Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F11572g7.343ON73173136630.0
NCAS0A141107.343ON75373425030.0
TDEL0C020407.343ON70571224900.0
CAGL0I03410g7.343ON72471223940.0
SAKL0F10912g7.343ON69360823800.0
YDL164C (CDC9)7.343ON75572423730.0
KNAG0C037407.343ON72772023700.0
Suva_4.827.343ON75573323660.0
Smik_4.747.343ON84572123530.0
Skud_4.937.343ON75572823520.0
Kwal_56.246167.343ON71572423300.0
NDAI0A019407.343ON76573623240.0
Kpol_2001.717.343ON72670622910.0
KLTH0H01408g7.343ON72373122840.0
KAFR0B008307.343ON71063022710.0
KLLA0D12496g7.343ON70070521110.0
TPHA0D045707.343ON73674620860.0
ACL155W7.343ON69771320620.0
TBLA0E020507.343ON72060820440.0
KLLA0D01089g6.18ON9073932442e-20
TPHA0M002606.18ON9662322398e-20
ACR008W6.18ON9814162362e-19
ZYRO0C07854g6.18ON9443892334e-19
KNAG0F028706.18ON9542672156e-17
KAFR0A050506.18ON9484172131e-16
YOR005C (DNL4)6.18ON9444092131e-16
KLTH0C11286g6.18ON9513902112e-16
Smik_15.1746.18ON9452402102e-16
NCAS0D026506.18ON9502382067e-16
TBLA0G010406.18ON9722362068e-16
NDAI0I022606.18ON9672702022e-15
TDEL0G045106.18ON9694112022e-15
CAGL0E02695g6.18ON9463872003e-15
Kwal_56.224146.18ON9632601987e-15
Suva_15.1806.18ON9484411762e-12
Skud_15.1666.18ON9472351763e-12
Kpol_1032.76.18ON9652241753e-12
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F11572g
         (731 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...  1415   0.0  
NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON} Anc_7...   968   0.0  
TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {O...   963   0.0  
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...   926   0.0  
SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {...   921   0.0  
YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}  ...   918   0.0  
KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.3...   917   0.0  
Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}...   915   0.0  
Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}...   910   0.0  
Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}...   910   0.0  
Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL1...   902   0.0  
NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {O...   899   0.0  
Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON} (1951...   887   0.0  
KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {...   884   0.0  
KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...   879   0.0  
KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]...   817   0.0  
TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.3...   808   0.0  
ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homo...   798   0.0  
TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.3...   791   0.0  
KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {O...    99   2e-20
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...    97   8e-20
ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic ho...    96   2e-19
ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} simila...    94   4e-19
KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.1...    87   6e-17
KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6...    87   1e-16
YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON} ...    87   1e-16
KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...    86   2e-16
Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {...    86   2e-16
NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...    84   7e-16
TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...    84   8e-16
NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {O...    82   2e-15
TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.1...    82   2e-15
CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {...    82   3e-15
Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {...    81   7e-15
Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {...    72   2e-12
Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {...    72   3e-12
Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON...    72   3e-12

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score = 1415 bits (3663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 689/731 (94%), Positives = 689/731 (94%)

Query: 1   MLARVHQLSVIGVRRFGMATSSSQPKKQAKQATLAKFFSSVKDRNSPTKKNATPAFPTTT 60
           MLARVHQLSVIGVRRFGMATSSSQPKKQAKQATLAKFFSSVKDRNSPTKKNATPAFPTTT
Sbjct: 1   MLARVHQLSVIGVRRFGMATSSSQPKKQAKQATLAKFFSSVKDRNSPTKKNATPAFPTTT 60

Query: 61  NVKRESPVRSNSNEKESSPMFDDSNGRSSACSSAGLEMESAPAPKKLKMESDSNSTSKNN 120
           NVKRESPVRSNSNEKESSPMFDDSNGRSSACSSAGLEMESAPAPKKLKMESDSNSTSKNN
Sbjct: 61  NVKRESPVRSNSNEKESSPMFDDSNGRSSACSSAGLEMESAPAPKKLKMESDSNSTSKNN 120

Query: 121 QDDHFSTVPYADVCNIFQEIESTSSRLSIIKICSDFFTQIVKEDSRNLVPTTYLFINKLG 180
           QDDHFSTVPYADVCNIFQEIESTSSRLSIIKICSDFFTQIVKEDSRNLVPTTYLFINKLG
Sbjct: 121 QDDHFSTVPYADVCNIFQEIESTSSRLSIIKICSDFFTQIVKEDSRNLVPTTYLFINKLG 180

Query: 181 PDYEPXXXXXXXXXXXXKTISESCGKSLAQVKNRYREMGDLGQIAMEARNVQPTMFKPKP 240
           PDYEP            KTISESCGKSLAQVKNRYREMGDLGQIAMEARNVQPTMFKPKP
Sbjct: 181 PDYEPGMELGLGEGLLMKTISESCGKSLAQVKNRYREMGDLGQIAMEARNVQPTMFKPKP 240

Query: 241 LTVGEVFVNLRNIANAQGKDSQNKKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKT 300
           LTVGEVFVNLRNIANAQGKDSQNKKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKT
Sbjct: 241 LTVGEVFVNLRNIANAQGKDSQNKKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKT 300

Query: 301 VLISLSNALLRHEQGLDVEPSDEAVDKAEQSIRDAFCQVPNYEIVINTCLEHGISQLHKH 360
           VLISLSNALLRHEQGLDVEPSDEAVDKAEQSIRDAFCQVPNYEIVINTCLEHGISQLHKH
Sbjct: 301 VLISLSNALLRHEQGLDVEPSDEAVDKAEQSIRDAFCQVPNYEIVINTCLEHGISQLHKH 360

Query: 361 CQLTPGIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGTMRIYSRNG 420
           CQLTPGIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGTMRIYSRNG
Sbjct: 361 CQLTPGIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGTMRIYSRNG 420

Query: 421 ENMTERYPEIDIRDFLSDPSTESLILDCEAVAWDKEQGKILPFQVLSTXXXXXXXXXXXX 480
           ENMTERYPEIDIRDFLSDPSTESLILDCEAVAWDKEQGKILPFQVLST            
Sbjct: 421 ENMTERYPEIDIRDFLSDPSTESLILDCEAVAWDKEQGKILPFQVLSTRKRKDVDAKDVK 480

Query: 481 XXXCLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLD 540
              CLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLD
Sbjct: 481 VRVCLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLD 540

Query: 541 QSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLXXXXXXXXX 600
           QSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVL         
Sbjct: 541 QSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLGAYYGRGKR 600

Query: 601 XXXXXXFLLGCYNQDTGEYETCCKIGTGFSEELLQQLYDRLKPTAMEAPAAFYVYDSAQQ 660
                 FLLGCYNQDTGEYETCCKIGTGFSEELLQQLYDRLKPTAMEAPAAFYVYDSAQQ
Sbjct: 601 TGTYGGFLLGCYNQDTGEYETCCKIGTGFSEELLQQLYDRLKPTAMEAPAAFYVYDSAQQ 660

Query: 661 PDVWFEPTLLFEVLAADLSLSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQV 720
           PDVWFEPTLLFEVLAADLSLSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQV
Sbjct: 661 PDVWFEPTLLFEVLAADLSLSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQV 720

Query: 721 VDLYEAQAHLS 731
           VDLYEAQAHLS
Sbjct: 721 VDLYEAQAHLS 731

>NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON}
           Anc_7.343 YDL164C
          Length = 753

 Score =  968 bits (2503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/734 (65%), Positives = 564/734 (76%), Gaps = 23/734 (3%)

Query: 18  MATSSSQPKKQAKQATLAKFFSSVKDRNSPTKKNATPAFPTTTNVKRESPVRSNSNE--- 74
           M++ +  PKKQ KQATLAKFFSS+K+     KK+   +  TTT     SP  +NS +   
Sbjct: 19  MSSPAGFPKKQ-KQATLAKFFSSMKNEKPADKKDPEDSTTTTTEKPSLSPYTANSKKTFE 77

Query: 75  ----KESSPMFDDSNGRSSACSSAGL-----EMESAPAPKKLKMESDSNSTSKN------ 119
               + +S +   S G S   S+  +     +  + P  KK K+E  +   SK       
Sbjct: 78  EILNRPASNLASSSQGVSDIASTPSIPNISTDESTGPDLKKQKLEESNLEPSKEPTIENV 137

Query: 120 NQDD---HFSTVPYADVCNIFQEIESTSSRLSIIKICSDFFTQIVKEDSRNLVPTTYLFI 176
            QD    +FS++PY +VCN+FQEIESTSSRL+IIK+CSDFF +I+KE+ +NL+P TYLFI
Sbjct: 138 TQDSTKPYFSSIPYREVCNLFQEIESTSSRLAIIKLCSDFFIKIMKENPQNLIPVTYLFI 197

Query: 177 NKLGPDYEPXXXXXXXXXXXXKTISESCGKSLAQVKNRYREMGDLGQIAMEARNVQPTMF 236
           NKLGPDYEP            KTISESCGKSLAQV+N+YRE+GDLGQIAM+ARNVQPTMF
Sbjct: 198 NKLGPDYEPGLELGLGEGLLMKTISESCGKSLAQVRNKYRELGDLGQIAMDARNVQPTMF 257

Query: 237 KPKPLTVGEVFVNLRNIANAQGKDSQNKKIKLIKRMLTACQGVEAKFLIRSLESKLRIGL 296
           KPKPLTVGEVF NLR IA ++GKDSQ +KIKLIKRMLTAC+G EAKFLIRSLESKLRIGL
Sbjct: 258 KPKPLTVGEVFENLRLIAKSEGKDSQTRKIKLIKRMLTACEGTEAKFLIRSLESKLRIGL 317

Query: 297 AEKTVLISLSNALLRHEQGLDVEPSDEAVDKAEQSIRDAFCQVPNYEIVINTCLEHGISQ 356
           AEKTVLISLS ALL HE   + +   E ++ AEQ IRDAFCQVPNYEIVIN+CL++GI +
Sbjct: 318 AEKTVLISLSKALLVHECKDNKDFDMELLETAEQKIRDAFCQVPNYEIVINSCLKYGIME 377

Query: 357 LHKHCQLTPGIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGTMRIY 416
           L  HC L PGIPLKPMLAKPTKAI E+LDRFQG++F SEYKYDGERAQ+HLL DGTMRIY
Sbjct: 378 LETHCSLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDGTMRIY 437

Query: 417 SRNGENMTERYPEIDIRDFLSDP-STESLILDCEAVAWDKEQGKILPFQVLSTXXXXXXX 475
           SRNGENMTERYPEI IRDF++DP  T +LILDCEAVAWD EQ KILPFQVLST       
Sbjct: 438 SRNGENMTERYPEIHIRDFIADPLVTSTLILDCEAVAWDNEQNKILPFQVLSTRKRKDVD 497

Query: 476 XXXXXXXXCLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEEL 535
                   CLFAFD+LCHN E LINKSLRER+  LQ+VTK V GEF+YA ++ ++N++EL
Sbjct: 498 LKDVKVKVCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNLDEL 557

Query: 536 QHFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLXXXX 595
           Q FLDQSV DSCEGLMVKMLDG ESHYEPSKRSRNWLKLKKDYL G+GDSLDLCV+    
Sbjct: 558 QKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIGAYY 617

Query: 596 XXXXXXXXXXXFLLGCYNQDTGEYETCCKIGTGFSEELLQQLYDRLKPTAMEAPAAFYVY 655
                      FLLGCYNQDTGE+ETCCKIGTGFS+E+LQQLY RL PT ++ P A +VY
Sbjct: 618 GRGKRTGMYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQQLYTRLTPTVLDGPKATFVY 677

Query: 656 DSAQQPDVWFEPTLLFEVLAADLSLSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEAT 715
           DS+ +PDVWFEPTLLFEVL ADLSLSP+YKAGS+ YDKGISLRFPRF+R R+DK VE+AT
Sbjct: 678 DSSAEPDVWFEPTLLFEVLTADLSLSPIYKAGSSTYDKGISLRFPRFIRTREDKGVEDAT 737

Query: 716 SSEQVVDLYEAQAH 729
           SSEQ+++LYE QAH
Sbjct: 738 SSEQIIELYENQAH 751

>TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {ON}
           Anc_7.343 YDL164C
          Length = 705

 Score =  963 bits (2490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/712 (66%), Positives = 550/712 (77%), Gaps = 39/712 (5%)

Query: 30  KQATLAKFFSSVKDRNSPTKKNATPAF---------PTTTNVKRESPVRSNSNEKESSPM 80
           KQATLA+FFS+V+  ++  K N              P T   K  SPV+  ++       
Sbjct: 23  KQATLARFFSAVQKDDTKEKVNGDVKIIESRDNQDEPVTKKFKSSSPVKLQTSS------ 76

Query: 81  FDDSNGRSSACSSAGLEMESAPAPKKLKMESDSNSTSKNNQDDHFSTVPYADVCNIFQEI 140
                   S   SAG+E    P                 + D ++S VPY+DVCN+FQEI
Sbjct: 77  -------LSPVKSAGVESGDKPV----------------SPDLYYSKVPYSDVCNVFQEI 113

Query: 141 ESTSSRLSIIKICSDFFTQIVKEDSRNLVPTTYLFINKLGPDYEPXXXXXXXXXXXXKTI 200
           E TSSRLSIIKICS+FF++I+K++ +NL+PTTYLFIN+LGPDYEP            KTI
Sbjct: 114 EGTSSRLSIIKICSEFFSRIMKDNPQNLIPTTYLFINRLGPDYEPGLELGLGEGLLMKTI 173

Query: 201 SESCGKSLAQVKNRYREMGDLGQIAMEARNVQPTMFKPKPLTVGEVFVNLRNIANAQGKD 260
           SE+CGKSL QVKNRYREMGDLGQIA+EARNVQPTMFKPKPLTVGEVF NLR IA++QGKD
Sbjct: 174 SEACGKSLVQVKNRYREMGDLGQIALEARNVQPTMFKPKPLTVGEVFENLRAIAHSQGKD 233

Query: 261 SQNKKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSNALLRHEQGLDVEP 320
           SQ +KIKLIKRMLTAC+GVEAKFLIRSLESKLRIGLAEKTVLISLS ALL +E     EP
Sbjct: 234 SQTRKIKLIKRMLTACEGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLTNEGETGKEP 293

Query: 321 SDEAVDKAEQSIRDAFCQVPNYEIVINTCLEHGISQLHKHCQLTPGIPLKPMLAKPTKAI 380
           S E V++AE  IRDAFCQVPNYEIVIN CL++GI +L KHC+L PGIPLKPMLAKPTK+I
Sbjct: 294 SMELVEQAEAKIRDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLKPMLAKPTKSI 353

Query: 381 TEVLDRFQGQLFVSEYKYDGERAQLHLLPDGTMRIYSRNGENMTERYPEIDIRDFLSD-P 439
           TEVLDRFQGQ F SEYKYDGERAQ+HLL DGTMRIYSRNGENMTERYPEI IRDF++D  
Sbjct: 354 TEVLDRFQGQTFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEISIRDFVADLE 413

