TIP+PTDVGALANRINF TRD HNK++A+M +RLA ALKHG+I+R+G++ +Y+IF  IE
Sbjct: 3   STIPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNTIE 62

Query: 62  QELDRIMDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYSPEFPTE-SSLEQFLT 120
            E+D +++   N+ + QM+ +L  F++++FRR D+I +DL LLY PEF  +   L +F+ 
Sbjct: 63  TEIDLVLN---NQDDSQMKLILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEFIN 119

Query: 121 SG--NHLAPTLQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPK 178
           S    + +  LQ FV  I  N  E+PCT+LAYCHVLYLALFAGGK+M+SN+ +H G+FPK
Sbjct: 120 SDRFTNDSEQLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIFPK 179

Query: 179 FQHLSPRELVQRGTNFFTFSEEGS--EAENKLRWRYKRGYELATRDELTEEQKQKIISVS 236
           F+HLS +E++ RGTNF+ F++  +    + KLRW YK+ YEL+TRDEL E+QK  +I  S
Sbjct: 180 FEHLSHKEIIARGTNFYQFTDSTNPETTDVKLRWLYKKNYELSTRDELLEQQKLTVIKTS 239

Query: 237 SEIFQWNMETIAEIGELNRQELMGSVSFRLLTYLHEEWKHTDKLS 281
            ++F      IAE+G  NR ELM   S++L T++ EEWK+   +S
Sbjct: 240 KDVFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEWKYNSSIS 284

>TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.344
           YLR205C
          Length = 320

 Score =  305 bits (780), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 149/290 (51%), Positives = 201/290 (69%), Gaps = 8/290 (2%)

Query: 4   IPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAIEQE 63
           IP+PTDV ALANRINF TRD HNKI A+MS+RLA AL+HG+I+RQG++A+Y+IF  IE E
Sbjct: 7   IPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIFGTIENE 66

Query: 64  LDRI---MDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYSPEFP-TESSLEQFL 119
           +D +   +D   +  ++Q + +L  F++N+FRR D + QDLT+LY PEF      +  FL
Sbjct: 67  IDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQDVLDFL 126

Query: 120 TS---GNHLAPTLQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLF 176
            S        P L  F D I    +E+P TI+AYCHVLYLALFAGGK+M+SN+ ++ GLF
Sbjct: 127 NSETFNKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVLKNVGLF 186

Query: 177 PKFQHLSPRELVQRGTNFFTFSEEGS-EAENKLRWRYKRGYELATRDELTEEQKQKIISV 235
           PKF H+S  E+  +G+NFF F++E + + ++KLR+ YK+ YEL+TRDEL E QK  II V
Sbjct: 187 PKFDHMSHEEVTNQGSNFFRFTQEDTADFDSKLRFEYKKNYELSTRDELNEMQKNDIIEV 246

Query: 236 SSEIFQWNMETIAEIGELNRQELMGSVSFRLLTYLHEEWKHTDKLSKNQK 285
           S  IF      IAEIG  NR +LMG  + + +TYL EEWK+ +KL+K  K
Sbjct: 247 SKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNEKLTKTNK 296

>NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {ON}
           Anc_7.344 YLR205C
          Length = 327

 Score =  302 bits (774), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 146/300 (48%), Positives = 201/300 (67%), Gaps = 15/300 (5%)

Query: 1   MATIPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAI 60
           +  IP+PTD  ALANRINFHTRDAHNKI+  M+++LA AL+HG I+RQGIL YYYIFQA+
Sbjct: 6   VTIIPSPTDTEALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYYIFQAV 65

Query: 61  EQELDRIMDHARNEKEMQMQ--NVLGKFWMNDFRRTDRIFQDLTLLYSPEFPTESSLEQF 118
           E E++ ++    +  + Q +  ++L K W+ +F RTD++F+DL LLYS  F  +  L  F
Sbjct: 66  ESEINYLLSFNTDATKEQKRTGSLLSKIWLTEFNRTDKLFKDLKLLYSDRFQNDQDLLNF 125

Query: 119 LTSGNHLA-----PTLQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHT 173
           +     L        L  FV+ IH ++Q  PC ILAYCHVLYLALFAGGK+++S +Y++ 
Sbjct: 126 INEEFKLIHQNKNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSKIYKNL 185

Query: 174 GLFPKFQHLSPRELVQRGTNFFTFSE-----EGSEA---ENKLRWRYKRGYELATRDELT 225
           G  P F HLS +EL    TNFF F+E     EG  +   ENKL+ ++KR +EL TR  L 
Sbjct: 186 GFLPNFNHLSSKELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFELNTRSNLN 245

