Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F11550g7.342ON5382459931e-128
TDEL0C020507.342ON5012467553e-93
NCAS0H006707.342ON4832576811e-82
Skud_4.947.342ON4472456746e-82
Skud_12.2707.342ON6262706791e-80
YDL161W (ENT1)7.342ON4542456661e-80
Smik_4.757.342ON4602466625e-80
Smik_12.2647.342ON6122656674e-79
Suva_4.837.342ON4622456522e-78
Suva_10.3007.342ON6182646596e-78
YLR206W (ENT2)7.342ON6132676562e-77
CAGL0A03872g7.342ON5102566343e-75
Kpol_2001.707.342ON5332446171e-72
TPHA0D045607.342ON4872466113e-72
KNAG0C038007.342ON4472425953e-70
KAFR0L014607.342ON5502565953e-69
SAKL0F10934g7.342ON4982485913e-69
KLLA0C16731g7.342ON4782485885e-69
NDAI0D006107.342ON4862635879e-69
Kwal_56.246107.342ON5082595829e-68
TBLA0E004807.342ON5992695624e-64
KLTH0H01430g7.342ON5022565557e-64
KAFR0B008907.342ON4141405173e-59
Ecym_47317.342ON5142565173e-58
KNAG0B026507.342ON6462874664e-50
TBLA0E020407.342ON7012524651e-49
ACL157C7.342ON5152534332e-46
Suva_12.2164.346ON4101412362e-20
Kpol_1001.24.346ON4181412344e-20
Kwal_47.168574.346ON3821412325e-20
Skud_10.3494.346ON4101412325e-20
Smik_10.4184.346ON4091412318e-20
KLTH0D16896g4.346ON4011412301e-19
TDEL0D007104.346ON3751412291e-19
NDAI0D032004.346ON4351412311e-19
YJR125C (ENT3)4.346ON4081412301e-19
SAKL0G17952g4.346ON4151412292e-19
KLLA0B04587g4.346ON4001412263e-19
KAFR0B067404.346ON3991412245e-19
AER155C4.346ON3641412201e-18
NCAS0A062104.346ON4231412212e-18
ZYRO0B14784g4.346ON4241412202e-18
KNAG0M003804.346ON4031412174e-18
TBLA0E047604.346ON4261412184e-18
TPHA0B004004.346ON3991412132e-17
Ecym_11334.346ON3921412042e-16
CAGL0H04323g4.346ON4121412015e-16
SAKL0H25762g4.17ON2621491734e-13
Kwal_55.206114.17ON2541471663e-12
Kpol_388.54.17ON2681421513e-10
KLTH0E05874g4.17ON2551371495e-10
TDEL0G017404.17ON2571351496e-10
TBLA0B062204.346ON3391471373e-08
TPHA0F002304.17ON2801441283e-07
KLLA0D03949g4.17ON2251371254e-07
ZYRO0G07876g4.17ON2591371264e-07
Ecym_84074.17ON2541531256e-07
Suva_10.354.17ON2471301247e-07
CAGL0E03806g4.17ON2601091176e-06
TBLA0G006504.17ON4231341198e-06
Skud_12.304.17ON2471301141e-05
ACL061C4.17ON234921104e-05
NDAI0H002804.17ON3101371071e-04
SAKL0H02530g5.84ON669891072e-04
NCAS0C058404.17ON2671301033e-04
YLL038C (ENT4)4.17ON247931008e-04
Smik_12.194.17ON24793980.001
YHR161C (YAP1801)5.84ON63772990.002
Skud_8.2255.84ON62188930.010
KAFR0I014604.17ON275157910.013
TBLA0H012108.335ON49198920.013
TBLA0B057705.84ON68079910.020
NCAS0B036608.335ON416113900.021
Smik_8.2455.84ON62772910.021
Kpol_344.88.335ON384170880.035
KAFR0B058008.335ON38297870.053
NDAI0J009308.335ON418113830.17
CAGL0E01199g8.335ON41297820.17
KNAG0A051008.335ON42198820.22
AGR046C8.335ON38799810.25
ZYRO0F13684g8.335ON40798800.31
KLLA0D16654g8.335ON399168790.44
TBLA0A040408.335ON415112790.46
NDAI0A028305.84ON47377790.50
KNAG0E006105.84ON60472770.97
NCAS0E038205.84ON42877751.3
Kwal_YGOB_27.112618.335ON404168732.1
TPHA0C007408.335ON38597732.5
Skud_4.4128.335ON406172704.8
TDEL0F045908.335ON36197705.5
CAGL0F08063g5.84ON53417706.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F11550g
         (538 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {...   387   e-128
TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.3...   295   3e-93
NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342    266   1e-82
Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W (...   264   6e-82
Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206...   266   1e-80
YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}  ENT1Epsin-...   261   1e-80
Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W (...   259   5e-80
Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206...   261   4e-79
Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W (...   255   2e-78
Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206...   258   6e-78
YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}  ENT2Epsin...   257   2e-77
CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {...   248   3e-75
Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa] ...   242   1e-72
TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {O...   239   3e-72
KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.3...   233   3e-70
KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {...   233   3e-69
SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some s...   232   3e-69
KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]...   231   5e-69
NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.3...   230   9e-69
Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]...   228   9e-68
TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}...   221   4e-64
KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some s...   218   7e-64
KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.3...   203   3e-59
Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar...   203   3e-58
KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.3...   184   4e-50
TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {O...   183   1e-49
ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON} Syn...   171   2e-46
Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {...    96   2e-20
Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..931...    95   4e-20
Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125...    94   5e-20
Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {...    94   5e-20
Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {...    94   8e-20
KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]...    93   1e-19
TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.3...    93   1e-19
NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {O...    94   1e-19
YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON} ...    93   1e-19
SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]...    93   2e-19
KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} simila...    92   3e-19
KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON} Anc_4...    91   5e-19
AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON} S...    89   1e-18
NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa] ...    90   2e-18
ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]...    89   2e-18
KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.34...    88   4e-18
TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa] ...    89   4e-18
TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346...    87   2e-17
Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar t...    83   2e-16
CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} simila...    82   5e-16
SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some ...    71   4e-13
Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {O...    69   3e-12
Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON} c...    63   3e-10
KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {O...    62   5e-10
TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17...    62   6e-10
TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON} Anc_4...    57   3e-08
TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON} ...    54   3e-07
KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar...    53   4e-07
ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {O...    53   4e-07
Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to...    53   6e-07
Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON} ...    52   7e-07
CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar...    50   6e-06
TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.1...    50   8e-06
Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON} ...    49   1e-05
ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON} Sy...    47   4e-05
NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON} ...    46   1e-04
SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly...    46   2e-04
NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4....    44   3e-04
YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}  EN...    43   8e-04
Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON} ...    42   0.001
YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}  ...    43   0.002
Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON...    40   0.010
KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17...    40   0.013
TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.3...    40   0.013
TBLA0B05770 Chr2 complement(1364772..1366814) [2043 bp, 680 aa] ...    40   0.020
NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {O...    39   0.021
Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON...    40   0.021
Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON} ...    39   0.035
KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa] ...    38   0.053
NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8....    37   0.17 
CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} simila...    36   0.17 
KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.3...    36   0.22 
AGR046C Chr7 complement(800910..802073) [1164 bp, 387 aa] {ON} S...    36   0.25 
ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]...    35   0.31 
KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]...    35   0.44 
TBLA0A04040 Chr1 complement(1004703..1005950) [1248 bp, 415 aa] ...    35   0.46 
NDAI0A02830 Chr1 (636619..638040) [1422 bp, 473 aa] {ON} Anc_5.8...    35   0.50 
KNAG0E00610 Chr5 complement(102826..104640) [1815 bp, 604 aa] {O...    34   0.97 
NCAS0E03820 Chr5 (750631..751917) [1287 bp, 428 aa] {ON} Anc_5.8...    33   1.3  
Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)...    33   2.1  
TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.3...    33   2.5  
Skud_4.412 Chr4 complement(736255..737475) [1221 bp, 406 aa] {ON...    32   4.8  
TDEL0F04590 Chr6 complement(864567..865652) [1086 bp, 361 aa] {O...    32   5.5  
CAGL0F08063g Chr6 complement(796793..798397) [1605 bp, 534 aa] {...    32   6.1  

>ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {ON}
           some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 538

 Score =  387 bits (993), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 193/245 (78%), Positives = 193/245 (78%)

Query: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60
           MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID
Sbjct: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXX 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRH          
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHDDDGTQDGGQ 120

Query: 121 IIRVKAKELTNLLMDDERLRMERGEDKGAXXXXXXXXXXXXXXNSYDSEMQRALDASRLT 180
           IIRVKAKELTNLLMDDERLRMERGEDKGA              NSYDSEMQRALDASRLT
Sbjct: 121 IIRVKAKELTNLLMDDERLRMERGEDKGAPPRMMSPSPPTPRRNSYDSEMQRALDASRLT 180