Query: 440 STESLILDCEAVAWDKEQGKILPFQVLSTXXXXXXXXXXXXXXXCLFAFDLLCHNGEPLI 499
            T++LILDCEAVAWDK Q KILPFQVLST               CLFAFD++CHNGE  I
Sbjct: 414 HTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVKVRVCLFAFDIICHNGERQI 473

Query: 500 NKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQSVKDSCEGLMVKMLDGPE 559
           NKSLRER++ L +VTKPV GEF+YA +L T+++EELQ FLDQSVKDSCEGLMVKMLDGPE
Sbjct: 474 NKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGLMVKMLDGPE 533

Query: 560 SHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEY 619
           SHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL               FLLGCYNQD+GE+
Sbjct: 534 SHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDSGEF 593

Query: 620 ETCCKIGTGFSEELLQQLYDRLKPTAMEAPAAFYVYDSAQQPDVWFEPTLLFEVLAADLS 679
           ETCCKIGTGFS+E+LQQLY+R   T ++ P A YV+DS+ +PDVWFEPT LFEVL ADLS
Sbjct: 594 ETCCKIGTGFSDEMLQQLYERFSKTTLDGPKATYVFDSSAEPDVWFEPTTLFEVLTADLS 653

Query: 680 LSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVDLYEAQAHLS 731
           LSPVYKAG++ YDKG+SLRFPRF+R+RDDKSVE+ATSS Q+V+LY+ Q+H++
Sbjct: 654 LSPVYKAGASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQSHVA 705

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score =  926 bits (2394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/712 (64%), Positives = 545/712 (76%), Gaps = 27/712 (3%)

Query: 30  KQATLAKFFSSVKDRNSPTKKNATPAFPTTTNVKRESPVRSNSNEKES--SP---MFDDS 84
           +QATLA+FFSSVK      KK       T       + V  NS+E ++  SP   M  +S
Sbjct: 29  RQATLARFFSSVKKDADGDKKGEQADVKT-------AAVDLNSHEVDANKSPLKKMKLES 81

Query: 85  NGRSSACSSAGL---EMESAPAPKKLKMESDSNSTSKNNQDDHFSTVPYADVCNIFQEIE 141
            G  +A  +      E E  P            ST +      F  VPY+D+CN+F+EIE
Sbjct: 82  TGSLTATKNGNQGKEEHEGTPIA----------STPRQVDSKFFCKVPYSDLCNLFEEIE 131

Query: 142 STSSRLSIIKICSDFFTQIVKEDSRNLVPTTYLFINKLGPDYEPXXXXXXXXXXXXKTIS 201
            TSSRL+IIK+CSDFF +I+KED +NL+P TYLFINKLGPDYEP            KTIS
Sbjct: 132 GTSSRLAIIKLCSDFFIKIMKEDPQNLIPVTYLFINKLGPDYEPGLELGLGENLLMKTIS 191

Query: 202 ESCGKSLAQVKNRYREMGDLGQIAMEARNVQPTMFKPKPLTVGEVFVNLRNIANAQGKDS 261
           ESCGKS+ Q+KN+YRE+GDLGQIA+EARNVQPTMFKPKPL VGEVF NL+ IA +QGKDS
Sbjct: 192 ESCGKSMQQIKNQYREIGDLGQIALEARNVQPTMFKPKPLVVGEVFENLKTIAKSQGKDS 251

Query: 262 QNKKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSNALLRHEQGL-DVEP 320
           Q KK+KLIKRMLTACQG EAKFLIRSLESKLRIGLAEKTVLI+LS ALL H++   + EP
Sbjct: 252 QTKKMKLIKRMLTACQGTEAKFLIRSLESKLRIGLAEKTVLIALSKALLIHDEKYSNKEP 311

Query: 321 SDEAVDKAEQSIRDAFCQVPNYEIVINTCLEHGISQLHKHCQLTPGIPLKPMLAKPTKAI 380
           S + V++AEQ IRDAFCQVPNYE+VIN CL++GI +L +HC + PGIPLKPMLAKPTKAI
Sbjct: 312 SMDVVEQAEQKIRDAFCQVPNYELVINACLDYGIMKLDEHCTIQPGIPLKPMLAKPTKAI 371

Query: 381 TEVLDRFQGQLFVSEYKYDGERAQLHLLPDGTMRIYSRNGENMTERYPEIDIRDFLSDP- 439
            EVLDRFQGQ F SEYKYDGERAQ+HLL DGTMRIYSRNGENMTERYPEI I+DFL+DP 
Sbjct: 372 NEVLDRFQGQTFTSEYKYDGERAQVHLLKDGTMRIYSRNGENMTERYPEIQIKDFLADPA 431

Query: 440 STESLILDCEAVAWDKEQGKILPFQVLSTXXXXXXXXXXXXXXXCLFAFDLLCHNGEPLI 499
           ST SLILDCEAVAWDKEQ KILPFQVL+T               CLFAFD+L HN   LI
Sbjct: 432 STTSLILDCEAVAWDKEQNKILPFQVLTTRKRKDVNINEVKVRVCLFAFDILLHNDMRLI 491

Query: 500 NKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQSVKDSCEGLMVKMLDGPE 559
           N+ L +R++ L +VTKPV+GEF+YA ++ T+N++ELQ FLD+SVK+SCEGLMVKM+DG E
Sbjct: 492 NEPLSKRREVLHEVTKPVEGEFQYATQMTTSNLDELQKFLDESVKNSCEGLMVKMMDGVE 551

Query: 560 SHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEY 619
           S+YEPSKRSRNWLKLKKDYL GVGDSLDLCVL               FLLGCYN D+ ++
Sbjct: 552 SYYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYFGRGKRTGTYGGFLLGCYNADSEDF 611

Query: 620 ETCCKIGTGFSEELLQQLYDRLKPTAMEAPAAFYVYDSAQQPDVWFEPTLLFEVLAADLS 679
           ETCCKIGTGFSEE+LQ LY++L PT ++ P   YV+DS+ +PDVWFEPT+LFEVL ADLS
Sbjct: 612 ETCCKIGTGFSEEMLQTLYEKLSPTVIDGPKGTYVFDSSAEPDVWFEPTMLFEVLTADLS 671

Query: 680 LSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVDLYEAQAHLS 731
           LSP+YKAGS+ YDKGISLRFPRFLRIRDDKSVE+ATSSEQ++++Y+ Q+H++
Sbjct: 672 LSPIYKAGSSVYDKGISLRFPRFLRIRDDKSVEDATSSEQIIEMYQNQSHVA 723

>SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 693

 Score =  921 bits (2380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/608 (71%), Positives = 509/608 (83%), Gaps = 2/608 (0%)

Query: 124 HFSTVPYADVCNIFQEIESTSSRLSIIKICSDFFTQIVKEDSRNLVPTTYLFINKLGPDY 183
           H S +PY+DVCNIF EIESTSSRLSI+KICS+FF  ++K++  NLVP TYLFIN+LGPDY
Sbjct: 85  HHSKIPYSDVCNIFSEIESTSSRLSIVKICSNFFYSVLKQNPSNLVPITYLFINRLGPDY 144

Query: 184 EPXXXXXXXXXXXXKTISESCGKSLAQVKNRYREMGDLGQIAMEARNVQPTMFKPKPLTV 243
           EP            KTI+ESCGKSL QV+ +YRE+GDLG++A EAR VQPTMFKPKPLTV
Sbjct: 145 EPGLELGLGEGLLMKTIAESCGKSLQQVRAKYREIGDLGEVAQEARAVQPTMFKPKPLTV 204

Query: 244 GEVFVNLRNIANAQGKDSQNKKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI 303
           GEVF NL++IA +QGKDSQ +KI+LIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI
Sbjct: 205 GEVFNNLKSIAKSQGKDSQTRKIQLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI 264

Query: 304 SLSNALLRHEQGLDVEPSDEAVDKAEQSIRDAFCQVPNYEIVINTCLEHGISQLHKHCQL 363
           SLS ALL +E   + EPS E V+ AEQ +RDAFCQVPNYEIVINTCLEHGI +++KHC L
Sbjct: 265 SLSKALLSYEHDGE-EPSSELVENAEQRVRDAFCQVPNYEIVINTCLEHGIMEVNKHCVL 323

Query: 364 TPGIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGTMRIYSRNGENM 423
            PGIPLKPMLAKP+K+ITEVLDRF G+ F  EYKYDGERAQ+HLLPDG+M IYSRNGENM
Sbjct: 324 KPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQVHLLPDGSMNIYSRNGENM 383

Query: 424 TERYPEIDIRDFLSDP-STESLILDCEAVAWDKEQGKILPFQVLSTXXXXXXXXXXXXXX 482
           TERYPE+ IRD+L+DP +T SLILDCEAVAWD EQGKILPFQ+LST              
Sbjct: 384 TERYPELHIRDYLADPETTHSLILDCEAVAWDTEQGKILPFQILSTRKRKGVEAKDVKVR 443

Query: 483 XCLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQS 542
            CLFAFD+LC+NG+ LIN SL ER++ LQ+V KPV G+F++AN+L ++N+E++Q +L+QS
Sbjct: 444 VCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQFANELNSSNLEDVQKYLEQS 503

Query: 543 VKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLXXXXXXXXXXX 602
           VKD+CEGLMVK+L+G ESHYEPSKRSRNWLKLKKDYL GVGDSLDLCVL           
Sbjct: 504 VKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTG 563

Query: 603 XXXXFLLGCYNQDTGEYETCCKIGTGFSEELLQQLYDRLKPTAMEAPAAFYVYDSAQQPD 662
               FLLGCYNQDTGE+ETCCKIGTGFS+E+L  LY++LKP+++E P AFYVYDS+ +PD
Sbjct: 564 TYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLVSLYEKLKPSSLEQPKAFYVYDSSAEPD 623

Query: 663 VWFEPTLLFEVLAADLSLSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVD 722
           VWFEPT+LFEVL ADLSLSP+YKAG++ Y KGISLRFPRF+RIRDDK VE+ATSSEQ+V+
Sbjct: 624 VWFEPTMLFEVLTADLSLSPIYKAGNSAYGKGISLRFPRFIRIRDDKDVEDATSSEQIVE 683

Query: 723 LYEAQAHL 730
           LYE+Q +L
Sbjct: 684 LYESQVNL 691

>YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}
           CDC9DNA ligase found in the nucleus and mitochondria, an
           essential enzyme that joins Okazaki fragments during DNA
           replication; also acts in nucleotide excision repair,
           base excision repair, and recombination
          Length = 755

 Score =  918 bits (2373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/724 (62%), Positives = 551/724 (76%), Gaps = 24/724 (3%)

Query: 27  KQAKQATLAKFFSSVKDRNSPTKKNATPAFPTTTNVKRESPVRSNSNEKE---------- 76
           K+ KQATLA+FF+S+K  N PT+   TP+   ++    E  + + S E+E          
Sbjct: 34  KKPKQATLARFFTSMK--NKPTE--GTPSPKKSSKHMLEDRMDNVSGEEEYATKKLKQTA 89

Query: 77  -----SSPMFDDSNGRSSACSSAGLEMESAPAPKKLKMESDSNSTSKNNQDDHFSTVPYA 131
                ++P    SN  S   S+    +  +P   +  +    ++ S NN D + S +PY+
Sbjct: 90  VTHTVAAPSSMGSNFSSIPSSAPSSGVADSPQQSQRLVGEVEDALSSNNNDHYSSNIPYS 149

Query: 132 DVCNIFQEIESTSSRLSIIKICSDFFTQIVKEDSRNLVPTTYLFINKLGPDYEPXXXXXX 191
           +VC +F +IE+ SSRL II+ICSDFF +I+K+ S+NL+PTTYLFIN+LGPDYE       
Sbjct: 150 EVCEVFNKIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDYEAGLELGL 209

Query: 192 XXXXXXKTISESCGKSLAQVKNRYREMGDLGQIAMEARNVQPTMFKPKPLTVGEVFVNLR 251
                 KTISE+CGKS++Q+K +Y+++GDLG+IAM ARNVQPTMFKPKPLTVGEVF NLR
Sbjct: 210 GENLLMKTISETCGKSMSQIKLKYKDIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLR 269

Query: 252 NIANAQGKDSQNKKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSNALLR 311
            IA  QGKDSQ KK+KLIKRMLTAC+G+EAKFLIRSLESKLRIGLAEKTVLISLS ALL 
Sbjct: 270 AIAKTQGKDSQLKKMKLIKRMLTACKGIEAKFLIRSLESKLRIGLAEKTVLISLSKALLL 329

Query: 312 HEQGLDVEPSDEA----VDKAEQSIRDAFCQVPNYEIVINTCLEHGISQLHKHCQLTPGI 367
           H++  +  P  +     ++ A+Q IRDAFCQVPNYEIVIN+CLEHGI  L K+C L PGI
Sbjct: 330 HDENREDSPDKDVPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGI 389

Query: 368 PLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGTMRIYSRNGENMTERY 427
           PLKPMLAKPTKAI EVLDRFQG+ F SEYKYDGERAQ+HLL DGTMRIYSRNGENMTERY
Sbjct: 390 PLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERY 449

Query: 428 PEIDIRDFLSD-PSTESLILDCEAVAWDKEQGKILPFQVLSTXXXXXXXXXXXXXXXCLF 486
           PEI+I DF+ D  +T++LILDCEAVAWDK+QGKILPFQVLST               CLF
Sbjct: 450 PEINITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELNDVKVKVCLF 509

Query: 487 AFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQSVKDS 546
           AFD+LC+N E LINKSL+ER++ L KVTK V GEF+YA ++ T N++ELQ FLD+SV  S
Sbjct: 510 AFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQKFLDESVNHS 569

Query: 547 CEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLXXXXXXXXXXXXXXX 606
           CEGLMVKML+GPESHYEPSKRSRNWLKLKKDYL GVGDSLDLCVL               
Sbjct: 570 CEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGG 629

Query: 607 FLLGCYNQDTGEYETCCKIGTGFSEELLQQLYDRLKPTAMEAPAAFYVYDSAQQPDVWFE 666
           FLLGCYNQDTGE+ETCCKIGTGFS+E+LQ L+DRL PT ++ P A +V+DS+ +PDVWFE
Sbjct: 630 FLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHDRLTPTIIDGPKATFVFDSSAEPDVWFE 689

Query: 667 PTLLFEVLAADLSLSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVDLYEA 726
           PT LFEVL ADLSLSP+YKAGSA +DKG+SLRFPRFLRIR+DK VE+ATSS+Q+V+LYE 
Sbjct: 690 PTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYEN 749

Query: 727 QAHL 730
           Q+H+
Sbjct: 750 QSHM 753

>KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.343
           YDL164C
          Length = 727

 Score =  917 bits (2370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/720 (63%), Positives = 549/720 (76%), Gaps = 30/720 (4%)

Query: 27  KQAKQATLAKFFSSVK--DRNSPT-------KKNATPAFPTTTNVKRESPVRSNSNEKES 77
           K  +Q TL  FF+SVK  D N+P        +K+ +P  P T   +     +  + + ++
Sbjct: 20  KMKRQMTLNNFFTSVKKSDTNTPASTTPKKMEKDESPQIPATKTAEE----KHENMDVDT 75