Query: 226 EEQKQKIISVSSEIFQWNMETIAEIGELNRQELMGSVSFRLLTYLHEEWKHTDKLSKNQK 285
           E +K  II ++ +IFQWN+E++ E+G+ N++ELM   SF+L+ YL EEWK  D + KN K
Sbjct: 246 ENEKLTIIEIAKQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEWKFNDSIKKNFK 305

>CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205c
          Length = 282

 Score =  286 bits (731), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 137/264 (51%), Positives = 192/264 (72%), Gaps = 12/264 (4%)

Query: 32  MSVRLAFALKHGWIFRQGILAYYYIFQAIEQELDRIM--DHAR--------NEKEMQMQN 81
           MSVR A AL+HG ++RQGILA+YY+FQAIEQE+D ++  D A         +++++    
Sbjct: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDTATGATGATDVSDQKLLASK 60

Query: 82  VLGKFWMNDFRRTDRIFQDLTLLYSPEFPTESSLEQFLTSGNHLAPTLQAFVDSIHKNVQ 141
           ++ +FWM +FRRT+++++DL LLYSPE+PT + L+  L   + L P LQ FVD +H  V+
Sbjct: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTELDAMLVD-HQLPPQLQGFVDMVHATVR 119

Query: 142 EEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFQHLSPRELVQRGTNFFTFSEEG 201
           + P T+LAYCHV+YLALFAGGKVMRS LYR+TGLFPKF+HLS +EL ++GTNFFTFS+ G
Sbjct: 120 QNPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFFTFSDAG 179

Query: 202 SEAENKLRWRYKRGYELATRDELTEEQKQKIISVSSEIFQWNMETIAEIGELNRQELMGS 261
            + EN+L+W+YK+ YELATR+ L E  K +II V+  IF+ NM+ I EIG+LN++ L  +
Sbjct: 180 VDVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLNKEALTNN 239

Query: 262 VSFRLLTYLHEEWKHTDKLSKNQK 285
               LL Y+ EE K  +K   +Q+
Sbjct: 240 -KLDLLQYVFEELKFYNKDRSHQQ 262

>ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR205C (HMX1)
          Length = 319

 Score =  260 bits (664), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 136/279 (48%), Positives = 178/279 (63%), Gaps = 2/279 (0%)

Query: 3   TIPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAIEQ 62
            +P PTD GALANRINFHTR+ H+K +A++S + A AL+H  I+RQG+LA YYIF+++EQ
Sbjct: 17  VVPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRHPSIYRQGLLAMYYIFRSVEQ 76

Query: 63  ELDRIMDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYSPEFPTESSLEQFLTSG 122
            +DR++       E ++  +L  FW  +F R   + QD  + Y+ E+ T + L QFL S 
Sbjct: 77  HIDRLLRAPATADEARIGEILRAFWRPEFARAPALVQDFEVYYAAEYSTSAQLHQFLDS- 135

Query: 123 NHLAPTLQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFQHL 182
             L P L A V  I      +P TILA+CHVLYLALFAGG+VMRS L R  GL P+   L
Sbjct: 136 YELPPRLAAAVADIEAAALRQPWTILAHCHVLYLALFAGGRVMRSALSRQLGLLPRAAGL 195

Query: 183 SPRELVQRGTNFFTFSEEGSEAENKLRWRYKRGYELATRDELTEEQKQKIISVSSEIFQW 242
           S RE   RGT+FFTF   G+  ENK R  YKR YELATR  L+E +K  +I  +   F  
Sbjct: 196 SARETQLRGTHFFTFG-AGAGEENKARVAYKRAYELATRTALSEAEKADVIDAARADFDH 254

Query: 243 NMETIAEIGELNRQELMGSVSFRLLTYLHEEWKHTDKLS 281
               +AE+   NRQEL+GS S+RLLT+L EEW++  K S
Sbjct: 255 IQAVMAELAVRNRQELLGSPSYRLLTFLGEEWRYRTKNS 293

>KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.344
           YLR205C
          Length = 300

 Score =  239 bits (610), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 116/274 (42%), Positives = 184/274 (67%), Gaps = 14/274 (5%)

Query: 4   IPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAIEQE 63
           +P+PTD  ALANRINFHTRD HN I+  MS++  FAL+H +I++  +L+YYY+F+ +E E
Sbjct: 5   VPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRTLEDE 64