Query: 181 AEEDERRRKTLNNEDADLETAXXXXXXXXXXXXXXXXXXXXXXXXXXXXMQPQGYYDIFG 240
           AEEDERRRKTLNNEDADLETA                            MQPQGYYDIFG
Sbjct: 181 AEEDERRRKTLNNEDADLETALQLSKEEEELKRLQELQKAQQDQQRLSQMQPQGYYDIFG 240

Query: 241 NPISP 245
           NPISP
Sbjct: 241 NPISP 245

 Score =  353 bits (905), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 170/190 (89%), Positives = 170/190 (89%)

Query: 349 EGYFQQPVSTGSNNPFALNGMPLQSNSKPQAASDLAGLNNWGNNSTGQLEMPKYQPRPQQ 408
           EGYFQQPVSTGSNNPFALNGMPLQSNSKPQAASDLAGLNNWGNNSTGQLEMPKYQPRPQQ
Sbjct: 349 EGYFQQPVSTGSNNPFALNGMPLQSNSKPQAASDLAGLNNWGNNSTGQLEMPKYQPRPQQ 408

Query: 409 PQHNTAPEPQPMQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTF 468
           PQHNTAPEPQPMQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTF
Sbjct: 409 PQHNTAPEPQPMQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTF 468

Query: 469 INSQGTGFKQYSNEPKKNPFLPTQFTGIPTSSVVPSHTGYGFGXXXXXXXXXXXXXXXXX 528
           INSQGTGFKQYSNEPKKNPFLPTQFTGIPTSSVVPSHTGYGFG                 
Sbjct: 469 INSQGTGFKQYSNEPKKNPFLPTQFTGIPTSSVVPSHTGYGFGNQQAQNQQISQPPQQQQ 528

Query: 529 XXXGVSLIDL 538
              GVSLIDL
Sbjct: 529 ADQGVSLIDL 538

>TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.342
           YLR206W
          Length = 501

 Score =  295 bits (755), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 155/246 (63%), Positives = 170/246 (69%), Gaps = 4/246 (1%)

Query: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60
           M  QFVRSAKN +KGY+SAQVLVR+ATANE EGPSVD LDELA ++YDSVEFFEIMDMID
Sbjct: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXX 120
           KRLNDKGKYWRH+AKSLTVLDYLVRFGSENCVLWCRENLY+IKTL EFR+          
Sbjct: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNDDDGGVDQGQ 120

Query: 121 IIRVKAKELTNLLMDDERLRMERGED-KGAXXXXXXXXXXXXXXNSYDSEMQRALDASRL 179
           IIRVKAKELTNLL DDERLR ER  + KG               + +D ++QRALD SRL
Sbjct: 121 IIRVKAKELTNLLSDDERLREEREMNRKGRKNGTRRRRRTTGEQDGFDDDLQRALDESRL 180

Query: 180 TAEEDERRRKTLNNEDADLETAXXXXXXXXXXXXXXXXXXXXXXXXXXXXMQPQGYYDIF 239
           TAEEDERRRK L +ED DL+ A                             Q   YYDIF
Sbjct: 181 TAEEDERRRKMLGSEDDDLQAALQLSKEEEELKRLQEMQKLQQQQTQQQPSQ---YYDIF 237

Query: 240 GNPISP 245
           GNPISP
Sbjct: 238 GNPISP 243

 Score =  177 bits (449), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 97/189 (51%), Positives = 129/189 (68%), Gaps = 7/189 (3%)

Query: 350 GYFQQPVSTGSNNPFALNGMPLQSNSKPQAASDLAGLNNWGNNSTGQLEMPKYQPRPQQP 409
           GY+QQP++TGSNNPFALN + LQ  ++P  +S +    N+ +        P+ Q +PQ+ 
Sbjct: 320 GYYQQPMATGSNNPFALNNLQLQQ-ARPAQSSPVP---NFTSTQAQSPPKPQPQAQPQKQ 375

Query: 410 QHNTAPEPQPMQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFI 469
                   Q ++PVRTG+ ++++KY +LN+LLA  TG+DTFGN GDARIPAQHTKTGTFI
Sbjct: 376 APLPQQPQQALKPVRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFI 435

Query: 470 NSQGTGFKQYSNEPKKNPFLPTQFTGIPTSSVVPSHTGYGFGXXXXXXXXXXXXXXXXXX 529
           NSQGTG++Q + EPKKNPFL +Q+TGIP+S++VP+HTGYGFG                  
Sbjct: 436 NSQGTGYRQVTGEPKKNPFLQSQYTGIPSSNIVPAHTGYGFG---NQPSQQNQAQQHQTA 492

Query: 530 XXGVSLIDL 538
             GVSLIDL
Sbjct: 493 DQGVSLIDL 501

>NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342
          Length = 483

 Score =  266 bits (681), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 146/257 (56%), Positives = 172/257 (66%), Gaps = 16/257 (6%)

Query: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60
           M  QFVRSAKN +KGY++ QVLVRDAT+N+   PS ++L ELA RS+DSV+FFEIMDM+D
Sbjct: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXX 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWC+ENLYIIKTLREFRH          
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120

Query: 121 IIRVKAKELTNLLMDDERLRMER---------GEDKGAXXXXXXXXXXXXXXNSYDSEMQ 171
           IIRVKAKELT+LL+D+ERL+ ER         G+ KG               +    E+Q
Sbjct: 121 IIRVKAKELTSLLLDEERLKEERTINLKNRRDGDMKGRRRRRGTRNGRGNDEDQ--DELQ 178

Query: 172 RALDASRLTAEEDERRRKTL---NNEDADLETAXXXXXXXXXXXXXXXXXXXXXXXXXXX 228
           RAL+ SRLTAEEDERRR+ +   +++D DL+TA                           
Sbjct: 179 RALEESRLTAEEDERRRRQMAQYDDQDPDLQTA--LQLSKEEEELKKLQEMQRLQQQQGQ 236

Query: 229 XMQPQGYYDIFGNPISP 245
             QPQGY+DIFGNPISP
Sbjct: 237 MNQPQGYFDIFGNPISP 253

 Score =  153 bits (386), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 108/162 (66%), Gaps = 18/162 (11%)

Query: 350 GYFQQPVSTGSNNPFALNGMPLQSNSKPQAASDLAGLNNWGNNSTGQLEMPKYQPRPQQP 409
            Y+QQP+ TGSNNPFA+N      N+KP   S  A                   P+  Q 
Sbjct: 314 AYYQQPLQTGSNNPFAMNNF----NNKPAVESTQA--------------YTASAPQLNQQ 355

Query: 410 QHNTAPEPQPMQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFI 469
                P+ QP++  RTGNQSI+DKY+ LN LLA  TG+DTFGN G+ RIPAQHT+TGTFI
Sbjct: 356 PAQQQPQQQPLKQTRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFI 415

Query: 470 NSQGTGFKQYSNEPKKNPFLPTQFTGIPTSSVVPSHTGYGFG 511
           NSQGTG++Q +N+PK NPFL +Q+TG+P++++V + TGYGFG
Sbjct: 416 NSQGTGYRQVTNDPKNNPFLNSQYTGLPSTNIVSTQTGYGFG 457

>Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W
           (REAL)
          Length = 447

 Score =  264 bits (674), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 137/245 (55%), Positives = 159/245 (64%), Gaps = 5/245 (2%)

Query: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60
           M  QFVRSAKN +KGY+S QVLVR+AT+N+    S D L ELA +SYDS +FFEIMDM+D
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXX 120
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWC+ENLYIIKTL+EFRH          
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGVDQGQ 120

Query: 121 IIRVKAKELTNLLMDDERLRMERGEDKGAXXXXXXXXXXXXXXNSYDSEMQRALDASRLT 180
           I+RVKAKELT LL DDERL  ER  +                 +  D ++QRA+DASR+T
Sbjct: 121 IVRVKAKELTTLLSDDERLNEERNMNIKGRSRKGRKRRGTGRNDEDDDDLQRAIDASRMT 180

Query: 181 AEEDERRRKTLNNEDADLETAXXXXXXXXXXXXXXXXXXXXXXXXXXXXMQPQGYYDIFG 240
           AEEDERRRK    +D D ETA                             QP  YYDIFG
Sbjct: 181 AEEDERRRK----QDEDYETALQLSKEEEELKRLQDLQRMQQVHAQQQQQQPM-YYDIFG 235

Query: 241 NPISP 245
           NPI+P
Sbjct: 236 NPITP 240

 Score =  152 bits (383), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 64/93 (68%), Positives = 83/93 (89%)

Query: 419 PMQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGTGFKQ 478
           P+   RTGNQS++DKY  LN+LLA  TG+DTFGNVGD+R+PAQHTKTGTFINSQGTG++Q
Sbjct: 333 PLTQTRTGNQSMTDKYGKLNELLATGTGIDTFGNVGDSRVPAQHTKTGTFINSQGTGYRQ 392