Query: 78  SPMFDDSNGRSSACSSAGLEMESAPAP-----KKLKMESDSNSTSKNNQDDHFSTVPYAD 132
            P+   S+   SA  ++ L   ++P+P     KK+K++ ++N T      + +STVPYAD
Sbjct: 76  DPVI--SSSEVSAKRNSPL---TSPSPTPVVSKKIKIQDENNDTK-----EFYSTVPYAD 125

Query: 133 VCNIFQEIESTSSRLSIIKICSDFFTQIVKEDSRNLVPTTYLFINKLGPDYEPXXXXXXX 192
           +CN+FQEIE  SSRL+IIK+CS F   ++K D RNL+P TYLFINKLGPDY P       
Sbjct: 126 LCNLFQEIEGISSRLAIIKLCSSFLISVMKLDPRNLIPMTYLFINKLGPDYMPGLELGLG 185

Query: 193 XXXXXKTISESCGKSLAQVKNRYREMGDLGQIAMEARNVQPTMFKPKPLTVGEVFVNLRN 252
                KTI+ESCG+SL Q+K +Y E+GDLGQIA+EAR VQPTMFKPKPLTVGEVF NL++
Sbjct: 186 ENLLIKTIAESCGRSLQQIKTKYHEIGDLGQIALEARKVQPTMFKPKPLTVGEVFQNLKS 245

Query: 253 IANAQGKDSQNKKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSNALLRH 312
           IA++QGKDSQ KKIKLIKRMLT+CQGVEAKFLIRSLESKLRIGLAEKTVLISLS ALL +
Sbjct: 246 IASSQGKDSQTKKIKLIKRMLTSCQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLVY 305

Query: 313 EQG-LDVEPSDEAVDKAEQSIRDAFCQVPNYEIVINTCLEHGISQLHKHCQLTPGIPLKP 371
           E G  D +   E V+ AEQ IRDAFCQVPNYE+VI++CL+HGI  L +HC L P IPLKP
Sbjct: 306 EYGESDKDIDMETVENAEQKIRDAFCQVPNYEVVIDSCLKHGIMNLDQHCSLRPAIPLKP 365

Query: 372 MLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGTMRIYSRNGENMTERYPEID 431
           MLAKPTK+I+E+ DRFQ Q F  EYKYDGERAQ+HLL DGTMRIYSRNGENMTERYPEI 
Sbjct: 366 MLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEIH 425

Query: 432 IRDFLSDPS-TESLILDCEAVAWDKEQGKILPFQVLSTXXXXXXXXXXXXXXXCLFAFDL 490
           IRDF++D S T+SLILDCEAVAWDKEQ KILPFQVLST               CLFAFD+
Sbjct: 426 IRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIKVRVCLFAFDI 485

Query: 491 LCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQSVKDSCEGL 550
           L HN E LINKSL+ER+D L  +TK V GEF++A ++ T N+EELQ FLDQSVK+SCEGL
Sbjct: 486 LLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVKNSCEGL 545

Query: 551 MVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLXXXXXXXXXXXXXXXFLLG 610
           MVKML+G ESHYEPSKRSRNWLKLKKDYL GVGDSLDLCVL               FLLG
Sbjct: 546 MVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTGNYGGFLLG 605

Query: 611 CYNQDTGEYETCCKIGTGFSEELLQQLYDRLKPTAMEAPAAFYVYDSAQQPDVWFEPTLL 670
           CYNQDTGE+ET CKIGTGFS+E+LQQL++RLK T ++ P A YV+D + +PDVWFEPTLL
Sbjct: 606 CYNQDTGEFETACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDPSAEPDVWFEPTLL 665

Query: 671 FEVLAADLSLSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVDLYEAQAHL 730
           FEVL ADLSLSPVYKAGS+ YDKG+SLRFPRFLR+R+DK VE+ATSSEQ+V++YE QA+L
Sbjct: 666 FEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVEMYENQANL 725

>Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  915 bits (2366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/733 (63%), Positives = 555/733 (75%), Gaps = 27/733 (3%)

Query: 21  SSSQPK---KQAKQATLAKFFSSVKDR-----NSPTK------KNATPAFPT--TTNVKR 64
           SSS P    K+ KQATLA+FF+S+K++     +SP K      +N T    +   + +K+
Sbjct: 25  SSSLPSSAGKKPKQATLARFFTSMKNKPSGGSSSPEKAVKHKIENGTNEISSEGASAIKK 84

Query: 65  ESPVRSNSNEKESSPMFDDSNGRSSACSSA-GLEMESAPAPKKLKMESDSNSTSKNNQDD 123
              + +     E S M   S+   S+  S+ G++          K+E +         +D
Sbjct: 85  LKHLSAVQTPVEQSDMSSSSSPLPSSAPSSSGVDASQKSRELTPKVEEEQGPID----ND 140

Query: 124 HFST-VPYADVCNIFQEIESTSSRLSIIKICSDFFTQIVKEDSRNLVPTTYLFINKLGPD 182
           H+S+ +PY++VC +F EIE+ SSRL II+ICSDFF +I+K+ S+NL+PTTYLFIN+LGPD
Sbjct: 141 HYSSNIPYSEVCEVFNEIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPD 200

Query: 183 YEPXXXXXXXXXXXXKTISESCGKSLAQVKNRYREMGDLGQIAMEARNVQPTMFKPKPLT 242
           YEP            KTISESCGKS+ Q+K +Y+E+GDLG+IAM ARNVQPTMFKPKPLT
Sbjct: 201 YEPGLELGLGENLLMKTISESCGKSMNQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLT 260

Query: 243 VGEVFVNLRNIANAQGKDSQNKKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVL 302
           VGEVF NLR+IA  QGKDSQ +K+KLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVL
Sbjct: 261 VGEVFKNLRSIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVL 320

Query: 303 ISLSNALLRHE-QGLDVEPSD---EAVDKAEQSIRDAFCQVPNYEIVINTCLEHGISQLH 358
           ISLS ALL H   G +   +D   + ++ A+Q IRDAFCQVPNYEIVIN+CLEHGI  L 
Sbjct: 321 ISLSKALLLHGGNGENSHVNDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLD 380

Query: 359 KHCQLTPGIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGTMRIYSR 418
           K C L PGIPLKPMLAKPTKAI EVLDRFQG+ F SEYKYDGERAQ+HLL DGTMRIYSR
Sbjct: 381 KFCTLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGTMRIYSR 440

Query: 419 NGENMTERYPEIDIRDFLSD-PSTESLILDCEAVAWDKEQGKILPFQVLSTXXXXXXXXX 477
           NGENMTERYPEI I DF+ D  +T++LILDCEAVAWDKEQGKILPFQVLST         
Sbjct: 441 NGENMTERYPEIKITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVELS 500

Query: 478 XXXXXXCLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQH 537
                 CLFAFD+LCHNGE LINKSLRER++ L KVTK V GEF+YA +++T N++ELQ 
Sbjct: 501 DVKVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNLDELQK 560

Query: 538 FLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLXXXXXX 597
           FLD+SV  SCEGLMVKML+GPESHYEPSKRSRNWLKLKKDYL GVGDSLDLCVL      
Sbjct: 561 FLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGR 620

Query: 598 XXXXXXXXXFLLGCYNQDTGEYETCCKIGTGFSEELLQQLYDRLKPTAMEAPAAFYVYDS 657
                    FLLGCYNQDTGE+ETCCKIGTGFS+E LQQL++RL PT ++ P A +V+DS
Sbjct: 621 GKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDESLQQLHERLTPTIIDGPKATFVFDS 680

Query: 658 AQQPDVWFEPTLLFEVLAADLSLSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSS 717
           + +PDVWFEPT LFEVL ADLSLSP+YKAGS  + KG+SLRFPRFLRIR+DK VE+ATSS
Sbjct: 681 SAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDATSS 740

Query: 718 EQVVDLYEAQAHL 730
           EQ+V+LYE Q+H+
Sbjct: 741 EQIVELYENQSHV 753

>Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}
           YDL164C (REAL)
          Length = 845

 Score =  910 bits (2353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/721 (62%), Positives = 538/721 (74%), Gaps = 17/721 (2%)

Query: 27  KQAKQATLAKFFSSVKDR----NSPTKKNATPAFPTTTNVKRESPVRSNSNEKESS---- 78
           K+ KQATLA+FF+S+K++     SP  K+A      + +      VR+    ++ +    
Sbjct: 123 KKPKQATLARFFTSMKNKPSGNTSPPDKSAKHMLQDSVDDDSSVGVRNVKKSQQVAVAQA 182

Query: 79  ----PMFDDSNGRSSACSSAGLEMESAPAPKKLKMESDSNSTSKNNQDDHFSTVPYADVC 134
               P          + + +    + +   + L  + +    + N+ D + S +PY+DVC
Sbjct: 183 ATVQPFMSSFPSSLPSSAPSSSGADLSQKFQGLGPKVEDFEMNSNDSDHYSSNIPYSDVC 242

Query: 135 NIFQEIESTSSRLSIIKICSDFFTQIVKEDSRNLVPTTYLFINKLGPDYEPXXXXXXXXX 194
            +F +IE+ SSRL II+ICSDFF +++K+ S+NL+PTTYLFIN+LGPDYE          
Sbjct: 243 EVFNQIEAISSRLEIIRICSDFFIKVMKQSSKNLIPTTYLFINRLGPDYEAGLELGLGEN 302

Query: 195 XXXKTISESCGKSLAQVKNRYREMGDLGQIAMEARNVQPTMFKPKPLTVGEVFVNLRNIA 254
              KTISESCGKS++Q+K +Y+E+GDLG+IAM ARNVQPTMFKPKPLTVGEVF NLR IA
Sbjct: 303 LLMKTISESCGKSMSQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRTIA 362

Query: 255 NAQGKDSQNKKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSNALLRH-- 312
             QGKDSQ +KIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLS ALL H  
Sbjct: 363 KTQGKDSQLRKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHDE 422

Query: 313 --EQGLDVEPSDEAVDKAEQSIRDAFCQVPNYEIVINTCLEHGISQLHKHCQLTPGIPLK 370
             E   D +   + ++ A+Q IRDAFCQVPNYEIVIN+CLEHGI  L K+C L PGIPLK
Sbjct: 423 NRENSADKDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLK 482

Query: 371 PMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGTMRIYSRNGENMTERYPEI 430
           PMLAKPTKAI EVLDRFQG+ F SEYKYDGERAQ+HLL DGTMRIYSRNGENMTERYPEI
Sbjct: 483 PMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEI 542

Query: 431 DIRDFLSDPS-TESLILDCEAVAWDKEQGKILPFQVLSTXXXXXXXXXXXXXXXCLFAFD 489
            I DF+ D   T++LILDCEAVAWDK+Q KILPFQVLST               CLFAFD
Sbjct: 543 KITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVELNDVKVRVCLFAFD 602

Query: 490 LLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQSVKDSCEG 549
           +LCHN E LIN SLRER++ L KVTK V GEF+YA ++IT N++ELQ FLD+SV  SCEG
Sbjct: 603 ILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQKFLDESVNHSCEG 662

Query: 550 LMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLXXXXXXXXXXXXXXXFLL 609
           LMVKMLDG ESHYEPSKRSRNWLKLKKDYL GVGDSLDLCVL               FLL
Sbjct: 663 LMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLL 722

Query: 610 GCYNQDTGEYETCCKIGTGFSEELLQQLYDRLKPTAMEAPAAFYVYDSAQQPDVWFEPTL 669
           GCYNQDTGE+ETCCKIGTGFS+E+LQ L+ RL PT ++ P A YV+DS+ +PDVWFEPT 
Sbjct: 723 GCYNQDTGEFETCCKIGTGFSDEMLQLLHARLTPTIIDGPKATYVFDSSAEPDVWFEPTT 782

Query: 670 LFEVLAADLSLSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVDLYEAQAH 729
           LFEVL ADLSLSP+YKAGS  +DKG+SLRFPRFLRIR+DK VE+ATSS+Q+V+LYE Q+H
Sbjct: 783 LFEVLTADLSLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQSH 842

Query: 730 L 730
           +
Sbjct: 843 V 843

>Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  910 bits (2352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/728 (63%), Positives = 552/728 (75%), Gaps = 24/728 (3%)

Query: 23  SQPKKQAKQATLAKFFSSVKDRNSPTKKNATPAFPTTTNVKRESPVRSNSNE-KESSPMF 81
           S   K+ KQATLA+FFSS+K  N P+  +++P        K E+ + +NS+E  +++   
Sbjct: 30  SSAGKKPKQATLARFFSSMK--NEPSGSSSSPE--KAPKHKLENNIDNNSSEGADATKKL 85

Query: 82  DDSNGRSS--ACSSAGLEMESAPAPKKLKMESDSNSTSK-----------NNQDDHFST- 127
              +   +  A S+ G    S P+        D +  S+           +N +DH+S+ 
Sbjct: 86  KQVSTVQTLVAPSTMGSSPFSLPSSAPSSSGVDVSQESREFTPQVEKEPSSNDNDHYSSN 145

Query: 128 VPYADVCNIFQEIESTSSRLSIIKICSDFFTQIVKEDSRNLVPTTYLFINKLGPDYEPXX 187
           +PY++VC +F +IE+ SSRL II+ICSDFF +I+ + S+NL+PTTYLFIN+LGPDYE   
Sbjct: 146 IPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMNQSSKNLIPTTYLFINRLGPDYEAGL 205

Query: 188 XXXXXXXXXXKTISESCGKSLAQVKNRYREMGDLGQIAMEARNVQPTMFKPKPLTVGEVF 247
                     KTISESCGKS++Q+K +Y+EMGDLG+IAM ARNVQPTMFKPK LTVGEVF
Sbjct: 206 ELGLGENLLMKTISESCGKSMSQIKLKYKEMGDLGEIAMGARNVQPTMFKPKALTVGEVF 265

Query: 248 VNLRNIANAQGKDSQNKKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSN 307
            NLR IA  QGKDSQ +K+KLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLS 
Sbjct: 266 KNLRTIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSK 325

Query: 308 ALLRHEQGLDVEPSDE----AVDKAEQSIRDAFCQVPNYEIVINTCLEHGISQLHKHCQL 363
           ALL H++  +  P  E     ++ A+Q IRDAFCQVPNYEIVIN+CL HGI  L K+C L
Sbjct: 326 ALLLHDENKENSPDKEIPMDVLESAQQRIRDAFCQVPNYEIVINSCLNHGIMNLDKYCTL 385

Query: 364 TPGIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGTMRIYSRNGENM 423
            PGIPLKPMLAKPTKAI EVLDRFQG+ F SEYKYDGERAQ+HLL DGTMRIYSRNGENM
Sbjct: 386 RPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENM 445

Query: 424 TERYPEIDIRDFLSD-PSTESLILDCEAVAWDKEQGKILPFQVLSTXXXXXXXXXXXXXX 482
           TERYPEI I DF+ D  ST++LILDCEAVAWDKEQ KILPFQ+LST              
Sbjct: 446 TERYPEIKITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVELHDVKVK 505