Query: 64  LDRIMDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYSPEFPTESSLEQFLTSGN 123
           +D I+ + R+     +  +L  F+ + FRR D+I +DL  L   +   + S +Q+L+S  
Sbjct: 65  IDFIISNDRS----HIGEILRGFFNDKFRRKDQILKDLKFLNVIQ---DQSDDQWLSS-- 115

Query: 124 HLAPTLQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLF--PKFQH 181
              P L  F++ I  N+ E P  +LAYCHVLYLALFAGG++MR+++ ++   F  PKF  
Sbjct: 116 --RPELCKFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKFDK 173

Query: 182 LSPRELVQRGTNFFTFSEEGSEAENKLRWRYKRGYELATRDELTEEQKQKIISVSSEIFQ 241
           +S  +++   TNFF F ++   +ENKL+  YKR Y++ T+ +L E++K +II +S EIF+
Sbjct: 174 MSHTDVIMNATNFFKFDKDIV-SENKLKSEYKRNYDILTKAKLNEDEKLEIIDISREIFK 232

Query: 242 WNMETIAEIGELNRQELMGSVSFRLLTYLHEEWK 275
           +N   + EIG +N+ ELM + +++++TY+ EEWK
Sbjct: 233 FNFNLLQEIGTVNKDELMKNFNYKMVTYVVEEWK 266

>KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON}
           Anc_7.344 YLR205C
          Length = 302

 Score =  227 bits (578), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 122/283 (43%), Positives = 173/283 (61%), Gaps = 21/283 (7%)

Query: 1   MATIPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAI 60
           M+TIP+PTD  ALANRINFHTRD HN+++   SV+   AL+H +I+   +  +Y +F  +
Sbjct: 2   MSTIPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGTV 61

Query: 61  EQELDRIMDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYSPEFPTESSLEQFLT 120
           EQ +D ++    +E    +  +LG+F++ +FRR D+I +DL  L   E+ T       + 
Sbjct: 62  EQRIDELI---ASEGGDGVGAILGEFYVPEFRRADKIKRDLVFL--GEWDT-------VE 109

Query: 121 SGNHLAPT-LQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKF 179
           SG    P  L  F+  +   +  +P T+LA CHVLYLALFAGG+V +S+L+++ G  P F
Sbjct: 110 SGQWTPPPQLAGFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNLGFLPNF 169

Query: 180 -------QHLSPRELVQRGTNFFTFSEEGSEAENKLRWRYKRGYELATRDELTEEQKQKI 232
                  + +S   LV   TNFF F+E   E ENKLRW YKR YELATRD LTE+QK  +
Sbjct: 170 RDKNGPGEEMSDHTLVSNATNFFQFAET-IEDENKLRWTYKRNYELATRDTLTEDQKLAV 228

Query: 233 ISVSSEIFQWNMETIAEIGELNRQELMGSVSFRLLTYLHEEWK 275
           I+ S ++F+     I EI + N  ELM   SF+++TY  EEWK
Sbjct: 229 IAASRDVFRHTFAVIEEICQQNHDELMSFRSFKIVTYFLEEWK 271

>KLLA0A09141g Chr1 (801373..803655) [2283 bp, 760 aa] {ON} weakly
           similar to uniprot|P38863 YHR172W Saccharomyces
           cerevisiae SPC97 Component of the microtubule-nucleating
           Tub4p (gamma-tubulin) complex
          Length = 760

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 28/55 (50%)

Query: 52  AYYYIFQAIEQELDRIMDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYS 106
            + Y F+ ++Q +DRIMD  R   EM    +    +M+D RR      DL +LY 
Sbjct: 173 GFIYKFRLLDQIVDRIMDSTRERSEMDRVQMDFNNFMDDLRRDTNDELDLRVLYD 227

>CAGL0K09988g Chr11 (977846..978436) [591 bp, 196 aa] {ON} similar
           to uniprot|P38962 Saccharomyces cerevisiae YDR084c
          Length = 196

 Score = 32.7 bits (73), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 40/110 (36%), Gaps = 6/110 (5%)

Query: 146 TILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFQHLSPRELVQRGTNFFTFSEEGSEAE 205
           TIL   H L +A    GK      Y    LFP F  L    ++    +F+          
Sbjct: 10  TILRSSHPLLMAFHLAGKAAPLAFYIAGFLFPSFTALFITIVLLLAADFYFTKNISGRRL 69