Query: 479 YSNEPKKNPFLPTQFTGIPTSSVVPSHTGYGFG 511
            SN+PK+NPFL +Q+TG+P++++VP+ TGYGFG
Sbjct: 393 VSNDPKQNPFLNSQYTGLPSTNIVPTQTGYGFG 425

>Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206W
           (REAL)
          Length = 626

 Score =  266 bits (679), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 144/270 (53%), Positives = 166/270 (61%), Gaps = 26/270 (9%)

Query: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60
           MP QFVRSAKN +KGY+S QVLVRDATAN+   PS+D LD+LA RSYDSV+FFEIMDM+D
Sbjct: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXX 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCREN Y+IKTLREFRH          
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKELTNLLMDDERLRMERG---EDKGAXXX-------XXXXXXXXXXXNSYDSEM 170
           IIRVKAKEL +LL DDERLR ER     ++GA                      SY  E+
Sbjct: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQDEL 180

Query: 171 QRALDASRLTAEEDERRRKTL---NNEDADLETAXXXXXXXXXXXXXXXXXXXXXXXXXX 227
           ++ L+ SR+TA+EDE+RR+ L   ++ED D + A                          
Sbjct: 181 EKVLEESRITAQEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQKQQQPL 240

Query: 228 XXM-------------QPQGYYDIFGNPIS 244
             M             Q   YYDIFGNPIS
Sbjct: 241 SQMPVPVQQQQQQQQQQLPAYYDIFGNPIS 270

 Score =  152 bits (385), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 82/93 (88%)

Query: 419 PMQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGTGFKQ 478
           P++  RTGNQSISDKYNDLN LLA  TG+DTFGN G+ARIPAQHTKTGTFINSQGTG+KQ
Sbjct: 450 PLEQTRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 509

Query: 479 YSNEPKKNPFLPTQFTGIPTSSVVPSHTGYGFG 511
            ++EPK NPFL  Q+TG+P++++VP+ TGYGFG
Sbjct: 510 VTSEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 542

>YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}
           ENT1Epsin-like protein involved in endocytosis and actin
           patch assembly and functionally redundant with Ent2p;
           binds clathrin via a clathrin-binding domain motif at
           C-terminus
          Length = 454

 Score =  261 bits (666), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 137/245 (55%), Positives = 158/245 (64%), Gaps = 5/245 (2%)

Query: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60
           M  QFVRSAKN +KGY+S QVLVR+AT+N+    S D L ELA +SYDS +FFEIMDM+D
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXX 120
           KRLNDKGKYWRH+AK+LTV+DYL+RFGSENCVLWCRENLYIIKTL+EFRH          
Sbjct: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120

Query: 121 IIRVKAKELTNLLMDDERLRMERGEDKGAXXXXXXXXXXXXXXNSYDSEMQRALDASRLT 180
           I+RVKAKELT LL DDERL  ER  +                 +  D ++QRA+ ASRLT
Sbjct: 121 IVRVKAKELTALLSDDERLNEERNMNIKGRNRKGRRRRGTGRSDENDDDLQRAISASRLT 180

Query: 181 AEEDERRRKTLNNEDADLETAXXXXXXXXXXXXXXXXXXXXXXXXXXXXMQPQGYYDIFG 240
           AEEDERRRK    +D D ETA                             QP  YYDIFG
Sbjct: 181 AEEDERRRK----QDEDYETALQLSKEEEELKRLQDLQRMQQQQGQQQLQQPM-YYDIFG 235

Query: 241 NPISP 245
           NPI+P
Sbjct: 236 NPITP 240

 Score =  146 bits (368), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 64/93 (68%), Positives = 82/93 (88%)

Query: 418 QPMQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGTGFK 477
           +P+   RTGNQS++DKY+ LN+LLA  TG+DTFGNVG+ARIPAQHTKTGTFINSQGTG++
Sbjct: 339 EPLIQNRTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYR 398

Query: 478 QYSNEPKKNPFLPTQFTGIPTSSVVPSHTGYGF 510
           Q S++P  NPFL +Q+TG+P++SVVP+ TGYGF
Sbjct: 399 QVSDDPNHNPFLNSQYTGLPSTSVVPTQTGYGF 431

>Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W
           (REAL)
          Length = 460

 Score =  259 bits (662), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 139/246 (56%), Positives = 161/246 (65%), Gaps = 7/246 (2%)

Query: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60
           M  QFVRSAKN +KGY+S QVLVR+AT+N+    S D L ELA +SYDS +FFEIMDM+D
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXX 120
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWC+ENLYIIKTL+EFRH          
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120

Query: 121 IIRVKAKELTNLLMDDERLRMERGED-KGAXXXXXXXXXXXXXXNSYDSEMQRALDASRL 179
           I+RVK+KELT LL DDERL  ER  + KG               N  D+++QRALDASR+
Sbjct: 121 IVRVKSKELTALLSDDERLNEERNMNIKGRNRKGRSRRGTGRSSNDNDNDLQRALDASRM 180

Query: 180 TAEEDERRRKTLNNEDADLETAXXXXXXXXXXXXXXXXXXXXXXXXXXXXMQPQGYYDIF 239
           TAEEDE+RRK     D D ETA                             QP  YYDIF
Sbjct: 181 TAEEDEKRRKM----DEDYETA-LQLSKEEEELKRLQDLQRMQQLQTQQQQQPM-YYDIF 234

Query: 240 GNPISP 245
           GNPI+P
Sbjct: 235 GNPITP 240

 Score =  155 bits (393), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 83/94 (88%)

Query: 418 QPMQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGTGFK 477
           +P+   RTGNQS++DKYN LN+LLA  TG+DTFGNVGDAR+PAQHTKTGTFINSQGTG+K
Sbjct: 345 EPLTQTRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYK 404

Query: 478 QYSNEPKKNPFLPTQFTGIPTSSVVPSHTGYGFG 511
           Q SN+PK NPFL  Q+TG+P+++VVP+ TGYGFG
Sbjct: 405 QVSNDPKYNPFLSGQYTGLPSTNVVPTQTGYGFG 438

>Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206W
           (REAL)
          Length = 612

 Score =  261 bits (667), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 140/265 (52%), Positives = 165/265 (62%), Gaps = 21/265 (7%)

Query: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60
           M  QFVRSAKN +KGY+S QVLVRDATAN+   PS+D LD+LA RSYDSV+FFEIMDM+D
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXX 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCREN Y+IKTLREFRH          
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKELTNLLMDDERLRMERGED----KGAXXXXXXXXXXXXXXN------SYDSEM 170
           IIRVKAKEL +LL DDERLR ER  +    +                N      SY +++
Sbjct: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRRDRSAARPRPRRQRTRSNPHDSSPSYQNDL 180

Query: 171 QRALDASRLTAEEDERRRKTL---NNEDADLETAXXXX--------XXXXXXXXXXXXXX 219
           ++AL+ SR+TA+EDE+RR+ L   ++ED D + A                          
Sbjct: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQNQQQSL 240

Query: 220 XXXXXXXXXXMQPQGYYDIFGNPIS 244
                      +   YYDIFGNPIS
Sbjct: 241 SQMQVPVQQQQEQPAYYDIFGNPIS 265

 Score =  154 bits (388), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 80/93 (86%)

Query: 419 PMQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGTGFKQ 478
           P++  RTGNQSISDKYNDLN LLA  TG DTFGN G+ARIPAQHTKTGTFINSQGTG+KQ
Sbjct: 425 PLKQTRTGNQSISDKYNDLNTLLATGTGTDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 484

Query: 479 YSNEPKKNPFLPTQFTGIPTSSVVPSHTGYGFG 511
             NEPK NPFL  Q+TG+P++++VP+ TGYGFG
Sbjct: 485 VINEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 517

>Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W
           (REAL)
          Length = 462

 Score =  255 bits (652), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 133/245 (54%), Positives = 158/245 (64%), Gaps = 5/245 (2%)

Query: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60
           M  Q VRSAKN +KGY+S QVLVR+AT+N+    S D L ELA +SYDS +FFEIMDM+D
Sbjct: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXX 120
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWC+ENLYIIKTL+EFRH          
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120

Query: 121 IIRVKAKELTNLLMDDERLRMERGEDKGAXXXXXXXXXXXXXXNSYDSEMQRALDASRLT 180
           I+RVKAKELT+LL D+ERL  ER  +                 +  D ++QRA+DASR+T
Sbjct: 121 IVRVKAKELTSLLSDEERLNEERNMNIKGRNRGGRRRRRTNRSSEDDDDLQRAIDASRMT 180

Query: 181 AEEDERRRKTLNNEDADLETAXXXXXXXXXXXXXXXXXXXXXXXXXXXXMQPQGYYDIFG 240
           A+EDERRRK    +D D ETA                             QP  Y DIFG
Sbjct: 181 ADEDERRRK----QDEDYETALQLSKEEEELKRLQDLQRIQAQQQQQQQQQPM-YCDIFG 235