Query: 483 XCLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQS 542
            CLFAFD+LC+N E LINKSLRER++ L KVTK V GEF+YA ++IT N++ELQ FLD+S
Sbjct: 506 VCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDELQKFLDES 565

Query: 543 VKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLXXXXXXXXXXX 602
           V +SCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYL GVGDSLDLCVL           
Sbjct: 566 VNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTG 625

Query: 603 XXXXFLLGCYNQDTGEYETCCKIGTGFSEELLQQLYDRLKPTAMEAPAAFYVYDSAQQPD 662
               FLLGCYNQDTGE+ETCCKIGTGFS+E+LQ L++RL PT ++ P A +V+D++ +PD
Sbjct: 626 TYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHERLTPTIIDGPKATFVFDASAEPD 685

Query: 663 VWFEPTLLFEVLAADLSLSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVD 722
           VWFEPT LFEVL ADLSLSP+YKAGSA +DKG+SLRFPRFLRIR+DK VE+ATSS+Q+++
Sbjct: 686 VWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIIE 745

Query: 723 LYEAQAHL 730
           LYE Q+H+
Sbjct: 746 LYENQSHV 753

>Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL164C
           (CDC9) - DNA ligase [contig 161] FULL
          Length = 715

 Score =  902 bits (2330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/724 (62%), Positives = 538/724 (74%), Gaps = 15/724 (2%)

Query: 13  VRRFGMATSSSQPKKQAKQATLAKFFSSVKDRNSPTKKNATPAFPTTTNVKRESPVRSNS 72
           +R   ++ SS++     KQATLAKFFSS K  N   +     A  +  N     P  S  
Sbjct: 2   IRTVRLSMSSAK-----KQATLAKFFSSKKRSNDEKEGPQESAKKSQLNAIDAKPESS-- 54

Query: 73  NEKESSPMFDDSNGRS---SACSSAGLEMESAPAPKKLKMESDSNSTSKNN-QDDHFSTV 128
             K S P  D++N  +      S+A  + E A  P KL +E      +K        S V
Sbjct: 55  --KGSQPNVDETNHETLQKPQLSAAEPKTEFAMNPAKLAVEKSHGDVAKIGISAPKDSNV 112

Query: 129 PYADVCNIFQEIESTSSRLSIIKICSDFFTQIVKEDSRNLVPTTYLFINKLGPDYEPXXX 188
            Y+++C++F EIE TSSRL I+K+CSDF   ++ +  ++LVP TYL INKLGPDY+P   
Sbjct: 113 MYSEMCSVFNEIEGTSSRLQIVKLCSDFLYSVLTKTRKDLVPITYLLINKLGPDYQPGLE 172

Query: 189 XXXXXXXXXKTISESCGKSLAQVKNRYREMGDLGQIAMEARNVQPTMFKPKPLTVGEVFV 248
                    KTISESCGKSL QVK RYRE+GDLG+IA EAR+VQPTMFKPKPLT G VF 
Sbjct: 173 LGLGEGLLMKTISESCGKSLQQVKARYRELGDLGRIAQEARSVQPTMFKPKPLTTGMVFA 232

Query: 249 NLRNIANAQGKDSQNKKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSNA 308
           NL++IA AQGKDSQ +K++LIK+MLTAC+GVEAKFLIRSLESKLRIGLAEK+VL++LS A
Sbjct: 233 NLQDIARAQGKDSQLRKVQLIKKMLTACEGVEAKFLIRSLESKLRIGLAEKSVLVALSKA 292

Query: 309 LLRHEQGLDVEPSDEAVDKAEQSIRDAFCQVPNYEIVINTCLEHGISQLHKHCQLTPGIP 368
           +L HE G   EPS + VD AEQ IRDAFCQVPNYEIVIN  LEHGI +L KHC LTPGIP
Sbjct: 293 ILTHEHG-GKEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIP 351

Query: 369 LKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGTMRIYSRNGENMTERYP 428
           LKPMLAKP+K+I+EVLDRFQGQ F  EYKYDGERAQ+HLLPDG+MRIYSRNGENMTERYP
Sbjct: 352 LKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYP 411

Query: 429 EIDIRDFLSDP-STESLILDCEAVAWDKEQGKILPFQVLSTXXXXXXXXXXXXXXXCLFA 487
           EI+I DF++ P  T +LILDCEAVAWDK++  ILPFQVLST               CLFA
Sbjct: 412 EINISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVKVRVCLFA 471

Query: 488 FDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQSVKDSC 547
           FD+LC+N EPLINKSL ER+  L+++ KPV GE + A+++ T +++E+Q +LDQSVKD C
Sbjct: 472 FDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKDCC 531

Query: 548 EGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLXXXXXXXXXXXXXXXF 607
           EGLMVK+LDG ESHYEPSKRSRNWLKLKKDYL GVGDSLDLCVL               F
Sbjct: 532 EGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGF 591

Query: 608 LLGCYNQDTGEYETCCKIGTGFSEELLQQLYDRLKPTAMEAPAAFYVYDSAQQPDVWFEP 667
           LLGCYNQDTGE+ETCCKIGTGFS+E+LQ LY++L PT +  P AFYVY  + QPDVW EP
Sbjct: 592 LLGCYNQDTGEFETCCKIGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYSESAQPDVWLEP 651

Query: 668 TLLFEVLAADLSLSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVDLYEAQ 727
           ++LFEVL ADLSLSPVYKAG + Y KGISLRFPRF+RIRDDKSVE+ATSSEQV++ YE+Q
Sbjct: 652 SMLFEVLTADLSLSPVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQ 711

Query: 728 AHLS 731
           +H++
Sbjct: 712 SHIN 715

>NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {ON}
           Anc_7.343 YDL164C
          Length = 765

 Score =  899 bits (2324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/736 (62%), Positives = 544/736 (73%), Gaps = 33/736 (4%)

Query: 19  ATSSSQPKKQAKQATLAKFFSSVKDRNSPTKKNATPAFPTTTNVKRESPVRSNSNEKESS 78
           A  ++  K + +QATL +FFSS+ +   PTK  A         +K ES   +    K+ S
Sbjct: 39  ARENNVSKGRKQQATLGRFFSSI-NHKKPTKDTA---------LKNESKEETKEENKDDS 88

Query: 79  PMFDDSNGRSSACSSAGLEM-ESAP-APKKLKMESDSNSTSKNNQD-------DH----- 124
                   R S  SS+   M ES P +P KL  E  S+  S +          DH     
Sbjct: 89  DSIPRKKIRLSTSSSSPSIMAESKPKSPIKLNTERSSSPASASASTTPTPIVADHTLDPK 148

Query: 125 -------FSTVPYADVCNIFQEIESTSSRLSIIKICSDFFTQIVKEDSRNLVPTTYLFIN 177
                     +PY +VC +FQEIE+TSSRLSIIK+CSDF  +I+K+D +NL+P TYLFIN
Sbjct: 149 TAVSKPFLCAIPYKEVCQLFQEIETTSSRLSIIKLCSDFLIKIMKQDPQNLIPVTYLFIN 208

Query: 178 KLGPDYEPXXXXXXXXXXXXKTISESCGKSLAQVKNRYREMGDLGQIAMEARNVQPTMFK 237
           KLGPDYEP            KTISESCGKSL Q++ +YRE+GDLGQIA+EARNVQPTMFK
Sbjct: 209 KLGPDYEPGLELGLGEGLLMKTISESCGKSLTQIRAQYRELGDLGQIALEARNVQPTMFK 268

Query: 238 PKPLTVGEVFVNLRNIANAQGKDSQNKKIKLIKRMLTACQ-GVEAKFLIRSLESKLRIGL 296
           PKPLTVGEVF NL+ IA A GKDSQ KKIKLIKRMLTAC+ GVEAKFLIRSLESKLRIGL
Sbjct: 269 PKPLTVGEVFNNLKMIAKAAGKDSQTKKIKLIKRMLTACEDGVEAKFLIRSLESKLRIGL 328

Query: 297 AEKTVLISLSNALLRHEQGLDVEPSDEAVDKAEQSIRDAFCQVPNYEIVINTCLEHGISQ 356
           AEKTVLISLS ALL  E   + +   E ++ AE  IRDAFCQVPNYEIVIN+CL++GI  
Sbjct: 329 AEKTVLISLSKALLVKEFDANKDFDMELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMN 388

Query: 357 LHKHCQLTPGIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGTMRIY 416
           L++HC L PGIPLKPMLAKPTKAI E+LDRFQG+ F SEYKYDGERAQ+HLL DGTMRIY
Sbjct: 389 LNEHCSLRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGTMRIY 448

Query: 417 SRNGENMTERYPEIDIRDFLSDPS-TESLILDCEAVAWDKEQGKILPFQVLSTXXXXXXX 475
           SRNGENMTERYPEI I DF+ D + T++LILDCEAVAWDKEQ KILPFQVLST       
Sbjct: 449 SRNGENMTERYPEIHIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVL 508

Query: 476 XXXXXXXXCLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEEL 535
                   CLFAFD+LCHN   LIN SL+ER++ L +VT P  GEF+YA +L T+N++EL
Sbjct: 509 AKDVKVRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDEL 568

Query: 536 QHFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLXXXX 595
           Q FLDQSV DSCEGLMVKML+G ESHYEPSKRSRNWLKLKKDYL G+GDSLDLCVL    
Sbjct: 569 QKFLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLGAYY 628

Query: 596 XXXXXXXXXXXFLLGCYNQDTGEYETCCKIGTGFSEELLQQLYDRLKPTAMEAPAAFYVY 655
                      FLLGCYN +TGE+ETCCKIGTGFS+E+LQQL+++LK T ++ P A Y+Y
Sbjct: 629 GRGKRTGTYGGFLLGCYNDNTGEFETCCKIGTGFSDEMLQQLHEKLKATVIDGPKATYIY 688

Query: 656 DSAQQPDVWFEPTLLFEVLAADLSLSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEAT 715
           DS+ +PDVWFEP+LLFEVL ADLSLSP+YKAGS+ YDKG+SLRFPRF+RIR+DK VE+AT
Sbjct: 689 DSSAEPDVWFEPSLLFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDAT 748

Query: 716 SSEQVVDLYEAQAHLS 731
           SSEQ+++LYE Q+H S
Sbjct: 749 SSEQIIELYENQSHRS 764

>Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON}
           (195103..197283) [2181 nt, 727 aa]
          Length = 726

 Score =  887 bits (2291), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/706 (62%), Positives = 530/706 (75%), Gaps = 14/706 (1%)

Query: 30  KQATLAKFFSSVKDRNSPTKKNATPAFPTTTNVKRESPVRSNSNEKESSPMFDDSNGRSS 89
           KQATLA+FFSS+     P +K    +   +T + ++     +S+  +   +  D    +S
Sbjct: 28  KQATLARFFSSM-----PKRKIDDDSSTDSTTINKDD----DSDTSKKIKLNSDETPTTS 78

Query: 90  ACSSAGLEMESAPAPKKLKMESDSNSTSKNNQDDHFSTVPYADVCNIFQEIESTSSRLSI 149
           A S    +  S  +  +  + + +   S       FSTVPYAD+C +FQE+ESTSSRLSI
Sbjct: 79  AGSVTSKDEPSLTSSPQKPIVTPAKVPSNTKPVKFFSTVPYADLCEVFQEVESTSSRLSI 138

Query: 150 IKICSDFFTQIVKEDSRNLVPTTYLFINKLGPDYEPXXXXXXXXXXXXKTISESCGKSLA 209
           IKICSDF  +++K+D +NLVP TYLFINKLGPDYEP            KTISESCGKS+ 
Sbjct: 139 IKICSDFLIKVMKQDPQNLVPITYLFINKLGPDYEPGLELGLGEGLLMKTISESCGKSMQ 198

Query: 210 QVKNRYREMGDLGQIAMEARNVQPTMFKPKPLTVGEVFVNLRNIANAQGKDSQNKKIKLI 269
           Q+KN+YRE+GDLGQIA +ARNVQPTMFKPKPLTVGEVF NL++IA +QGKDSQ +K++LI
Sbjct: 199 QLKNQYREIGDLGQIAQDARNVQPTMFKPKPLTVGEVFQNLKDIAQSQGKDSQQRKMRLI 258

Query: 270 KRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSNALLRHEQGLDVEPSDEAVDKAE 329
           KRMLTAC+GVEAKFLIRSLESKLRIGLAEKTVLISLS ALL +E     +PS E ++ AE
Sbjct: 259 KRMLTACKGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLNEYETSKDPSMELIETAE 318

Query: 330 QSIRDAFCQVPNYEIVINTCLEHGISQLHKHCQLTPGIPLKPMLAKPTKAITEVLDRFQG 389
           + IRDAFCQVPNYEI+I +CL  GI +L  +C+L PGIPLKPMLAKPTKAI EVLD FQG
Sbjct: 319 EKIRDAFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKPTKAINEVLDAFQG 378

Query: 390 QLFVSEYKYDGERAQLHLLPDGTMRIYSRNGENMTERYPEIDIRDFL----SDPSTE-SL 444
           + F  EYKYDGER Q+HLL +G MRIYSRNGENMTERYPE+ I DFL    S+   E SL
Sbjct: 379 EEFTCEYKYDGERGQVHLLSNGEMRIYSRNGENMTERYPELHIEDFLVKDESNTDKEVSL 438

Query: 445 ILDCEAVAWDKEQGKILPFQVLSTXXXXXXXXXXXXXXXCLFAFDLLCHNGEPLINKSLR 504
           ILDCE VAWD EQ KILPFQVLST               CLFAFD+L +NGE LI K+LR
Sbjct: 439 ILDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDVKVRVCLFAFDILYYNGEGLITKTLR 498

Query: 505 ERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQSVKDSCEGLMVKMLDGPESHYEP 564
           ER+  L +VTK V GEF+YA  LITA ++E+Q FLDQ++KDSCEGLMVK+LDG ES YEP
Sbjct: 499 ERRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRYEP 558

Query: 565 SKRSRNWLKLKKDYLNGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEYETCCK 624
           SKRSRNWLKLKKDYL GVGDSLDLCV+               FLLGCYNQD+GEYETCCK
Sbjct: 559 SKRSRNWLKLKKDYLAGVGDSLDLCVMGAYYGKGKRTGTYGGFLLGCYNQDSGEYETCCK 618

Query: 625 IGTGFSEELLQQLYDRLKPTAMEAPAAFYVYDSAQQPDVWFEPTLLFEVLAADLSLSPVY 684
           IGTGFS+E+L +LY+  +   +E P +FY +DS+ +PD+WFEP +LFEVL ADLSLSP+Y
Sbjct: 619 IGTGFSDEMLTKLYELFREEEIEVPKSFYNFDSSAEPDIWFEPKVLFEVLTADLSLSPIY 678