Query: 206 NKLRWRYKRGYELATRDELTEEQKQ-----KIISVSSEIFQWNMETIAEI 250
            +LRW Y      +T     E  KQ      I  + S++F W+M     I
Sbjct: 70  VQLRWWYDSS-ATSTETFTFESHKQYTAGPPINPIDSKLFWWSMYLTPAI 118

>TDEL0F02760 Chr6 (505275..506627) [1353 bp, 450 aa] {ON} Anc_4.74
           YGL038C
          Length = 450

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 37/79 (46%), Gaps = 10/79 (12%)

Query: 90  DFRRTDRIFQ-DLTLLYSPEFPTESSLEQFLTSGNHLAPTLQ---AFVDSIHKNVQEEPC 145
           DF  T R +Q D T++         S E  L   +H+ P L+   A V  + K  +E P 
Sbjct: 102 DFPSTFRRYQEDWTVMAG------DSFEHSLVPDDHIEPLLENMYAEVPLVLKAFKEMPA 155

Query: 146 TILAYCHVLYLALFAGGKV 164
           TIL    + YL LFA G +
Sbjct: 156 TILKADFLRYLLLFARGGI 174

>TBLA0A01710 Chr1 (411434..414358) [2925 bp, 974 aa] {ON} Anc_8.462
           YDR238C
          Length = 974

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 52/123 (42%), Gaps = 13/123 (10%)

Query: 33  SVRLAFALKHGWIFRQGILAYYYIFQAIEQELDRIMDHARNEKEMQMQNVLGKFWMNDFR 92
           SV      +H ++ +  ILA   IF+  +  L    DH +N   ++   +  +   N F 
Sbjct: 140 SVLQCLEYRHAYVRKYAILAVLSIFKVSDHLLPDAKDHIKNFLAVETDPICKR---NAFI 196

Query: 93  RTDRIFQDLTLLYSPEFPTESSLEQFLTSGNHLAPTLQ-AFVDSIHKNVQEEPCTILAYC 151
               + ++  L Y         LE  +TS ++L P LQ AFV  I K+  + P     Y 
Sbjct: 197 GLTELNREDALTY---------LENNITSMDNLDPLLQIAFVQFIRKDAFQTPSLRHQYI 247

Query: 152 HVL 154
            +L
Sbjct: 248 ELL 250

>Kpol_1013.50 s1013 complement(110643..118532) [7890 bp, 2629 aa] {ON}
            complement(110643..118532) [7890 nt, 2630 aa]
          Length = 2629

 Score = 30.8 bits (68), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 1/71 (1%)

Query: 45   IFRQGILAYYYIFQAIEQELDRIMDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDL-TL 103
            I R  I    +  +  E  L   +DH+ N K ++   +L K   N  ++ + + QDL TL
Sbjct: 1858 IPRTSINKRLHSLKTSENILKEKIDHSDNTKIIKHDTLLLKTTKNAVKKVEELVQDLDTL 1917

Query: 104  LYSPEFPTESS 114
             YS + PT+ +
Sbjct: 1918 FYSQDDPTKGN 1928

>KLTH0E09944g Chr5 complement(898345..901746) [3402 bp, 1133 aa] {ON}
            weakly similar to uniprot|P14737 Saccharomyces cerevisiae
            YDR217C RAD9 DNA damage-dependent checkpoint protein
            required for cell-cycle arrest in G1/S intra-S and G2/M
            transmits checkpoint signal by activating Rad53p and
            Chk1p hyperphosphorylated by Mec1p and Tel1p potential
            Cdc28p substrate
          Length = 1133

 Score = 30.0 bits (66), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 39/86 (45%), Gaps = 13/86 (15%)

Query: 2    ATIPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAIE 61
            +T   P D+ +L ++++ H  DAH K++  +++     L  G   + G        Q + 
Sbjct: 1049 STTEGPDDISSLVSKVSNHLEDAHRKLSKGLNILAYINLMDG---KDG------TSQHLT 1099

Query: 62   QELDRIMDHARN----EKEMQMQNVL 83
            Q L  + D   N    EKE  +Q V+
Sbjct: 1100 QNLKSLFDSKENIHIEEKEWLIQTVI 1125

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.135    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 29,822,583
Number of extensions: 1233375
Number of successful extensions: 3597
Number of sequences better than 10.0: 31
Number of HSP's gapped: 3654
Number of HSP's successfully gapped: 31
Length of query: 309
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 200
Effective length of database: 40,982,805
Effective search space: 8196561000
Effective search space used: 8196561000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 65 (29.6 bits)