Query: 241 NPISP 245
           NPI+P
Sbjct: 236 NPITP 240

 Score =  149 bits (375), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 88/121 (72%), Gaps = 14/121 (11%)

Query: 405 RPQQPQHNTAPEP--------------QPMQPVRTGNQSISDKYNDLNQLLAQPTGVDTF 450
           R  QP  NT+  P              +P+   RTGNQS++DKY+ LN+LL   TG+DTF
Sbjct: 320 RQDQPSMNTSSMPQQQQQQQQQQQQQQEPLTQTRTGNQSMTDKYSKLNELLGTGTGIDTF 379

Query: 451 GNVGDARIPAQHTKTGTFINSQGTGFKQYSNEPKKNPFLPTQFTGIPTSSVVPSHTGYGF 510
           GN GD R+PAQHTKTGTFINSQGTG++Q SN+PK NPFL +Q+TG+P+++VVP+ TGYGF
Sbjct: 380 GNFGDTRVPAQHTKTGTFINSQGTGYRQVSNDPKHNPFLNSQYTGLPSTNVVPAQTGYGF 439

Query: 511 G 511
           G
Sbjct: 440 G 440

>Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206W
           (REAL)
          Length = 618

 Score =  258 bits (659), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 142/264 (53%), Positives = 164/264 (62%), Gaps = 21/264 (7%)

Query: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60
           M  QFVRSAKN +KGY+S QVLVRDATAN+   PS+D LD+LA RSYDSV+FFEIMDM+D
Sbjct: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXX 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCREN Y+IKTLREFRH          
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKELTNLLMDDERLRMERGED--------KGAXXXXXXXXXXXXXXNSYDS---- 168
           IIRVKAKEL +LL DDERLR ER  +                         N YDS    
Sbjct: 121 IIRVKAKELVSLLNDDERLREERTMNTRNRRTNKTARPTPTPRPRRQRTRSNLYDSPPTY 180

Query: 169 --EMQRALDASRLTAEEDERRRKTL---NNEDADLETAXXXXXXXXXXXXXXXXXXXXXX 223
             ++++AL+ SR+TA+EDE RR  +   +++D D + A                      
Sbjct: 181 QNDLEKALEESRITAQEDELRRNEMAQYDDDDPDFQAALQLSKEEEELKQLQELQKQQQL 240

Query: 224 XXXXXXMQPQ---GYYDIFGNPIS 244
                 M PQ    YYDIFGNPIS
Sbjct: 241 QSQLQ-MPPQQQAAYYDIFGNPIS 263

>YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}
           ENT2Epsin-like protein required for endocytosis and
           actin patch assembly and functionally redundant with
           Ent1p; contains clathrin-binding motif at C-terminus
          Length = 613

 Score =  257 bits (656), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 139/267 (52%), Positives = 162/267 (60%), Gaps = 23/267 (8%)

Query: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60
           M  QFVRSAKN +KGY+S QVLVRDATAN+   PS+D LD+LA RSYDSV+FFEIMDM+D
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXX 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCREN Y+IKTLREFRH          
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKELTNLLMDDERLRMERGEDKGAXXXXXXXXXXXXXXN----------SYDSEM 170
           IIRVKAKEL +LL D+ERLR ER  +                            SY  ++
Sbjct: 121 IIRVKAKELVSLLNDEERLREERSMNTRNRRANRAARPRPRRQRTRSNPHDSSPSYQDDL 180

Query: 171 QRALDASRLTAEEDERRRKTL---NNEDADLETAXXXX----------XXXXXXXXXXXX 217
           ++AL+ SR+TA+EDE+RR+ L   ++ED D + A                          
Sbjct: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQKQQQSL 240

Query: 218 XXXXXXXXXXXXMQPQGYYDIFGNPIS 244
                        Q   YYDIFGNPIS
Sbjct: 241 SQFQAPLQQQQPQQQPAYYDIFGNPIS 267

 Score =  154 bits (389), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 82/93 (88%)

Query: 419 PMQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGTGFKQ 478
           P++  RTGNQSISDKY+DLN LLA  TG+DTFGN G+ARIPAQHTKTGTFINSQGTG+KQ
Sbjct: 424 PLKQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 483

Query: 479 YSNEPKKNPFLPTQFTGIPTSSVVPSHTGYGFG 511
            +NEPK NPFL  Q+TG+P++++VP+ TGYGFG
Sbjct: 484 VTNEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 516

>CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q05785 Saccharomyces
           cerevisiae YLR206w ENT2
          Length = 510

 Score =  248 bits (634), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 140/256 (54%), Positives = 165/256 (64%), Gaps = 13/256 (5%)

Query: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60
           MP+Q VRSAKN +KGY+S QV+VRDATAN+   PSV +L++LA ++YD+VEFFEIMDM+D
Sbjct: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXX- 119
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWC+ENLYIIKTLREFRH          
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120

Query: 120 XIIRVKAKELTNLLMDDERLRMERGEDKG-------AXXXXXXXXXXXXXXNSYDSEMQR 172
            IIRVKAKELT+LL DDERLR ER  ++                       N+YD ++Q+
Sbjct: 121 QIIRVKAKELTSLLTDDERLREERALNRANRRNGDAKRRRRRSRSRSTSYRNAYDDDLQK 180

Query: 173 ALDASRLTAEEDERRRKT---LNNEDADLETAXXXXXXXXXXXXXXXXXXXXXXXXXXXX 229
           AL+ SR+TAEE+E RR+      N+D DL  A                            
Sbjct: 181 ALEESRMTAEEEEARRREQAQYENQDPDLLAALQLSKEEEELKKLQDMQRMQELQAQQQQ 240

Query: 230 MQPQGYYDIFGNPISP 245
                YYDIFGNPISP
Sbjct: 241 QNV--YYDIFGNPISP 254

 Score =  155 bits (393), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 81/89 (91%)

Query: 423 VRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGTGFKQYSNE 482
            RTGNQSISDKY++LN LLA  TG+DTFGN G+ARIPAQHTKTGTFINSQGTG+KQ +NE
Sbjct: 361 TRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNE 420

Query: 483 PKKNPFLPTQFTGIPTSSVVPSHTGYGFG 511
           PK NPFL +Q+TG+P++++VPSHTGYGFG
Sbjct: 421 PKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449

>Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa]
           {ON} complement(192214..193815) [1602 nt, 534 aa]
          Length = 533

 Score =  242 bits (617), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 133/244 (54%), Positives = 162/244 (66%), Gaps = 3/244 (1%)

Query: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60
           MP QFVRSAKN +KGY+S QV+VR+AT+N+  GP +D LD LA ++YDSVEFFEIMDM+D
Sbjct: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXX 120
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWC+ENLYII+TL+EF +          
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120

Query: 121 IIRVKAKELTNLLMDDERLRMERGEDKGAXXXXXXXXXXXXXXNSYDSEMQRALDASRLT 180
           IIRVKAKELT+LL D+ERL   R E                   S D E+QRA++ S+ T
Sbjct: 121 IIRVKAKELTSLLNDEERL---RDERGMNRRGGRRERARPRRRPSDDDELQRAIEESKRT 177

Query: 181 AEEDERRRKTLNNEDADLETAXXXXXXXXXXXXXXXXXXXXXXXXXXXXMQPQGYYDIFG 240
           AE+D+RRR+  ++E+ADL+TA                             Q   YYDIFG
Sbjct: 178 AEDDDRRRRMRDDEEADLQTALQLSKEEEELKRLQELQRLQQQQQQQQQQQQPMYYDIFG 237

Query: 241 NPIS 244
           NPIS
Sbjct: 238 NPIS 241

 Score =  160 bits (404), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 108/168 (64%), Gaps = 29/168 (17%)

Query: 358 TGSNNPFALNGMPLQSNSKPQAASDLAGLNNWGNNSTGQLEMPKYQPRP---QQPQH--- 411
           TGSNNPFA+N   LQ N++               N     E+P +  +P    QP     
Sbjct: 319 TGSNNPFAMNNQALQLNNQ---------------NDKAHSELPDFNAKPVSAYQPAELPP 363

Query: 412 --------NTAPEPQPMQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHT 463
                         QP++  RTGNQ I+DK+ +LNQLLA  TG+DTFGN G+ARIPAQHT
Sbjct: 364 QQQISLPPQPQQPQQPLKQTRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHT 423

Query: 464 KTGTFINSQGTGFKQYSNEPKKNPFLPTQFTGIPTSSVVPSHTGYGFG 511
           KTGTFINSQGTG++Q +N+PK NPFL +Q+TG+P++++VPSHTGYGFG
Sbjct: 424 KTGTFINSQGTGYRQVTNDPKNNPFLNSQYTGLPSTNIVPSHTGYGFG 471

>TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {ON}
           Anc_7.342 YLR206W
          Length = 487

 Score =  239 bits (611), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 134/246 (54%), Positives = 161/246 (65%), Gaps = 11/246 (4%)