Query: 685 KAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVDLYEAQAHL 730
           KAGSA YDKGISLRFPRFLRIRDDKSVE+ATSS+Q++++YE Q+H+
Sbjct: 679 KAGSATYDKGISLRFPRFLRIRDDKSVEDATSSDQIIEMYENQSHI 724

>KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 723

 Score =  884 bits (2284), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/731 (61%), Positives = 527/731 (72%), Gaps = 50/731 (6%)

Query: 30  KQATLAKFFSSVKDRNSPTKKNATPAFPTTTN------------------------VKRE 65
           KQATLAKFFSS K R+   +K+  PA    ++                        VK E
Sbjct: 14  KQATLAKFFSS-KKRSVEEEKSHEPAKKLHSDPIGAGSGSPSSSPPLATGSSDAGSVKVE 72

Query: 66  SPVRSNS-NEKESSPMFDDSN---GRSSACSSAGLEMESAPAPKKLKMESDSNSTSKNNQ 121
           +   S   N K  +P   DS+    R+ A +        A APK                
Sbjct: 73  TSATSTGENTKAGTPTLPDSDEPAKRAVAATKGDPAKLGASAPKD--------------- 117

Query: 122 DDHFSTVPYADVCNIFQEIESTSSRLSIIKICSDFFTQIVKEDSRNLVPTTYLFINKLGP 181
               S + YA++CN+F EIE TSSRL I+K+C DF   ++ +  +++VP TYL INKLGP
Sbjct: 118 ----SKILYAEMCNVFNEIEGTSSRLQIVKLCGDFLYSVLLKARKDIVPITYLLINKLGP 173

Query: 182 DYEPXXXXXXXXXXXXKTISESCGKSLAQVKNRYREMGDLGQIAMEARNVQPTMFKPKPL 241
           DY+P            KTISESCGKSL Q+K RYRE+GDLG+IA EAR VQPTMFKPKPL
Sbjct: 174 DYQPGLELGLGEGLLMKTISESCGKSLQQIKARYRELGDLGRIAQEARAVQPTMFKPKPL 233

Query: 242 TVGEVFVNLRNIANAQGKDSQNKKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTV 301
           T GEVF NL+ IA +QGKDSQ +K++LIKRMLTACQG+EAKFLIRSLESKLRIGLAEK+V
Sbjct: 234 TTGEVFSNLQAIARSQGKDSQLRKVQLIKRMLTACQGLEAKFLIRSLESKLRIGLAEKSV 293

Query: 302 LISLSNALLRHEQGLDVEPSDEAVDKAEQSIRDAFCQVPNYEIVINTCLEHGISQLHKHC 361
           L++LS ALL +E     EPS E VD AEQ IRDAFCQVPNY+IVI T LEHGI +L KHC
Sbjct: 294 LVALSKALLTYEHN-GKEPSSELVDTAEQKIRDAFCQVPNYQIVIETALEHGIMELDKHC 352

Query: 362 QLTPGIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGTMRIYSRNGE 421
            LTPGIPLKPMLAKP+K+I+EVLDRFQGQ F  EYKYDGERAQ+HLLPDG+MRIYSRNGE
Sbjct: 353 VLTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGE 412

Query: 422 NMTERYPEIDIRDFLSDPS-TESLILDCEAVAWDKEQGKILPFQVLSTXXXXXXXXXXXX 480
           NMTERYPEI I DF++DP+ T +LILDCEAVAWDKE+  ILPFQVLST            
Sbjct: 413 NMTERYPEIRISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVK 472

Query: 481 XXXCLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLD 540
              CLFAFD+LC+N EPLI + L ER+  L++   PV GE + A+++ T +++ELQH+LD
Sbjct: 473 VRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLD 532

Query: 541 QSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLXXXXXXXXX 600
           Q+V+D CEGLMVK+L+G ESHYEPSKRSRNWLKLKKDYL GVGDSLDLCVL         
Sbjct: 533 QAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKR 592

Query: 601 XXXXXXFLLGCYNQDTGEYETCCKIGTGFSEELLQQLYDRLKPTAMEAPAAFYVYDSAQQ 660
                 FLLGCYNQD+GEYETCCKIGTGFSEE+LQ L+DRL PTA+  P AFYV+  +  
Sbjct: 593 TGTYGGFLLGCYNQDSGEYETCCKIGTGFSEEMLQTLFDRLSPTAIPTPKAFYVHSESAP 652

Query: 661 PDVWFEPTLLFEVLAADLSLSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQV 720
           PDVWFEPTLLFEVL ADLSLSPVYKAG++ Y KGISLRFPRF+R+RDDK+ EEATSSEQV
Sbjct: 653 PDVWFEPTLLFEVLTADLSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQV 712

Query: 721 VDLYEAQAHLS 731
           V+ YE+Q+H+S
Sbjct: 713 VEFYESQSHVS 723

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score =  879 bits (2271), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/630 (67%), Positives = 501/630 (79%), Gaps = 2/630 (0%)

Query: 104 PKKLKMESDSNSTSKNNQDDHF-STVPYADVCNIFQEIESTSSRLSIIKICSDFFTQIVK 162
           PK   +ES    +S+      F   +PYADVC +FQEIE+ SSRL IIK+CS+FFT+ +K
Sbjct: 80  PKLSPIESSKTDSSETTVKQEFVCDIPYADVCVLFQEIENISSRLQIIKLCSEFFTKAMK 139

Query: 163 EDSRNLVPTTYLFINKLGPDYEPXXXXXXXXXXXXKTISESCGKSLAQVKNRYREMGDLG 222
           +++ NL+P TYLFINKLGPDYE             KTISESCGKSL QVK  Y+++GDLG
Sbjct: 140 QNTANLIPLTYLFINKLGPDYEMGLELGLGENLLMKTISESCGKSLQQVKLDYKDIGDLG 199

Query: 223 QIAMEARNVQPTMFKPKPLTVGEVFVNLRNIANAQGKDSQNKKIKLIKRMLTACQGVEAK 282
            IAM ARNVQPTMFKPKPLTVG VF NL+ IA + GKDSQ KKI+LIK++LTAC+G+EAK
Sbjct: 200 TIAMNARNVQPTMFKPKPLTVGYVFQNLKLIAKSSGKDSQLKKIRLIKKLLTACKGIEAK 259

Query: 283 FLIRSLESKLRIGLAEKTVLISLSNALLRHEQGLDVEPSDEAVDKAEQSIRDAFCQVPNY 342
           +LIRSLESKLRIGLAEK+VLISLS ALL +E    ++P  E ++KAEQ IRDAFCQ+PNY
Sbjct: 260 YLIRSLESKLRIGLAEKSVLISLSKALLINEYNNTLDPDMELIEKAEQKIRDAFCQIPNY 319

Query: 343 EIVINTCLEHGISQLHKHCQLTPGIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGER 402
           EIVIN+CL++GI  L +HC L PGIPLKPMLAKPTK I EV DRFQ   F SEYKYDGER
Sbjct: 320 EIVINSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGER 379

Query: 403 AQLHLLPDGTMRIYSRNGENMTERYPEIDIRDFLSDPS-TESLILDCEAVAWDKEQGKIL 461
           AQ+HL+ DG+MRIYSRNGENMTERYPEI++ DF+ D + T+SLI+DCEAVAWD+E+ KIL
Sbjct: 380 AQVHLMNDGSMRIYSRNGENMTERYPEINVTDFIKDLNLTKSLIIDCEAVAWDREEKKIL 439

Query: 462 PFQVLSTXXXXXXXXXXXXXXXCLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEF 521
           PFQVLST               CLFAFD+LCHN E LINKSLRER++ L  VT+ V GEF
Sbjct: 440 PFQVLSTRKRKDVDIKDIKVRICLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEF 499

Query: 522 RYANKLITANIEELQHFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNG 581
            YA +L T N++ELQ FLDQSVKDSCEGLMVK+LDG +SHYEPSKRSRNWLKLKKDYL+G
Sbjct: 500 TYAKELSTNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDG 559

Query: 582 VGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEYETCCKIGTGFSEELLQQLYDRL 641
           VGDSLDLCVL               FLLGCYNQDTGE+ET CKIGTGFS+E+LQ LYDRL
Sbjct: 560 VGDSLDLCVLGAFYGRGKRTGTYGGFLLGCYNQDTGEFETACKIGTGFSDEVLQSLYDRL 619

Query: 642 KPTAMEAPAAFYVYDSAQQPDVWFEPTLLFEVLAADLSLSPVYKAGSAQYDKGISLRFPR 701
           K T ++ P A Y+YDS+ QPDVWFEPTLLFEVL ADLS+SP+YKAG++ Y KGISLRFPR
Sbjct: 620 KSTTIDGPKATYIYDSSAQPDVWFEPTLLFEVLTADLSMSPIYKAGASTYSKGISLRFPR 679

Query: 702 FLRIRDDKSVEEATSSEQVVDLYEAQAHLS 731
           F+R+R+DKSVEEATSSEQ+++LYE Q+H++
Sbjct: 680 FIRLREDKSVEEATSSEQIIELYENQSHVA 709

>KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]
           {ON} similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination,
          Length = 700

 Score =  817 bits (2111), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/705 (58%), Positives = 502/705 (71%), Gaps = 34/705 (4%)

Query: 27  KQAKQATLAKFFSSVKDRNSPTKKNATPAFPTTTNVKRESPVRSNSNEKESSPMFDDSNG 86
           K++KQ TL  F     ++     +    A P  T      PV+S S+    +P    S G
Sbjct: 28  KRSKQLTLDGFLRP--NKKQKVDEEGDSAMPDETAAA--PPVKSESSLSNITP--PKSRG 81

Query: 87  RSSACSSAGLEMESAPAPKKLKMESDSNSTSKNNQDDHFSTVPYADVCNIFQEIESTSSR 146
            +             P P KLK  S+               +P+A++C+ FQ IE TSSR
Sbjct: 82  ETLT-----------PVPSKLKFHSN---------------IPFAELCDTFQAIEVTSSR 115

Query: 147 LSIIKICSDFFTQIVKEDSRNLVPTTYLFINKLGPDYEPXXXXXXXXXXXXKTISESCGK 206
           L+I  ICS F   +++ D  +LVP TYLFI+KLGPDYEP            KTISE+CGK
Sbjct: 116 LAITAICSKFLYSVLERDPESLVPITYLFIHKLGPDYEPGLELGLGESLLIKTISEACGK 175

Query: 207 SLAQVKNRYREMGDLGQIAMEARNVQPTMFKPKPLTVGEVFVNLRNIANAQGKDSQNKKI 266
           S+ Q++N+YRE+GDLG+IAM+ARNVQPTMFKPKPLTVGEVF NL +IA + GKDSQ++K 
Sbjct: 176 SIQQIRNKYREIGDLGEIAMQARNVQPTMFKPKPLTVGEVFNNLVSIAKSNGKDSQSRKG 235

Query: 267 KLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSNALLRHEQGLDVEPSDEAVD 326
            LIK+MLTAC+G EAKFLIRSLESKLRIGLAEKTVLIS+S A+L HE     EPS E V+
Sbjct: 236 SLIKKMLTACKGYEAKFLIRSLESKLRIGLAEKTVLISVSKAILTHEHN-GQEPSTEMVE 294

Query: 327 KAEQSIRDAFCQVPNYEIVINTCLEHGISQLHKHCQLTPGIPLKPMLAKPTKAITEVLDR 386
           +AE  IRDAFCQVPNYE++IN  L++GI  L++H +L PGIPL+PMLAKPTK+I+EVLDR
Sbjct: 295 QAESLIRDAFCQVPNYEMIINVALQYGIMNLNQHIKLRPGIPLQPMLAKPTKSISEVLDR 354

Query: 387 FQGQLFVSEYKYDGERAQLHLLPDGTMRIYSRNGENMTERYPEIDIRDFLSD-PSTESLI 445
           FQG  F  EYKYDGERAQ+HL  DG+M+IYSRNGE+MTERYPEID++ ++ D  +T+S I
Sbjct: 355 FQGTKFTCEYKYDGERAQVHLCRDGSMKIYSRNGEDMTERYPEIDVKHYVKDLGATKSFI 414

Query: 446 LDCEAVAWDKEQGKILPFQVLSTXXXXXXXXXXXXXXXCLFAFDLLCHNGEPLINKSLRE 505
           +D EAVAWD+EQGKILPFQVLST               CL+AFD+LC N EPLINKS  E
Sbjct: 415 VDSEAVAWDQEQGKILPFQVLSTRKRKGVELKDVKVRVCLYAFDILCLNDEPLINKSFHE 474

Query: 506 RQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQSVKDSCEGLMVKMLDGPESHYEPS 565
           R+  L        G+F +AN+L T N +ELQ +LDQSVKDSCEGLMVKML+G ESHYEPS
Sbjct: 475 RRQILLDTFNGTQGQFDFANELTTTNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPS 534

Query: 566 KRSRNWLKLKKDYLNGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEYETCCKI 625
           KRSRNWLKLKKDYL GVGDSLDL VL               FLLGCYN D+ E+ETCCKI
Sbjct: 535 KRSRNWLKLKKDYLEGVGDSLDLVVLGAYYGRGKRTGTYGGFLLGCYNLDSEEFETCCKI 594

Query: 626 GTGFSEELLQQLYDRLKPTAMEAPAAFYVYDSAQQPDVWFEPTLLFEVLAADLSLSPVYK 685
           GTGFS+E+LQ LY +LK T +E P+   +YDS+   DVWFEP++LFEVL ADLSLSPVYK
Sbjct: 595 GTGFSDEMLQDLYTKLKDTTVEHPSTNVIYDSSAPADVWFEPSMLFEVLTADLSLSPVYK 654

Query: 686 AGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVDLYEAQAHL 730
           AG   + KGISLRFPRF+RIRDDK+V +ATSS+QV++ YE+QAH+
Sbjct: 655 AGFEAFGKGISLRFPRFVRIRDDKNVTDATSSDQVIEFYESQAHM 699

>TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.343
           YDL164C
          Length = 736

 Score =  808 bits (2086), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/746 (56%), Positives = 518/746 (69%), Gaps = 66/746 (8%)

Query: 15  RFGMA------TSSSQPKKQAKQATLAKFFSSVKDRNSPTKKNATPAFPTTTNVKRESPV 68
           RFG A      T S+  +   KQATLA+FF+S+  +  P  + AT         K+ESP 
Sbjct: 25  RFGTASLLYTRTMSNSLEPSKKQATLARFFTSMGKKTPPAVEVAT---------KQESPE 75

Query: 69  RSNSNEKESSPMFDDSNGRSSACSSAGLEMESAPAPKKLKMESDSNSTSKNNQDDHFSTV 128
                +++       S G S          E A +P                 D   STV
Sbjct: 76  NHVDKKRKVEVHPSQSVGAS----------EKAESPP----------------DQTKSTV 109

Query: 129 PYADVCNIFQEIESTSSRLSIIKICSDFFTQIVKEDSRNLVPTTYLFINKLGPDYEPXXX 188
            Y++VCN+FQ+IE TSSRL+IIK+CS+FF +++K +  +++   YLFIN+LGPDYEP   
Sbjct: 110 LYSEVCNLFQQIEETSSRLAIIKLCSEFFIRVIKNNPSDIIIVAYLFINRLGPDYEPGLE 169

Query: 189 XXXXXXXXXKTISESCGKSLAQVKNRYREMGDLGQIAMEARNVQPTMFKPKPLTVGEVFV 248
                    KTISE+ GKS+ Q+K   +E GDLG IA +ARN+QPTMFKPKPLT+ +VF 
Sbjct: 170 LGLGENLLIKTISEAYGKSIKQIKLELKETGDLGTIARDARNIQPTMFKPKPLTISDVFN 229

Query: 249 NLRNIANAQGKDSQNKKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSNA 308
           NL+ IA+A GKDSQ +KIKLIK+ML+A +G+EAKFLIRSLESKLRIGLAEKTVLISLS A
Sbjct: 230 NLKKIASATGKDSQLRKIKLIKQMLSASKGLEAKFLIRSLESKLRIGLAEKTVLISLSKA 289

Query: 309 LLRHEQGL----------DVEPSDEAVDKAEQSIRDAFCQVPNYEIVINTCLEHGISQLH 358
           LL HE             DVE  D  +++AE  +R+A CQVPNYEIVIN CL+ GI  + 
Sbjct: 290 LLLHEHWKEKGESKFDEEDVESMD-LIEQAEAKLREAHCQVPNYEIVINLCLQDGILNID 348

Query: 359 KHCQLTPGIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGTMRIYSR 418
           K C L PGIPLKPMLAKPTKAITEVL+ FQG+ F+SEYKYDGERAQ+HLL  G MRIYSR
Sbjct: 349 KTCTLRPGIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLEGGEMRIYSR 408

Query: 419 NGENMTERYPEIDIRDFL-------SDPSTES-------LILDCEAVAWDKEQGKILPFQ 464
           NGENMTERYPE+D++DFL       +D   E+       +ILDCE VAWD EQ KILPFQ
Sbjct: 409 NGENMTERYPELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQ 468

Query: 465 VLSTXXXXXXXXXXXXXXXCLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYA 524
           VL+T               CLFAFDLL  N E +INKSLRERQ+ L+KVT  V GEF+YA
Sbjct: 469 VLTTRKRKNVDLKDVKVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQYA 528

Query: 525 NKLITANIEELQHFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGD 584
             LIT++++ELQ FLDQ+VK+SCEGLMVKMLDG ESHYEPSKRSRNWLKLKKDYL+GVGD
Sbjct: 529 TSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVGD 588

Query: 585 SLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEYETCCKIGTGFSEELLQQLYDRLKPT 644
           SLDL V+               FLLGCYN+DT E+ETCCKIGTGFS+E+L  L+  L+PT
Sbjct: 589 SLDLVVMGAYFGKGKRTGSYGGFLLGCYNEDTQEFETCCKIGTGFSDEMLGNLHTLLQPT 648

Query: 645 AMEAPAAFYVYDSAQQPDVWFEPTLLFEVLAADLSLSPVYKAGSAQYDKGISLRFPRFLR 704
            ++ P   Y+YDS+ +PDVWF+  +LFEVL ADLSLSPVYKAG+++YDKGISLRFPRFLR
Sbjct: 649 EIDNPPMTYIYDSSAEPDVWFQAKVLFEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLR 708

Query: 705 IRDDKSVEEATSSEQVVDLYEAQAHL 730
           IR+DK V + T+SE +++ YE+Q+H+
Sbjct: 709 IREDKDVTDGTTSEDIIEFYESQSHI 734

>ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL164C (CDC9)
          Length = 697

 Score =  798 bits (2062), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/713 (57%), Positives = 501/713 (70%), Gaps = 22/713 (3%)

Query: 23  SQPKKQAKQATLAKFFSSVKDRNSPTKKNATPAFPTTTNVKRESPVRSNSNEKESSPMFD 82
           S PKKQA   TL +FF+++K         AT        VK+    +  + E  ++P   
Sbjct: 2   SAPKKQA---TLGRFFTALKRPQDGATAAAT--------VKKS---KVEAAECLAAPAGH 47

Query: 83  DSNGRSSACSSAGLEMESAPAPKKLKMESDS---NSTSKNNQDDHFSTVPYADVCNIFQE 139
           + +       ++  E+   PAP  +  ++ S    + S   +    ++V YAD+C +F+ 
Sbjct: 48  EQDAE---VKNSLPELADKPAPGGVLPQAASAVPRAQSSPVKPAASTSVMYADLCAVFEA 104

Query: 140 IESTSSRLSIIKICSDFFTQIVKEDSRNLVPTTYLFINKLGPDYEPXXXXXXXXXXXXKT 199
           +E+TSSRLSI K+C+DF   ++K D  +L+P TYLFIN+LGPDYEP            KT
Sbjct: 105 VEATSSRLSITKLCADFMYSVLKCDPGHLIPVTYLFINRLGPDYEPGLELGLGEGILIKT 164

Query: 200 ISESCGKSLAQVKNRYREMGDLGQIAMEARNVQPTMFKPKPLTVGEVFVNLRNIANAQGK 259
           IS++CGKS AQV++ YRE GDLG +A +AR VQPTMFKPKPLTV +VF  L+ IA A+GK
Sbjct: 165 ISDACGKSAAQVRSSYRECGDLGTVAQQARVVQPTMFKPKPLTVRDVFSTLQAIAQAEGK 224

Query: 260 DSQNKKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSNALLRHEQGLDVE 319
           DSQ KKI+LIK+MLTACQG+EAK+LIRSLESKLRIGLAEKTVL++LS A+L HE     E
Sbjct: 225 DSQGKKIRLIKKMLTACQGMEAKYLIRSLESKLRIGLAEKTVLVALSKAILTHEHD-GKE 283

Query: 320 PSDEAVDKAEQSIRDAFCQVPNYEIVINTCLEHGISQLHKHCQLTPGIPLKPMLAKPTKA 379
           PS E VD AE  +RD FCQVPNYE++IN  L++GI  L +HC LTPGIPLKPMLAKPTK+
Sbjct: 284 PSPEQVDAAEALVRDTFCQVPNYEMIINAALQYGIMNLPQHCVLTPGIPLKPMLAKPTKS 343

Query: 380 ITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGTMRIYSRNGENMTERYPEIDIRDFLSDP 439
           ITEVLDRFQGQ F  EYKYDGERAQ+HL+ DGT+RIYSRN ENMTERYPEI    FL++P
Sbjct: 344 ITEVLDRFQGQRFTCEYKYDGERAQVHLMEDGTIRIYSRNSENMTERYPEIQFHQFLANP 403

Query: 440 -STESLILDCEAVAWDKEQGKILPFQVLSTXXXXXXXXXXXXXXXCLFAFDLLCHNGEPL 498
            +T SLI+DCEAVAWD E+ KILPFQVLST               CLFAFDLL  NGE L
Sbjct: 404 QTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDVKVRVCLFAFDLLYLNGESL 463

Query: 499 INKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQSVKDSCEGLMVKMLDGP 558
           +  SL +R+  L  V K V GE ++AN++ T  + ELQ +L+QSV  SCEGLMVKMLDG 
Sbjct: 464 LKCSLADRRKHLYSVLKVVPGELQFANEITTMELSELQTYLEQSVSASCEGLMVKMLDGE 523

Query: 559 ESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGE 618
           ES YEPSKRSRNWLKLKKDYL GVGDSLDL VL               FLLGCYN D  E
Sbjct: 524 ESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLGAYYGRGKRTGTYGGFLLGCYNPDLEE 583

Query: 619 YETCCKIGTGFSEELLQQLYDRLKPTAMEAPAAFYVYDSAQQPDVWFEPTLLFEVLAADL 678
           +ETCCKIGTGFSEE+LQ L+ +LK T + AP     YD +  PDVWFEP +LFEVL ADL
Sbjct: 584 FETCCKIGTGFSEEVLQSLHAQLKDTVIAAPRGDVSYDDSSPPDVWFEPAMLFEVLTADL 643

Query: 679 SLSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVDLYEAQAHLS 731
           SLSPVYKAG   Y KGISLRFPRFLRIR+DKSV +ATSS+Q+V+ Y+ QA+ S
Sbjct: 644 SLSPVYKAGRDVYGKGISLRFPRFLRIREDKSVTDATSSDQIVEFYQRQANSS 696

>TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.343
           YDL164C
          Length = 720

 Score =  791 bits (2044), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/608 (63%), Positives = 469/608 (77%), Gaps = 5/608 (0%)

Query: 126 STVPYADVCNIFQEIESTSSRLSIIKICSDFFTQIVKEDSRNLVPTTYLFINKLGPDYEP 185
           S++PYAD+C +F+ IES SSRL+I  +C+ FF++ ++ D   LVP TYL INKLGPDY  
Sbjct: 113 SSLPYADLCQLFETIESESSRLTITNLCTAFFSRTLQLDPSLLVPVTYLCINKLGPDYS- 171

Query: 186 XXXXXXXXXXXXKTISESCGKSLAQVKNRYREMGDLGQIAMEARNVQPT--MFKPKPLTV 243
                       K I  +CG S  Q+K +YR++GDLGQ+AM  R +QPT  MFK +PLT+
Sbjct: 172 GVELGLGEGLLLKAIGSACGVSQQQLKLQYRKLGDLGQLAMSTRVLQPTITMFKLEPLTI 231

Query: 244 GEVFVNLRNIANAQGKDSQNKKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI 303
            +VF  L  IA +QGKDSQN+KI +IKR+LT+CQGVEAKFLIRSLESKLRIGLAEKTVL 
Sbjct: 232 TKVFDTLAKIAASQGKDSQNQKINMIKRLLTSCQGVEAKFLIRSLESKLRIGLAEKTVLT 291

Query: 304 SLSNALLRHEQGLDVEPSDEAVDKAEQSIRDAFCQVPNYEIVINTCLEHGISQLHKHCQL 363
           SL+ AL+ HE+G D    D+    AEQ I+D+FCQ+PNYEI+I T L++G+SQL  H +L
Sbjct: 292 SLARALVIHEKGND-NIQDDDYSNAEQIIKDSFCQIPNYEIIITTSLQYGVSQLASHIKL 350

Query: 364 TPGIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGTMRIYSRNGENM 423
           TPGIPLKPMLAKPTK+I+EVLD FQ   F SEYKYDGERAQ+HLLPDG+MRIYSRNGE+M
Sbjct: 351 TPGIPLKPMLAKPTKSISEVLDTFQNIQFTSEYKYDGERAQVHLLPDGSMRIYSRNGEDM 410

Query: 424 TERYPEIDIRDFLSDPSTES-LILDCEAVAWDKEQGKILPFQVLSTXXXXXXXXXXXXXX 482
           T+RYPE++I+D+L D +T + LILDCEAVAWD E  KILPFQVLST              
Sbjct: 411 TQRYPELNIQDYLVDSTTTTQLILDCEAVAWDVELQKILPFQVLSTRKRKSVDLKDIKVR 470

Query: 483 XCLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQS 542
            CLFAFD+L HN + LIN +LRER+D L  +TKP  G+F++A +L T+N++ELQ FLD++
Sbjct: 471 VCLFAFDILRHNNDSLINNTLRERRDILHSITKPCPGQFQFATELTTSNLDELQTFLDKA 530

Query: 543 VKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLXXXXXXXXXXX 602
           +KDSCEGLMVK LDG +SHYEPSKRSRNWLKLKKDYL G+GDSLDLCVL           
Sbjct: 531 IKDSCEGLMVKSLDGTDSHYEPSKRSRNWLKLKKDYLQGMGDSLDLCVLGAYYGRGKRTG 590

Query: 603 XXXXFLLGCYNQDTGEYETCCKIGTGFSEELLQQLYDRLKPTAMEAPAAFYVYDSAQQPD 662
               FLL CYNQDT E+ETCCKIGTGFS+E+LQ LY+ LK TA+E+P A +V+DS+ +PD
Sbjct: 591 TYGGFLLACYNQDTEEFETCCKIGTGFSDEMLQTLYNGLKETAIESPRANFVFDSSAEPD 650

Query: 663 VWFEPTLLFEVLAADLSLSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVD 722
           VWF PT++FEVL ADLSLSP+YKAGS  Y KGISLRFPRF+RIR DKSV +ATSSEQV+D
Sbjct: 651 VWFNPTMVFEVLTADLSLSPIYKAGSTVYGKGISLRFPRFIRIRTDKSVNDATSSEQVID 710

Query: 723 LYEAQAHL 730
            YE Q+HL
Sbjct: 711 FYENQSHL 718

>KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005C DNL4 DNA ligase required for nonhomologous end-
           joining (NHEJ) forms stable heterodimer with required
           cofactor Lif1p catalyzes DNA ligation as part of a
           complex with Lif1p and Nej1p involved in meiosis not
           essential for vegetative growth
          Length = 907

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 96/393 (24%), Positives = 165/393 (41%), Gaps = 44/393 (11%)

Query: 363 LTPGIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDG-TMRIYSRNGE 421
           +T     +P LAK T    E +       F+ E K DGER Q+H +  G  ++  SR G 
Sbjct: 241 ITISHAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGV 300

Query: 422 NMTERYPEIDIRDFLSDPSTESL---------ILDCEAVAWDKEQGKILPFQVLSTXXXX 472
           + +  Y E    +  S P + SL         ILD E + +D E+  +LPF ++ +    
Sbjct: 301 DFSYLYGE----NSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMN 356

Query: 473 XXXXX------XXXXXXCLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANK 526
                               AFDL+  NG+ L N +L  R+D L K+  PV+        
Sbjct: 357 QIQSELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQY 416

Query: 527 LITANIEELQHFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSL 586
           +   N E ++  L+Q++    EG+++K L    S Y    R+ +W+K+K +YL   G+++
Sbjct: 417 MKAINAEAIKDSLEQAISMGSEGIVLKHL---HSKYFVGSRNTDWIKIKPEYLEQFGENM 473

Query: 587 DLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGE------YETCCKIGTGFSEELLQQL--- 637
           DL ++               F  G    D  E      + + C I  G S E  + +   
Sbjct: 474 DLLII------GREQGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIERK 527

Query: 638 -YDRLKPTAMEAPAAFYVYDSAQQPDVWFEP--TLLFEVLAADLSLSPVYKAGSAQYDKG 694
            + +    + + P+   +    + P  W  P  +++ EV A  +      ++   +Y  G
Sbjct: 528 TWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTK---ESEKRKYRSG 584

Query: 695 ISLRFPRFLRIRDDKSVEEATSSEQVVDLYEAQ 727
            +L F    +IR DK  +   S  +  D+ +A+
Sbjct: 585 CTLHFGYCKQIRYDKDWKTVASFSEFEDMKDAR 617

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score = 96.7 bits (239), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 69/232 (29%), Positives = 107/232 (46%), Gaps = 12/232 (5%)

Query: 369 LKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDG-TMRIYSRNGENMTERY 427
            +P LAK      EVL R     F  E K DGER Q+H +  G  ++ +SR G + T  Y
Sbjct: 264 FEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIHYMDYGHQIKYFSRRGNDYTYLY 323