Query: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60
           M  QFVRS KN +KGY+S QVLVR+ATANE  GP++D+L ++A ++YDS +FFEIMDM+D
Sbjct: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXX--XXX 118
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWC+ENLY+IKTL EFR+          
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120

Query: 119 XXIIRVKAKELTNLLMDDERLRMERGEDKGAXXXXXXXXXXXXXXNSYDSEMQRALDASR 178
             IIRVKAKELT LLMDDERLR ER   +                N  D ++QRAL+ SR
Sbjct: 121 GQIIRVKAKELTALLMDDERLREER---RLNNRRDRNRNRRPPARNGSDEDLQRALEESR 177

Query: 179 LTAEEDERRRKTLNNEDADLETAXXXXXXXXXXXXXXXXXXXXXXXXXXXXMQPQGYYDI 238
            TAEEDER+R+ LN +D+DL+ A                                 YYD+
Sbjct: 178 RTAEEDERKRR-LNQDDSDLQAALQLSKEEEELKRLQELQSSMHMQQQQPV-----YYDV 231

Query: 239 FGNPIS 244
           FGNPIS
Sbjct: 232 FGNPIS 237

 Score =  144 bits (364), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 111/195 (56%), Gaps = 34/195 (17%)

Query: 358 TGSNNPFALNGMPLQSNSKPQAASDLAGLNNWGNNSTGQLEMPKYQPRPQQPQHNTAPEP 417
           TGSNNPFALN     +N+   A+                 E+P +  +PQ   +  A  P
Sbjct: 313 TGSNNPFALNNQQTNNNNVQAAS-----------------ELPDF-TKPQAQSYQPAKLP 354

Query: 418 QPMQPV--------------RTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHT 463
           + ++                RTGN+ +++KYN+LNQLLA  TG+DTFGN G+ RIPAQHT
Sbjct: 355 EQIEIQQPVQQPVQQPLQQNRTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHT 414

Query: 464 KTGTFINSQGTGFKQYSNEPKKNPFLPTQFTGIPTSSVVPSHTGYGFGXXXXXXXXXXXX 523
           +TGTFINSQGTG++Q S E K NPFL  Q+TG+P+S+++P+ TGYGFG            
Sbjct: 415 QTGTFINSQGTGYRQQSGESKVNPFLSNQYTGLPSSNIIPTQTGYGFG--NQPQQQQYQQ 472

Query: 524 XXXXXXXXGVSLIDL 538
                   GVSLIDL
Sbjct: 473 QQQQNNNQGVSLIDL 487

>KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.342
           YLR206W
          Length = 447

 Score =  233 bits (595), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 127/242 (52%), Positives = 159/242 (65%), Gaps = 2/242 (0%)

Query: 5   FVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLN 64
            +RSAKN +KGY+  +VLVRDATAN    PS ++LD+LA +SY+SVEFFEI+DM+DKR+N
Sbjct: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60

Query: 65  DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXXIIRV 124
           DKGKYWRHVAK+LTVLDYLVRFGSENCV+WC+ENLYIIKTLREF H          IIRV
Sbjct: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120

Query: 125 KAKELTNLLMDDERLRMERGED-KGAXXXXXXXXXXXXXXNSYDSEMQRALDASRLTAEE 183
           KAKELT+LLMD+ERL+ ER  + +                N  D ++QRA++ S+ TAEE
Sbjct: 121 KAKELTSLLMDEERLKEERAMNIRRRGGPKRRSGGSRERNNRSDEDLQRAIEESKRTAEE 180

Query: 184 DERRRKTLNNEDADLETAXXXXXXXXXXXXXXXXXXXXXXXXXXXXMQPQGYYDIFGNPI 243
           +ERRR+   + +AD + A                             QP  YYD+FGNPI
Sbjct: 181 EERRRRNGASSEADRQAALQLSREEEDLRRLQEQARLAQQQQQQQQQQPM-YYDVFGNPI 239

Query: 244 SP 245
           +P
Sbjct: 240 TP 241

 Score =  148 bits (374), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 102/162 (62%), Gaps = 24/162 (14%)

Query: 350 GYFQQPVSTGSNNPFALNGMPLQSNSKPQAASDLAGLNNWGNNSTGQLEMPKYQPRPQQP 409
           G  QQ + TGSNNPFALN     S      A+  A +           E P         
Sbjct: 289 GIQQQTLPTGSNNPFALNNATQPSAPASTTAARPAAI-----------ETP--------- 328

Query: 410 QHNTAPEPQPMQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFI 469
               A + +P+   R+GNQ+ISDKY+ LN LLA  TG+DTFGN G+ RIPAQHT+TGTFI
Sbjct: 329 ----ATQTKPLTQTRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFI 384

Query: 470 NSQGTGFKQYSNEPKKNPFLPTQFTGIPTSSVVPSHTGYGFG 511
           NSQGTG++Q +N+ K NPFL  Q+TG+P++++VP+ TG+GFG
Sbjct: 385 NSQGTGYRQVNNDDKPNPFLNGQYTGLPSTNIVPTQTGFGFG 426

>KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {ON}
           Anc_7.342 YLR206W
          Length = 550

 Score =  233 bits (595), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 131/256 (51%), Positives = 159/256 (62%), Gaps = 12/256 (4%)

Query: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60
           M  QFVRSAKN +KGY+S QVLVRDAT+N+    ++D LD++A RSYDSV+FFEIMDM+D
Sbjct: 1   MSKQFVRSAKNVMKGYSSTQVLVRDATSNDNRVTNIDTLDDIASRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXX 120
           KRLNDKGKYW+H+ KSLTVLDYLVRFGSENCVLWC+ENLY+IKTLREFR+          
Sbjct: 61  KRLNDKGKYWKHIVKSLTVLDYLVRFGSENCVLWCKENLYVIKTLREFRYEDDTGIDQGQ 120

Query: 121 IIRVKAKELTNLLMDDERLRMERGEDKGAXXXXXXXXXXXXXXNSY-------DSEMQRA 173
           IIRVKAKELT+LL D+ERLR ER  +                 +         D ++QR 
Sbjct: 121 IIRVKAKELTSLLQDEERLREERRFNNRRNRRNNRSANRSRATSRSQSNIGPDDDDLQRV 180

Query: 174 LDASRLTAEEDERRRKTL---NNEDADLETAXXXXXXXXXXXXXXXXXXXXXXXXXXXXM 230
           ++ S+ TAEEDERRRK L   + ED + + A                             
Sbjct: 181 IEESKKTAEEDERRRKELARYDEEDPEFQAALQLSKEEEELKNLQDLQRQQQQLQMLQQQ 240

Query: 231 QPQG--YYDIFGNPIS 244
           Q     YYD+FGNPIS
Sbjct: 241 QTSANVYYDVFGNPIS 256

 Score =  146 bits (368), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 85/164 (51%), Positives = 105/164 (64%), Gaps = 21/164 (12%)

Query: 355 PVSTGSNNPFALNGMPLQSNSKPQAASDLAGLNNWGNNSTGQLEMPKYQPRPQQ-PQ--- 410
           P+ TGSNNPF+++              +L  +NN              Q  PQQ PQ   
Sbjct: 328 PMVTGSNNPFSMD--------------NLGKVNNAPPPQPVPQPQLAVQSPPQQIPQVAM 373

Query: 411 --HNTAPEPQPMQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTF 468
                  E QP++  RTGN+ I++KY++LN LLAQ TGVDTFGN G  RIPAQHTKTGTF
Sbjct: 374 PPLPQQQEQQPLKQNRTGNEEITEKYSELNNLLAQGTGVDTFGNTGQERIPAQHTKTGTF 433

Query: 469 INSQGTGFKQYSNE-PKKNPFLPTQFTGIPTSSVVPSHTGYGFG 511
           INSQGTG+KQ +NE  K NPFL TQ+TG+P+S++VPS TGYGFG
Sbjct: 434 INSQGTGYKQVTNERSKNNPFLNTQYTGLPSSNIVPSSTGYGFG 477

>SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 498

 Score =  232 bits (591), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 135/248 (54%), Positives = 160/248 (64%), Gaps = 4/248 (1%)

Query: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60
           M    +R+AKN + GY+S QVLVR+AT+NE  GP+VD LDELA ++YD+VEFFEIMDM+D
Sbjct: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXX 120
           KRLNDKGK WRHVAKSLTVLDYLVR+GSENCVLW +ENLYIIKTLREF H          
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120

Query: 121 IIRVKAKELTNLLMDDERLRMERGEDKGAXXXXXXXXXXXXXXNSYDSEMQRALDASRLT 180
           IIRVKAKELT+LL D+ERL  ER   K                  YD ++QRAL+ SRLT
Sbjct: 121 IIRVKAKELTSLLRDEERLTEERNMRK-KRRGKTRRPERSRGGEEYDDDLQRALEESRLT 179