Query: 428 PE----IDIRDFLS-DPSTESLILDCEAVAWDKEQGKILPFQVLSTXXXXXXXXXXXXXX 482
            +      I  +L  +   +  ILD E V++DK +  ILPF ++ +              
Sbjct: 324 GKDKSTATISKYLQLNEDVKECILDGEMVSYDKSRNCILPFGMVKSGAANSLKIDGLEND 383

Query: 483 XC---LFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFL 539
            C      FD+L  NG PL N  L +R++ L  +  P           I  + E ++  L
Sbjct: 384 LCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILTPKKSHIEILKFSIAHDSESIRSAL 443

Query: 540 DQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVL 591
             ++    EG+++K  D   S Y    R+ +W+K+K +YL   G++LDL V+
Sbjct: 444 QAAISVGSEGIVLKKYD---SLYSVGDRNNDWIKVKPEYLEQFGENLDLIVI 492

>ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR005C (DNL4)
          Length = 981

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 102/416 (24%), Positives = 167/416 (40%), Gaps = 67/416 (16%)

Query: 366 GIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDG-TMRIYSRNGENMT 424
           G    P +A+  K   E +    G  F  E K DG+R Q+H +  G ++  +SRNG N T
Sbjct: 291 GYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGINYT 350

Query: 425 ERYPEIDIRDFLSD-----PSTESLILDCEAVAWDKEQGKILPFQVLSTXXXXXXXXXXX 479
             Y E   +  +S+        +  ILD E V++DKE   ILPF +  +           
Sbjct: 351 YLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNFETT 410

Query: 480 XXXXCLF-----AFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEE 534
                 +      FDLL  NG+ L N+ + +R++ L+K+  P        +    ++ E 
Sbjct: 411 GHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSDAEA 470

Query: 535 LQHFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLXXX 594
           +   L  +V    EG+++K      S Y   KR  +W+K+K +YL   G+++DL V+   
Sbjct: 471 ITAALGAAVAHGSEGIVLKK---ARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVI--- 524

Query: 595 XXXXXXXXXXXXFLLGCYNQDTGE----------------------------YETCCKIG 626
                       F+      D  E                            + + C I 
Sbjct: 525 ---GRDKGRKDSFICALAVTDDSEKNNPSSYESGSDSDSDSEPIIVQPKIEKFISFCSIA 581

Query: 627 TGFSEELLQQLYDRLK-----PTAMEAPAAFYVYDSAQQPDVWFEP--TLLFEVLAADL- 678
            G S E  +++ DRL      P     P   +V    + P  W +P  +++ EV A  + 
Sbjct: 582 NGISNEEFKEI-DRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKARSID 640

Query: 679 ---SLSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVDLYEAQAHLS 731
              S S +YK GS  Y+           RIR DK+   A++  +     EA+++ +
Sbjct: 641 NEESKSDLYKTGSTLYNAYCK-------RIRHDKNWSTASTVAEYDTAREARSYFN 689

>ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 944

 Score = 94.4 bits (233), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 97/389 (24%), Positives = 160/389 (41%), Gaps = 47/389 (12%)

Query: 366 GIPLKPMLAKPTK-AITEVLDRFQGQLFVSEYKYDGERAQLHLLPDG-TMRIYSRNGENM 423
           G+P  P LAK    +  +V  R +   ++ E K DGER QLH +  G  ++ +SR G + 
Sbjct: 253 GLPFAPFLAKRLYISYDKVALRLKSDFYIEE-KMDGERIQLHYMDYGRKLKWFSRRGNDY 311

Query: 424 TERYPEIDI------RDFLSDPSTESLILDCEAVAWDKEQGKILPFQVLSTXXXXXXXXX 477
           T  Y E DI      +    DP     +LD E +++D E+  +LPF ++ +         
Sbjct: 312 TYLYGE-DIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSLTAE 370

Query: 478 XXXXXX---CLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEE 534
                         D L  NG  LIN  L  R+  L  +  P          +   +   
Sbjct: 371 GILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTS 430

Query: 535 LQHFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLXXX 594
           ++  L++++    EG+++K     +S YE   R+ NW+K+K +YL   G++LDL V+   
Sbjct: 431 IKSSLEKAIMMGSEGIILKHF---KSKYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRD 487

Query: 595 XXXXXXXXXXXXFLLG-----------CYNQDTGEYE----------TCCKIGTGFSEEL 633
                        L G             N D+ E E          + C I  G S+E 
Sbjct: 488 PGKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEEEPRKAVKKFISFCTIANGISQEE 547

Query: 634 LQQL----YDRLKPTAMEAPAAFYVYDSAQQPDVWFEP--TLLFEVLAADLSLSPVYKAG 687
            +Q+      + K T    P     + S + P+ W  P  +++ EV A  L  +   ++ 
Sbjct: 548 FKQIERKTAGKWKNTEDHKPPKILEFGS-KLPEEWIYPEDSVVLEVKARSLDNT---ESS 603

Query: 688 SAQYDKGISLRFPRFLRIRDDKSVEEATS 716
             ++  G +L      RIR+DK+  E  +
Sbjct: 604 GRKFKVGCTLHGGYCRRIREDKNWTECYT 632

>KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.18
           YOR005C
          Length = 954

 Score = 87.4 bits (215), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 72/267 (26%), Positives = 119/267 (44%), Gaps = 12/267 (4%)

Query: 334 DAFCQVPNYEIVINTCLEHGISQLHKHCQLTPGIPLKPMLAKPTKAITEVLDRFQGQLFV 393
           D F  V +   V     E  +   ++   L  G    P LAK      E + +  G  F 
Sbjct: 220 DYFSVVSDLSSVTKKLYEPSVRLRNEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFS 279

Query: 394 SEYKYDGERAQLHLLPDGT-MRIYSRNGENMTERY----PEIDIRDFLS-DPSTESLILD 447
            E K DGER Q+H +  G  ++  SR G + T  Y        I  +L  + + +  ILD
Sbjct: 280 IEEKMDGERIQIHYMDYGNEIKFLSRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILD 339

Query: 448 CEAVAWDKEQGKILPFQVLSTXXXXXXXXXXXXXXX---CLFAFDLLCHNGEPLINKSLR 504
            E V +D+E+  ILPF ++ +                     AFDL+  NG  L++  L 
Sbjct: 340 GEMVTYDQEKQMILPFGLVKSSAKNFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLY 399

Query: 505 ERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQSVKDSCEGLMVKMLDGPESHYEP 564
           +R+D L K+    +G     +     N+E +   L  ++    EG+++K L+   S Y  
Sbjct: 400 QRKDYLSKILTKCNGFVDIVSFARCNNLESITKSLAAAISVGSEGIILKKLN---SRYMV 456

Query: 565 SKRSRNWLKLKKDYLNGVGDSLDLCVL 591
           + R+ +W+K+K  YL   G+++DL ++
Sbjct: 457 ASRNDSWIKIKPQYLKQFGENMDLIII 483

>KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6.18
           YOR005C
          Length = 948

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 97/417 (23%), Positives = 166/417 (39%), Gaps = 49/417 (11%)

Query: 334 DAFCQVPNYEIVINTCLEHGISQLHKHCQLTPGIPLKPMLAKP-TKAITEVLDRFQGQLF 392
           D    V + + V        I   H    +  G    P LAK  + +  ++  + +   F
Sbjct: 219 DYLSVVSDLKTVCTRLWNPNIRLRHDELSINIGYAFAPHLAKKLSISYDKICKKLKNDFF 278

Query: 393 VSEYKYDGERAQLHLLPDGT-MRIYSRNGENMTERYPEI----DIRDFLS-DPSTESLIL 446
           + E K DGER Q+H +  G  ++  SR G + T  Y E      I  +L  +   +  +L
Sbjct: 279 IEE-KMDGERIQIHYMDYGNDIKFLSRRGVDYTYLYGENLSTGTIACYLKLNRDVKECVL 337

Query: 447 DCEAVAWDKEQGKILPFQVLSTXXXXXXXXXXXXXXX---CLFAFDLLCHNGEPLINKSL 503
           D E V +D++Q  +LPF ++ +                   L  FDL+  NG  L+   L
Sbjct: 338 DGEMVTYDEDQDILLPFGMVKSAAMNALTKEEISGQDYHPLLMVFDLVFLNGSSLVEFPL 397

Query: 504 RERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQSVKDSCEGLMVKMLDGPESHYE 563
            +R+D L  V +P     +  N    +N   ++  L+ ++    EG+++K  +   S Y 
Sbjct: 398 YQRKDYLASVLEPYRARVQIVNFTRCSNENIIRKSLEHAISVGSEGIVLKNYN---SRYM 454

Query: 564 PSKRSRNWLKLKKDYLNGVGDSLDLCVLXXXXXXXXXXXXXXXFL------------LGC 611
              R+ +W+K+K +YL   G+++DL V+                L             G 
Sbjct: 455 IGSRNDSWIKIKPEYLEQFGENMDLIVIGRDSAKKDSFYCGLTVLDEEEEKLVEEIDKGV 514

Query: 612 YN--QDTGEYE------------TCCKIGTGFSEELLQQLYDR----LKPTAMEAPAAFY 653
            N   D  +YE            + C I  G S+   +++Y +     K T    P    
Sbjct: 515 VNLVSDESDYENPENNRHIKKVVSFCMIANGISQNEYKEIYRKTRGFWKKTEEVPPPPEL 574

Query: 654 VYDSAQQPDVWFEP--TLLFEVLAADLSLSPVYKAGSAQYDKGISLRFPRFLRIRDD 708
           +    Q P  W EP  +++ E+ A  L  +   ++   ++  G +L      RIRDD
Sbjct: 575 IEFGTQVPMEWIEPEHSVVLEIKARSLDNT---ESSCKRFKAGCTLYGGYCRRIRDD 628

>YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON}
           DNL4DNA ligase required for nonhomologous end-joining
           (NHEJ), forms stable heterodimer with required cofactor
           Lif1p, interacts with Nej1p; involved in meiosis, not
           essential for vegetative growth
          Length = 944

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 99/409 (24%), Positives = 162/409 (39%), Gaps = 62/409 (15%)

Query: 366 GIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDG-TMRIYSRNGENMT 424
           G    P LAK      E + R     F+ E K DGER Q+H +  G +++ +SR G + T
Sbjct: 251 GFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSRRGIDYT 310

Query: 425 ERYPEIDIRDFLSD-----PSTESLILDCEAVAWDKEQGKILPFQVLSTXXXXXXXXXXX 479
             Y        +S       S +  +LD E V +D ++  ILPF ++             
Sbjct: 311 YLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEALSFNSI 370

Query: 480 XXXX---CLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQ 536
                      FDLL  NG  L    L +R+  L  +  P+              +E ++
Sbjct: 371 NNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRCYGVESIK 430

Query: 537 HFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLXXXXX 596
             L+ ++    EG+++K  +   S Y  + R+ NW+K+K +YL   G++LDL V+     
Sbjct: 431 KSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDLIVI----- 482

Query: 597 XXXXXXXXXXFLLGCYNQDTGEYE------------------------------TCCKIG 626
                     F+LG    D  EY+                              + C I 
Sbjct: 483 -GRDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSIA 541

Query: 627 TGFSEELLQQLYDR-----LKPTAMEAPAAFYVYDSAQQPDVWFEP--TLLFEVLAADLS 679
            G S+E  +++ DR      K T+  AP A  +   ++ P  W +P  +++ E+ +  L 
Sbjct: 542 NGISQEEFKEI-DRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLD 600

Query: 680 LSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVDLYEAQA 728
            +   +    +Y    +L      RIR DK   E T    + DLYE++ 
Sbjct: 601 NT---ETNMQKYATNCTLYGGYCKRIRYDK---EWTDCYTLNDLYESRT 643

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 90/390 (23%), Positives = 162/390 (41%), Gaps = 48/390 (12%)

Query: 366 GIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGT-MRIYSRNGENMT 424
           G    P LAK      E +       F+ E K DGER QLH +  G+ ++  SR G + +
Sbjct: 262 GHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGIDFS 321

Query: 425 ERYPEIDIRDFLSD-----PSTESLILDCEAVAWDKEQGKILPFQVLSTXXXXXXXXXXX 479
             Y +   R  +S            +LD E V++DK++  ILPF ++ +           
Sbjct: 322 HLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELINSEV 381

Query: 480 XXXX-----CLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEE 534
                        FDL+  NG  L    L  R++ L+++  PV         +   + + 
Sbjct: 382 GNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRACDAKA 441

Query: 535 LQHFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLXXX 594
           +++F+ ++++   EG++VK      S YE   R+ +W+K+K +Y   +G+++DL V+   
Sbjct: 442 IKNFMQRAIEMGSEGVIVKQ---ASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVI--- 495

Query: 595 XXXXXXXXXXXXFLLGCYNQDT-------GEYE------------TCCKIGTGFSEELLQ 635
                        + G    D+       G  E            + C +  G S+E  +
Sbjct: 496 ---GRDPGKKDSLMCGLLVSDSEHILENFGPIEHGKEGDPIIKCVSFCNVANGVSDEEFK 552

Query: 636 QLYDRLKPTAM---EAPAAFYVYD-SAQQPDVWFEP--TLLFEVLAADLSLSPVYKAGSA 689
           ++  + + + +   E P    + +  ++ P  W +P  +++ EV A  +  S   +  S 
Sbjct: 553 EINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENS---EYSSK 609

Query: 690 QYDKGISLRFPRFLRIRDDKSVEEATSSEQ 719
           +Y  G +L      RIR+DK     TS  Q
Sbjct: 610 RYRAGSTLHSAYCRRIRNDKDWTTCTSVAQ 639

>Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {ON}
           YOR005C (REAL)
          Length = 945

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 68/240 (28%), Positives = 107/240 (44%), Gaps = 22/240 (9%)

Query: 366 GIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDG-TMRIYSRNGENMT 424
           G    P LAK      E + R     F+ E K DGER Q+H +  G ++R YSR G + T
Sbjct: 251 GFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRGIDYT 310

Query: 425 ERYP----------EIDIRDFLSDPSTESLILDCEAVAWDKEQGKILPFQVL--STXXXX 472
             Y            +D  D     +    +LD E V +D  +  ILPF ++  S     
Sbjct: 311 YLYGASLSSGTISHHLDFTD-----NVRECVLDGEMVTFDARRKVILPFGLVKGSAKDAL 365

Query: 473 XXXXXXXXXXXCLFA-FDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITAN 531
                       L+  FDLL  NG  L    L +R++ L+ +  PV             N
Sbjct: 366 SFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRCYN 425

Query: 532 IEELQHFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVL 591
           +E ++  L+ ++    EG+++K  +   S Y  + R+ NW+K+K +YL   G++LDL ++
Sbjct: 426 VESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDLVII 482

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 104/238 (43%), Gaps = 12/238 (5%)

Query: 363 LTPGIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDG-TMRIYSRNGE 421
           + PG    P LAK      E +       F+ E K DGER QLH    G  ++ +SR G 
Sbjct: 256 INPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRGT 315