Query: 181 AEEDERRRKT--LNNEDADLETA-XXXXXXXXXXXXXXXXXXXXXXXXXXXXMQPQGYYD 237
           AEE+ERRR+T   +N+D D +TA                              Q   YYD
Sbjct: 180 AEEEERRRRTDSGSNDDDDFQTALQLSKEEEELRRLRNLQMQQQQTAMFQQQQQQPMYYD 239

Query: 238 IFGNPISP 245
           +FGNPI+P
Sbjct: 240 VFGNPITP 247

 Score =  146 bits (369), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 78/93 (83%), Gaps = 1/93 (1%)

Query: 420 MQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGTGFKQY 479
           + P RTGNQSIS KYNDLN LLA  TG+DTFGN G  RIPAQHT+TG FINSQGTG+KQ 
Sbjct: 371 LNPTRTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQV 430

Query: 480 SN-EPKKNPFLPTQFTGIPTSSVVPSHTGYGFG 511
           +N +PK NPFL  Q+TG+P++SVVPS+TGYGFG
Sbjct: 431 TNDQPKNNPFLAAQYTGLPSTSVVPSYTGYGFG 463

>KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]
           {ON} some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 478

 Score =  231 bits (588), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 131/248 (52%), Positives = 156/248 (62%), Gaps = 6/248 (2%)

Query: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60
           M   F+RSAKN + GY+ AQVLVR AT+N+ +GPSVD L+ELA R++D+VEFFEIMDM+D
Sbjct: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXX- 119
           KRLNDKG+ WRHVAKSLT LD+LVR GSENCV WC+ENLYIIKTLREF H          
Sbjct: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120

Query: 120 XIIRVKAKELTNLLMDDERLRMERGEDKGAXXXXXXXXXXXXXXNSYDSEMQRALDASRL 179
            I+RVKAKELT LL D+ERL+ ER                    N  D ++QRAL+ SR+
Sbjct: 121 EIVRVKAKELTALLRDEERLKEERM--MRLKGRKRGGRKNRRDDNEDDDDLQRALEESRI 178

Query: 180 TAEEDERRRKTL--NNEDADLETAXXXXXXXXXXXXXXXXXXXXXXXXXXXXMQPQ-GYY 236
           TAEE+ERRRK L    +D+ L+ A                             Q Q  YY
Sbjct: 179 TAEEEERRRKQLMMQGDDSSLQAALELSKEEEELRRLQQLQAQQQAALWQQQQQQQPMYY 238

Query: 237 DIFGNPIS 244
           DIFGNPIS
Sbjct: 239 DIFGNPIS 246

 Score =  154 bits (388), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 80/155 (51%), Positives = 103/155 (66%), Gaps = 16/155 (10%)

Query: 358 TGSNNPFALNGMPLQSNSKPQAASDLAGLNNWGNNSTGQLEMPKYQPRPQQPQHNTAPEP 417
           TGSNNPFALN  P     +     D   +    + S   +   +++P P+Q         
Sbjct: 309 TGSNNPFALNRPPSPQEIEEIEEPDFTPVQLPPSPSPAAVPQQEFKPVPKQ--------- 359

Query: 418 QPMQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGTGFK 477
                 RTGNQSISDK+++LN LLA  TG+DTFGN G+ R+PAQHTKTGTFINSQGTG+K
Sbjct: 360 ------RTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYK 413

Query: 478 QYSNE-PKKNPFLPTQFTGIPTSSVVPSHTGYGFG 511
           Q +N+ PK NPFL +Q+TGIP+S++ PS+TGYGFG
Sbjct: 414 QITNDAPKHNPFLTSQYTGIPSSAIAPSYTGYGFG 448

>NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.342
           YDL161W
          Length = 486

 Score =  230 bits (587), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 133/263 (50%), Positives = 163/263 (61%), Gaps = 19/263 (7%)

Query: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60
           M  QFVRSAKN +KGY++ QVLVRDAT+N+   PS ++L E++ RS+DSV+FFEIMDM+D
Sbjct: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXX 120
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWC++NLYIIKTL+EF+           
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFK-LEDDNVDESS 119

Query: 121 IIRVKAKELTNLLMDDERLRMERGEDKGAXXXXXXXXXXXXXXNSY------DSEMQRAL 174
           IIRVKAKELT LL DDERL+ ER  +                 N+       D ++Q+AL
Sbjct: 120 IIRVKAKELTALLQDDERLKEERSINLKNNRRSERKNRSRRGTNATRRGTKSDEDLQKAL 179

Query: 175 DASRLTAEEDERRRKTL---NNEDADLETAXXXXXXXXXXXXXXXXXXXXXXXXXXXXMQ 231
           + SR+TAEEDERRR+ L   +N+D D +TA                              
Sbjct: 180 EESRITAEEDERRRRELAQYDNQDTDYQTALQLSKEEEELKKLQELQRLQQLQQQQQQQM 239

Query: 232 PQG---------YYDIFGNPISP 245
                       YYDIFGNPISP
Sbjct: 240 QFQQQPQQQEQVYYDIFGNPISP 262

 Score =  149 bits (376), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 101/154 (65%), Gaps = 21/154 (13%)

Query: 358 TGSNNPFALNGMPLQSNSKPQAASDLAGLNNWGNNSTGQLEMPKYQPRPQQPQHNTAPEP 417
           TGSNNPFALN     S  +P                         QP+   PQ    P  
Sbjct: 323 TGSNNPFALNATINTSPIRPAEQQP--------------------QPQFTAPQQQQQPLQ 362

Query: 418 QPMQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGTGFK 477
           QP++  RTGNQSISDKYN+LN LLA  TG+DTFGN GD RIPAQHT+TGTFINSQGTG+K
Sbjct: 363 QPLKQTRTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYK 422

Query: 478 QYSNEP-KKNPFLPTQFTGIPTSSVVPSHTGYGF 510
           Q  N+P KKNPFL  Q+TG+P+S++VPSHTGYGF
Sbjct: 423 QIVNDPVKKNPFLNNQYTGLPSSNIVPSHTGYGF 456

>Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]
           {ON} YDL161W (ENT1) - Ent1p [contig 161] FULL
          Length = 508

 Score =  228 bits (582), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 128/259 (49%), Positives = 156/259 (60%), Gaps = 21/259 (8%)

Query: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60
           M    +R AKN + GY++ QVL+R+AT+N+ EGPS+D++DE+A RS+DSV FFEIMDM+D
Sbjct: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXX 120
           KRLNDKGK WRHVAKSLTVLDYLVR GSE+CV W +ENLY+IKTLREF H          
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120

Query: 121 IIRVKAKELTNLLMDDERLRMERGEDKGAXXXXXXXXXXXXXXNSYDSEMQRALDASRLT 180
           I+RVKA+ELT LL+DDERLR ER     +               S D ++QRA++ SRLT
Sbjct: 121 IVRVKARELTALLLDDERLREER-----SLRTKNRKPRRRPTAGSEDEDLQRAMEESRLT 175

Query: 181 A--EEDERRRK--TLNNEDADLETAXXXXXXXXXXXXXXXXXXXXX-----------XXX 225
           A  EE ERRRK    +N   DL+TA                                   
Sbjct: 176 AEQEEAERRRKLEIYDNSSDDLQTALQLSKEEEELRRLRELQMQQQMQQAQQQMFGLSQQ 235

Query: 226 XXXXMQPQGYYDIFGNPIS 244
                QP  YYD+FGNPIS
Sbjct: 236 QTQAQQPM-YYDVFGNPIS 253

 Score =  139 bits (350), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 114/164 (69%), Gaps = 10/164 (6%)

Query: 354 QPVSTGSNNPFALNGMPLQSNSKPQAASDLAGL------NNWGNNSTGQLEMPKYQPRPQ 407
           QP+ TGSNNPFA +     + +  + AS  A +      +N   +   QL+  + Q + Q
Sbjct: 324 QPLETGSNNPFARHS----NQNANEDASKYANVAPSPPQDNQLLSQQQQLQQEQQQQQQQ 379

Query: 408 QPQHNTAPEPQPMQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGT 467
           Q Q    P+PQP++  RTGNQSI++K+++LN LLA  TG+DTFGN G  RIPAQHTKTG 
Sbjct: 380 QQQPQPQPQPQPLKQTRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGN 439

Query: 468 FINSQGTGFKQYSNEPKKNPFLPTQFTGIPTSSVVPSHTGYGFG 511
           FINSQGTG+KQ S+ PK NPFL  Q+TG+P+++VVPS+TGYGFG
Sbjct: 440 FINSQGTGYKQVSSTPKHNPFLGQQYTGLPSTNVVPSYTGYGFG 483

>TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}
           Anc_7.342 YLR206W
          Length = 599

 Score =  221 bits (562), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 129/269 (47%), Positives = 162/269 (60%), Gaps = 25/269 (9%)

Query: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60
           M  QF+RS KN +KGY+S Q+LVRDATAN+   PS+D+LD++A ++YDSV+FFEIMDM+D
Sbjct: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXX-- 118
           KRLNDKGKYW+HVAKSLTVLDYL+RFGSENCV WC+ENLY+IKTL+EFR           
Sbjct: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120