Query: 422 NMTERYPEIDIRDFLS-----DPSTESLILDCEAVAWDKEQGKILPFQVLSTXXXXXXXX 476
           + T  Y E     F+      +   +  ILD E + +DK Q  ILPF ++ +        
Sbjct: 316 DYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLTK 375

Query: 477 XXXXXXX---CLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIE 533
                         FDL+  NG  L N  L  R++ L  +  P        +     N +
Sbjct: 376 DGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFNED 435

Query: 534 ELQHFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVL 591
            ++  L+ ++    EG+++K  D   S Y  + R+ +W+K+K +YL   G+++DL V+
Sbjct: 436 SIRKSLELAISMGSEGIVLKRYD---SRYTVASRNDDWIKVKPEYLEQFGENMDLIVI 490

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 66/236 (27%), Positives = 108/236 (45%), Gaps = 14/236 (5%)

Query: 366 GIPLKPMLAKPTKAITEVL-DRFQGQLFVSEYKYDGERAQLHLLPDG-TMRIYSRNGENM 423
           G    P LAK      + + +R     F+ E K DGER QLH +  G T++ +SR+G + 
Sbjct: 272 GYIFAPQLAKRLMLSYDTISNRLNNDFFIEE-KMDGERIQLHYMNYGETVKFFSRHGTDY 330

Query: 424 TERYPEID----IRDFLS-DPSTESLILDCEAVAWDKEQGKILPFQVLSTXXXXXXXXXX 478
           T  Y        I  FL    + +  +LD E V +D    K+LPF ++ +          
Sbjct: 331 TYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSASSQLNKKD 390

Query: 479 XXXXX---CLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEEL 535
                       FD+L  NG  LI+  L +R++ L  V  P        + +   +  ++
Sbjct: 391 IDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIRCTDSIQI 450

Query: 536 QHFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVL 591
           +  LD ++    EG+++K      S Y P+ R  NW+K+K +YL   G+++DL V+
Sbjct: 451 KKGLDAAISVGSEGIVLKQY---ISKYIPNARHNNWIKVKPEYLEEFGENMDLIVI 503

>NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {ON}
           Anc_6.18 YOR005C
          Length = 967

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 70/270 (25%), Positives = 123/270 (45%), Gaps = 16/270 (5%)

Query: 333 RDAFCQVPNYEIVINTCLEHGISQLHKHCQLTPGIPLKPMLAKPTKAITE-VLDRFQGQL 391
           +D    V + + V N   +  +   +    +  G P  P  AK      E +  + +   
Sbjct: 234 QDYLSVVSDLKTVANKLWDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDF 293

Query: 392 FVSEYKYDGERAQLHLLPDGT-MRIYSRNGENMTERYPEIDIRD-----FLS-DPSTESL 444
           F+ E K DGER QLH    G  +   SR G + T  Y E  I+D     +L  D + ++ 
Sbjct: 294 FIEE-KMDGERIQLHYQDYGNKLSFLSRRGTDYTYLYGE-SIKDGTVSKYLHLDNNVQNC 351

Query: 445 ILDCEAVAWDKEQGKILPFQVLSTXXXXXXXXXXXXXXX---CLFAFDLLCHNGEPLINK 501
           +LD E V +DKE+  +LPF ++ +                   L  FDL+  NG  L+N 
Sbjct: 352 VLDGEMVTFDKERNALLPFGLVKSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNI 411

Query: 502 SLRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQSVKDSCEGLMVKMLDGPESH 561
            L +R+  L+K+  P             ++   +++ L+ ++    EG+++K  +   S 
Sbjct: 412 PLYQRKLYLEKIFTPERHIVELLRSKRCSDERSIKNALEHAISIGSEGVVLKHYN---SR 468

Query: 562 YEPSKRSRNWLKLKKDYLNGVGDSLDLCVL 591
           Y  + R+ +W+K+K +YL   G+++DL V+
Sbjct: 469 YTVASRNDDWIKVKPEYLEQFGENMDLIVI 498

>TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.18
           YOR005C
          Length = 969

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 91/411 (22%), Positives = 169/411 (41%), Gaps = 56/411 (13%)

Query: 366 GIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGT-MRIYSRNGENMT 424
           G    P LAK      E +       F+ E K DGER Q+H +  G  +R  SR G + T
Sbjct: 268 GYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVDYT 327

Query: 425 ERYPEI----DIRDFLS-DPSTESLILDCEAVAWDKEQGKILPFQVLSTXXXXXXXXX-- 477
           + Y E      + ++L+ D +    +LD E + +D ++  +LPF ++ +           
Sbjct: 328 QLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTEGI 387

Query: 478 -XXXXXXCLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQ 536
                   L   DL+  NG  LI   L +R++ L +V KP          +  +    ++
Sbjct: 388 CSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTAIR 447

Query: 537 HFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLXXXXX 596
             L++S+    EG+++K     ++ YE   R+  W+K+K +YL   G++LDL ++     
Sbjct: 448 KSLEKSISMGSEGIVLKSY---KARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGRTPG 504

Query: 597 XXXXXXXXXXFLLGCYNQDTGEYE------------------------------TCCKIG 626
                        G   +D  E E                              + C I 
Sbjct: 505 KKDSLMCGLAVYEG--EEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIA 562

Query: 627 TGFSEELLQQLYDRLKPTAMEA----PAAFYVYDSAQQPDVWFEP--TLLFEVLAADLSL 680
            G S++  +++  + +   +++    P+A  +   ++ P+ W +P  +++ EV A  L  
Sbjct: 563 NGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDN 622

Query: 681 SPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVDLYEAQAHLS 731
           +   ++   ++  G +L      RIRDDK   + T      +L++ + H S
Sbjct: 623 T---ESSKKKFAAGCTLHGGYCRRIRDDK---DWTGCYSFSELWQERLHKS 667

>CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005c DNL4 DNA ligase IV
          Length = 946

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 91/387 (23%), Positives = 168/387 (43%), Gaps = 53/387 (13%)

Query: 362 QLTPGIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGT-MRIYSRNG 420
           ++  G+   P LA       + +    G  F  E K DGER Q+H    G+ ++ YSR  
Sbjct: 262 KINIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRA 321

Query: 421 ENMTERYPEI----DIRDFLS-DPSTESLILDCEAVAWDKEQGKILPFQVLSTXXXXXXX 475
            + T  Y        + +F++ + + +  +LDCE V +D     +LPF ++ +       
Sbjct: 322 TDYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLS 381

Query: 476 XXXXXXXX---CLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANI 532
                       L  FD+L  NG  L++    +R++ L+++  P         K I AN 
Sbjct: 382 QDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEII-KSIRAND 440

Query: 533 EEL-QHFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVL 591
           E++ +  L++++    EG+++K  D   S Y  + RS +W+K+K +YL   G+++DL ++
Sbjct: 441 EQMIKKSLEKALSVGSEGIILKRYD---SRYVIASRSDDWIKIKPEYLEQFGENMDLVLM 497

Query: 592 XXXXXXXXXXXXXXXFLLGCY-------------NQDTGE--------YETCCKIGTGFS 630
                           +LG               N  + E        + + C I  G S
Sbjct: 498 ------GRDPSKKDSLMLGLLDYEEVIQDSPIMVNSQSSEENSQRFRGFVSLCIIANGIS 551

Query: 631 EELLQQLYDR----LKPTAMEAPAAFYVYDSAQQPDVWFEP--TLLFEVLAADLSLSPVY 684
            E  +++ DR    L   + + P   Y+   ++ P  W +P  +L+ E+ A  L  +   
Sbjct: 552 NEEYKEI-DRKTKGLWNDSEKIPPLEYMKFGSKVPRQWIDPKKSLILEIKARSLDNT--- 607

Query: 685 KAGSAQYDKGISLRFPRFLR-IRDDKS 710
           ++   ++  G +L F  + R IR+DK+
Sbjct: 608 RSSERKFAAGCTL-FGGYCRQIREDKN 633

>Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {ON}
           YOR005C (DNL4) - ATP dependent DNA ligase [contig 185]
           FULL
          Length = 963

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 66/260 (25%), Positives = 114/260 (43%), Gaps = 18/260 (6%)

Query: 343 EIVINTCLEHGISQLHKHCQLTPGIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGER 402
           E + N  +  G ++L     +  G    P LAK      E +     Q F+ E K DGER
Sbjct: 257 ETLWNPTMRLGKNEL----SINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGER 312

Query: 403 AQLHLLPDGT-MRIYSRNGENMTERYPEIDIRDFLSDP-----STESLILDCEAVAWDKE 456
            QLH +  G  +R  SR G + T  Y +      +S         +  +LD E V++DKE
Sbjct: 313 IQLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKE 372

Query: 457 QGKILPFQVLSTXXXXXXXXXXXXXXX-----CLFAFDLLCHNGEPLINKSLRERQDDLQ 511
           +  +LPF ++ +                        FDL+  NG  L    L  R+  L+
Sbjct: 373 KNVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLR 432

Query: 512 KVTKPVDGEFRYANKLITANIEELQHFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNW 571
            +  PV       + +  +    ++  L+++++   EG+++K    P   YE   R+ +W
Sbjct: 433 SILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQFSSP---YEIGARNDSW 489

Query: 572 LKLKKDYLNGVGDSLDLCVL 591
           +K+K +Y   +G+++DL V+
Sbjct: 490 IKIKPEYFEELGETMDLVVI 509

>Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {ON}
           YOR005C (REAL)
          Length = 948

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 100/441 (22%), Positives = 171/441 (38%), Gaps = 65/441 (14%)

Query: 333 RDAFCQVPNYEIVINTCLEHGISQLHKHCQLTPGIPLKPMLAKPTKAITE-VLDRFQGQL 391
           +D    V +  +V +   +  I   +    +  G    P LAK      E +    +   
Sbjct: 218 QDYLSVVSDLRVVTSKLYDPDIRLKNDDLSIKVGFAFAPQLAKKVNLSYEKICHALRNDF 277

Query: 392 FVSEYKYDGERAQLHLLPDG-TMRIYSRNGENMTERYP----EIDIRDFLS-DPSTESLI 445
           FV E K DGER Q+H +  G +++ +SR G + T  Y        I  +L    S +  +
Sbjct: 278 FVEE-KMDGERIQVHYMNYGKSIKFFSRRGIDYTYLYGVNLLSGTISQYLKFSDSVKECV 336

Query: 446 LDCEAVAWDKEQGKILPFQVLSTXXXXXXXXXXXXXXX---CLFAFDLLCHNGEPLINKS 502
           LD E V +D  +  ILPF ++                        FDLL  NG  L    
Sbjct: 337 LDGEMVTFDAMRKVILPFGLVKGSAKEALSFNDINNNDFHPLYMVFDLLYLNGTSLTPLP 396

Query: 503 LRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQSVKDSCEGLMVKMLDGPESHY 562
           L +R++ L  +  P              + E ++  L+ ++    EG+++K      S Y
Sbjct: 397 LYQRKEYLSSILIPSKSVVEIVRYSRCYDAESVKKSLEVAISLGSEGVVLKHY---SSSY 453

Query: 563 EPSKRSRNWLKLKKDYLNGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCY---NQDTGEY 619
             + R+ NW+K+K +YL   G++LDL ++               F+LG      Q+TG+ 
Sbjct: 454 NVASRNNNWIKVKPEYLEEFGENLDLIII------GRDSGKKDSFMLGLLVVDEQETGKT 507

Query: 620 E----------------------------TCCKIGTGFSEELLQQLYDR-----LKPTAM 646
           +                            + C I  G S+E  +++ DR      K T+ 
Sbjct: 508 DQEGPSEILNDSSTERRATNPKKRVRKVLSFCSIANGISQEEFKEI-DRKTRGHWKKTSG 566

Query: 647 EAPAAFYVYDSAQQPDVWFEP--TLLFEVLAADLSLSPVYKAGSAQYDKGISLRFPRFLR 704
            +P    +   ++ P  W EP  +++ E+ +  L  +   +    +Y    +L      R
Sbjct: 567 LSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSLDNT---ETNMQKYATNCTLYGGYCRR 623

Query: 705 IRDDKSVEEATSSEQVVDLYE 725
           IR DK   E  + ++   LYE
Sbjct: 624 IRYDKDWTECYTLDE---LYE 641

>Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {ON}
           YOR005C (REAL)
          Length = 947

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 61/235 (25%), Positives = 103/235 (43%), Gaps = 12/235 (5%)

Query: 366 GIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDG-TMRIYSRNGENMT 424
           G    P LAK      E + R     F+ E K DGER Q+H +  G +++ +SR G + T
Sbjct: 251 GFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRGIDYT 310

Query: 425 ERY----PEIDIRDFLSDPST-ESLILDCEAVAWDKEQGKILPFQVLSTXXXXXXXXXXX 479
             Y        I  +L   +T +  +LD E V +D  +  ILPF ++             
Sbjct: 311 YLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLSCSDI 370

Query: 480 XXXX---CLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQ 536
                      FDLL  N   L    L +R+  L  +  P              +++ ++
Sbjct: 371 NNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDVQSVK 430

Query: 537 HFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVL 591
           + L+ ++    EG+++K  +   S Y  + R+ NW+K+K +YL   G++LDL ++
Sbjct: 431 NSLEVAISLGSEGVVLKYYN---SSYNIASRNYNWIKVKPEYLEEFGENLDLIII 482

>Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON}
           complement(12295..15192) [2898 nt, 966 aa]
          Length = 965

 Score = 72.0 bits (175), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 104/224 (46%), Gaps = 13/224 (5%)

Query: 377 TKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGT-MRIYSRNGENMTERYPEID---- 431
           T +   +  R +   F+ E K DGER QLH +  G  ++  SR G + +  Y +      
Sbjct: 285 TYSYDTIARRLKNDFFIEE-KMDGERIQLHYMNYGAKLKFLSRRGLDYSYLYGDNRNNGA 343

Query: 432 IRDFLS-DPSTESLILDCEAVAWDKEQGKILPFQVLSTXXXXXXXXXXXX---XXXCLFA 487
           I  +L+     +  ILD E V +D  +  ILPF ++ +                     A
Sbjct: 344 IGRYLNFHKDVKECILDGEMVTYDSVKNCILPFGLVKSSAMQSLSVSDIEPDGYHPLYMA 403

Query: 488 FDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQSVKDSC 547
           FDL+  NG  L    L +R++ L K+  P          L   +   ++  L+++++   
Sbjct: 404 FDLVYLNGSSLSTLPLHQRKNYLDKLLIPCPDFVEILPALHCNDSSLIKSSLEKAIELGS 463

Query: 548 EGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVL 591
           EG+++K  D   S Y  +KRS +W+K+K +YL   G+++DL V+
Sbjct: 464 EGIILKRFD---SQYLVAKRSDDWIKIKPEYLEQFGENMDLIVI 504

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 72,357,444
Number of extensions: 3067254
Number of successful extensions: 14279
Number of sequences better than 10.0: 235
Number of HSP's gapped: 14800
Number of HSP's successfully gapped: 335
Length of query: 731
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 614
Effective length of database: 40,065,477
Effective search space: 24600202878
Effective search space used: 24600202878
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)