Query: 119 --XXIIRVKAKELTNLLMDDERLRMERG-EDKGAXXXXXXXXXXXXXXNS---------- 165
               I+RV+A ELT+LLMDDERLR ER    +G               N+          
Sbjct: 121 DQGQIVRVRATELTSLLMDDERLREERSLHSRGGRRSAPPPRMAPQRRNTSRSDFNRQRA 180

Query: 166 ---YDSEMQRALDASRLTAEEDERRRKTLN-NEDADLETAXXXXXXXXXXXXXXXXXXXX 221
              YD ++Q+A++ S+ TAEEDERRR+    +++ D ETA                    
Sbjct: 181 DDHYDDDLQKAIEESKRTAEEDERRRRNREGDQEDDFETALQLSKEEEELKKLQELHAQQ 240

Query: 222 XXXXXXXXMQPQG------YYDIFGNPIS 244
                     P        Y DIFGNPIS
Sbjct: 241 IALQNQQNATPTTQNVANVYTDIFGNPIS 269

 Score =  165 bits (418), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 117/167 (70%), Gaps = 15/167 (8%)

Query: 353 QQPVSTGSNNPFALNGM--------PLQSNSKPQAASDLAGLNNWGNNSTGQLEMPKYQP 404
           QQP+ TG+NNPF+L+ +        PL S+S    ++ L  L+++  +++     P  Q 
Sbjct: 399 QQPMVTGTNNPFSLSNINNPQQQQPPLMSSS----STTLPDLSSFKQSTSVP---PATQS 451

Query: 405 RPQQPQHNTAPEPQPMQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTK 464
                 + ++  PQP+  +RTGNQ ISDKYN+LN LLA  TG+DTFGN GD RIPAQHT 
Sbjct: 452 SYTTKTNASSLPPQPIPQMRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTA 511

Query: 465 TGTFINSQGTGFKQYSNEPKKNPFLPTQFTGIPTSSVVPSHTGYGFG 511
           TGTFINSQGTG+KQY N+PK NPF+  Q+TG+P+++VVPS+TGYGFG
Sbjct: 512 TGTFINSQGTGYKQYINDPKNNPFMSNQYTGLPSTNVVPSYTGYGFG 558

>KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 502

 Score =  218 bits (555), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 131/256 (51%), Positives = 158/256 (61%), Gaps = 17/256 (6%)

Query: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60
           M    +R AKN + GY++ QVL+R+AT+N+ +GPS+D++DE+A RS+DSV FFEIMDM+D
Sbjct: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXX 120
           KRLNDKGK WRHVAKSLTVLDYLVR GSE+CV W +ENLYIIKTLREF H          
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120

Query: 121 IIRVKAKELTNLLMDDERLRMERGEDKGAXXXXXXXXXXXXXXNSYDSEMQRALDASRLT 180
           I+RVKA+ELT LL D+ERLR ER E KG               +SYD +MQRAL+ SR+T
Sbjct: 121 IVRVKARELTALLQDEERLREER-ELKGR----NRRPRRRKNSDSYDDDMQRALEESRMT 175

Query: 181 A--EEDERRRK--TLNNEDADLETAXXXXXXXXXXXXXXXXXXXXXXXXXXXXMQPQG-- 234
           A  EE ERRRK    +N   DL+TA                            M      
Sbjct: 176 AEQEEAERRRKLEMYDNSADDLQTALQLSKEEEELRRLRELQMQQQMQQAQQQMFGLQQQ 235

Query: 235 ------YYDIFGNPIS 244
                 YYD+FGNPIS
Sbjct: 236 QTQQPMYYDVFGNPIS 251

 Score =  146 bits (368), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 95/188 (50%), Positives = 110/188 (58%), Gaps = 14/188 (7%)

Query: 355 PVSTGSNNPFALNGM--PLQSNSKPQAASDLAGLNNWGNNSTGQLEMPKYQPRPQQPQHN 412
           P+ TGSNNPFA N      +  SK  AAS            T QL         Q  Q  
Sbjct: 325 PLETGSNNPFAKNAQQPSAEDPSKYAAAS--------SPQRTQQLSPQLQPQPEQFQQQQ 376

Query: 413 TAPEPQPMQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQ 472
                QP++  RTGNQS++DK++DLN LLA  TG+DTFGN G  RIPAQHTKTGTFINSQ
Sbjct: 377 QQIPQQPLKQTRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQ 436

Query: 473 GTGFKQYSNEP--KKNPFLPTQFTGIPTSSVVPSHTGYGFGXXXXXXXXXXXXXXXXXXX 530
           GTG+KQ SN P  K NPFL  Q+TG+P++SVVPS+TGYGFG                   
Sbjct: 437 GTGYKQVSNMPQGKHNPFLGQQYTGLPSTSVVPSYTGYGFG--NQNVQKQTNQNRANGAD 494

Query: 531 XGVSLIDL 538
            GVSLIDL
Sbjct: 495 QGVSLIDL 502

>KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.342
           YLR206W
          Length = 414

 Score =  203 bits (517), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 112/140 (80%)

Query: 5   FVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLN 64
            +RSAKN +KGY+S Q LVRDAT+N  + P +D L ELA  +Y+++EFFEIMDM+DKR+N
Sbjct: 1   MLRSAKNLVKGYSSTQKLVRDATSNSHDNPPIDQLSELAEMTYNNMEFFEIMDMLDKRIN 60

Query: 65  DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXXIIRV 124
            KGKYW+HV KSL VLDYLVRFGSENCV+WC+ENLYIIKTLREF +          ++RV
Sbjct: 61  SKGKYWKHVIKSLIVLDYLVRFGSENCVIWCKENLYIIKTLREFTYEDESGMDQGQMVRV 120

Query: 125 KAKELTNLLMDDERLRMERG 144
           +AKELT+LLMD+ERLR ER 
Sbjct: 121 RAKELTSLLMDEERLREERA 140

 Score =  147 bits (371), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 78/157 (49%), Positives = 96/157 (61%), Gaps = 29/157 (18%)

Query: 355 PVSTGSNNPFALNGMPLQSNSKPQAASDLAGLNNWGNNSTGQLEMPKYQPRPQQPQHNTA 414
           P++TGSNNPFALN   LQ ++   +  D                              T 
Sbjct: 275 PLATGSNNPFALNNKKLQQHTPEPSVID-----------------------------TTL 305

Query: 415 PEPQPMQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGT 474
               P++  RTG+QSISDKY+ LN LLA  TG+DTFGN G+ RIPAQHTKTGTFINSQGT
Sbjct: 306 NTQAPLKQTRTGSQSISDKYSALNTLLATGTGIDTFGNTGNQRIPAQHTKTGTFINSQGT 365

Query: 475 GFKQYSNEPKKNPFLPTQFTGIPTSSVVPSHTGYGFG 511
           G+KQ S     N FL +Q+TG+P+S++VPS TGYGFG
Sbjct: 366 GYKQVSTNGFNNVFLNSQYTGLPSSNIVPSQTGYGFG 402

>Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar to
           Ashbya gossypii ACL157C
          Length = 514

 Score =  203 bits (517), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 119/256 (46%), Positives = 148/256 (57%), Gaps = 13/256 (5%)

Query: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60
           M  Q +RSAKN + GY+ AQVLVR+AT+N+  GPS+D ++ELA R+Y +VEFFEIM M+D
Sbjct: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXX-XXXX 119
           +RLNDK K WRHVAKSLTV DYLVR G+E CV W REN++II+ L EF H          
Sbjct: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120

Query: 120 XIIRVKAKELTNLLMDDERLRMERGEDKGAXXXXXXXXXXXXXXNSYDSEMQRALDASRL 179
            +IRVKAKEL  LL DDERL+ ER    G               +  D +++RAL+ SR+
Sbjct: 121 QLIRVKAKELIALLRDDERLKEERNLRLG-RGKKNPQNVPETNPDGVDPDLKRALEESRI 179

Query: 180 TAEEDERRRKTL-NNEDA-DLETAXXXXXXXXXXXXXXXXXXXXXXXXXXXXMQPQG--- 234
           TAEE+ERRRK     EDA +L+ A                             Q      
Sbjct: 180 TAEEEERRRKLAEKTEDAEELQAALQLSKEEEELRKLRELQQQREQQMAFWQQQQVQQVQ 239

Query: 235 ------YYDIFGNPIS 244
                 YYDIFGNPI+
Sbjct: 240 YQQQPMYYDIFGNPIT 255

 Score =  145 bits (365), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 83/117 (70%), Gaps = 6/117 (5%)

Query: 423 VRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGTGFKQYSNE 482
            RTGNQSISDKY +LN LLA  TG+DTFGN G ARI +QHTKT TFINS GTGFKQ SNE
Sbjct: 403 TRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE 462

Query: 483 -PKKNPFLPTQFTGIPTSSVVPSHTGYGFGXXXXXXXXXXXXXXXXXXXXGVSLIDL 538
            PK NPFL TQ+TG+P++++VPSHTGYGFG                    G+SLIDL
Sbjct: 463 PPKHNPFLTTQYTGLPSTNIVPSHTGYGFG-----NASSFQQTASKPNDQGMSLIDL 514

>KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.342
           YLR206W
          Length = 646

 Score =  184 bits (466), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 109/287 (37%), Positives = 147/287 (51%), Gaps = 43/287 (14%)

Query: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60
           M  QFVRSAKN +KGY+S QVLVRDATAN+   P +D L+++A  S+DSV+FFEIMD+++
Sbjct: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXX-XXX 119
           KRLND GKYWRH+ KSLTVLDYLVRFGSE+C  W R++L+++K LR FR           
Sbjct: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120

Query: 120 XIIRVKAKELTNLLMDDERL----------------------------RMERGED----- 146
            I+RVKA++L  LL   E+L                              +RG+D     
Sbjct: 121 QIVRVKARDLVELLQSGEQLGGRKAKRARGASRRDRGRRRGGDRGGGEYRQRGDDPEDEY 180

Query: 147 ----KGAXXXXXXXXXXXXXXNSYDSEMQRALDASRLTAEEDERRRKTL---NNEDADLE 199
                G                + D ++QRA++ S+ T +EDE RR+ L   + ED + +
Sbjct: 181 YPRPAGGPPPQRQGYESGGARGNDDDDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQ 240

Query: 200 TAXXXXXXXXXXXXXXXXXXXXXXXXXXXXMQPQ--GYYDIFGNPIS 244
            A                             Q     Y D+FGNP+S
Sbjct: 241 AALQLSREEEELKNLQHLQRLQQQQQQQQQQQQLNTAYLDVFGNPVS 287

 Score =  147 bits (371), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 117/194 (60%), Gaps = 37/194 (19%)

Query: 355 PVSTGSNNPFALNGMPLQSNSKPQAASD-LAGLNNWG----------------------- 390
           P++TGSNNPFA+N  P+Q  +  Q+ ++ ++   N+                        
Sbjct: 392 PMTTGSNNPFAVNAAPIQQPNYTQSPNNYVSPQQNYAPPQPPRPSQPSQQQSPQQSPQQA 451

Query: 391 -NNSTGQLEMPKYQ-------PRPQQPQHNTAPEP--QPMQPVRTGNQSISDKYNDLNQL 440
            N  +   ++P  Q         P Q  H  AP P  QPM  + TGNQ +++KY++LN L
Sbjct: 452 YNPYSSPQQVPNAQFSGNVPTGSPGQEAHGRAPAPVPQPMPRMNTGNQEVTNKYSELNNL 511

Query: 441 LAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGTGFKQYSNE---PKKNPFLPTQFTGIP 497
           LAQ TGVDTFGN G  RIPAQHT+TGTFINSQGTGFKQ ++E   P  NPFL +Q+TG+P
Sbjct: 512 LAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQVNSEGKDPNSNPFLNSQYTGLP 571

Query: 498 TSSVVPSHTGYGFG 511
           ++ +VP++TGYGFG
Sbjct: 572 STGIVPAYTGYGFG 585

>TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {ON}
           Anc_7.342 YLR206W
          Length = 701

 Score =  183 bits (465), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 111/252 (44%), Positives = 140/252 (55%), Gaps = 19/252 (7%)

Query: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60
           M  QFVRS KN  KGY+  QVLVRDATAN   G S+D+LD+L   SYD+ EF +I  ++D
Sbjct: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXX 120
           +R++DK KYWRHVAKSLTV+DYLVRFGSE CV W R+N   ++ LR+F +          
Sbjct: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120

Query: 121 IIRVKAKELTNLLMDDERLRMERGED-KGAXXXXXXXXXXXXXXNSY------DSEMQRA 173
           +IRVKA EL +LL D ERL  ERG + +G                S       + ++ RA
Sbjct: 121 LIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRRPEDEEDVDRA 180

Query: 174 LDASRLTAEEDE-RRRKTLNNEDADLETAXXXXXXXXXXXXXXXXXXXXXXXXXXXXMQP 232
           L+ S+ TAEEDE RRRK    E  DL+ A                             +P
Sbjct: 181 LEESKKTAEEDEARRRKDQEREKQDLKEAVKLSKEEDELKRLQDEANN----------KP 230

Query: 233 QGYYDIFGNPIS 244
           Q Y+D  GNPIS
Sbjct: 231 Q-YFDENGNPIS 241

 Score =  118 bits (296), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 65/83 (78%)

Query: 420 MQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGTGFKQY 479
           +QP+ TGN  IS KY++LNQLLAQ TG+DTFGN G  RIPAQHTKTGTFINSQGTG+KQ 
Sbjct: 591 LQPMHTGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQV 650

Query: 480 SNEPKKNPFLPTQFTGIPTSSVV 502
           ++     P LPTQ+TG+P  + V
Sbjct: 651 TSSSSPIPLLPTQYTGLPAQTAV 673

>ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR206W
           (ENT2) and YDL161W (ENT1)
          Length = 515

 Score =  171 bits (433), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 120/253 (47%), Positives = 148/253 (58%), Gaps = 10/253 (3%)

Query: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60
           M  Q +RSAKN + GY+ AQ+LVR+AT+NE  GPS+D ++ELA RSY +VEFFEI+ M+D
Sbjct: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXX- 119
           KRL+DK K+WRHVAKSLTV D+LVR G+E CV W RENLY+ + L EF H          
Sbjct: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120

Query: 120 XIIRVKAKELTNLLMDDERLRMERGEDKGAXXXXXXXXXXXXXXNSYDSEMQRALDASRL 179
            IIRVKA+EL  LL D+ERLR ER    G               +  D ++QRAL+ SR+
Sbjct: 121 QIIRVKARELVALLRDEERLREERNMRLGRNPRNRQASVPPPAED-LDPDLQRALEESRI 179

Query: 180 TAEEDERRRKTLNNEDAD---LETAXXXXXXXXXXXXXXXXXXXXXXXXXXXXMQPQG-- 234
           TAEE+ERRR+   N+  D   LE A                             Q Q   
Sbjct: 180 TAEEEERRRREKTNQQQDNEELEVALQLSKEEEELRKLRELQQQREQQMALWQQQQQQQP 239

Query: 235 ---YYDIFGNPIS 244
              YYDIFGNPIS
Sbjct: 240 QAMYYDIFGNPIS 252

 Score =  159 bits (403), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 112/170 (65%), Gaps = 17/170 (10%)

Query: 358 TGSNNPFALNGMPLQSNSKPQAA----SDLAGLNNWGNNS-----------TGQLEMPKY 402
           +G NNPF+L  M   ++  PQA+    S   G  +  ++S             Q      
Sbjct: 322 SGPNNPFSLENMHKLNSDGPQASGPYISTAGGFPDRASSSPSLPQQKQQPQVLQQPGQHS 381

Query: 403 QPRPQQPQHNTAPEPQPMQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQH 462
            P PQ P+  + P PQ +QP RTGNQSI+DKY++LN LLA  TG+DTFGN G  RIPAQH
Sbjct: 382 SPVPQLPRPQSQPGPQ-LQPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQH 440

Query: 463 TKTGTFINSQGTGFKQYSNE-PKKNPFLPTQFTGIPTSSVVPSHTGYGFG 511
           TKTGTFINSQGTG+KQ  NE PK NPF+ TQ+TG+P++++VPSHTGYGFG
Sbjct: 441 TKTGTFINSQGTGYKQVGNEPPKHNPFIATQYTGLPSTNMVPSHTGYGFG 490

>Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 95.5 bits (236), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/141 (34%), Positives = 79/141 (56%), Gaps = 1/141 (0%)

Query: 4   QFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRL 63
           ++ R A+N +  YT  +  VR+AT NE  G S  ++D+++  +Y+  E  EI+ MI +R 
Sbjct: 17  KYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFRRF 76

Query: 64  NDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXXII 122
            +K G  WR + K+L +LDYL++ GSE  +   R ++ +IK L  F +           +
Sbjct: 77  TEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILESFHYTDSQGRDQGINV 136

Query: 123 RVKAKELTNLLMDDERLRMER 143
           R + K L  LL DD ++R ER
Sbjct: 137 RTRVKALVELLSDDSKIRAER 157

>Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..9313)
           [1257 nt, 419 aa]
          Length = 418

 Score = 94.7 bits (234), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 81/141 (57%), Gaps = 1/141 (0%)

Query: 4   QFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRL 63
           ++ R A+N +  YT  +  VR+AT NE  G S  ++++++  +Y+  E  EI+ MI +R 
Sbjct: 17  KYFRKAQNVMFNYTEMEGKVREATNNEPWGASSTLMEQISQGTYNIREREEILSMIFRRF 76

Query: 64  NDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXXII 122
            +K    WR + K+L +L+YL++ GSE  +   R +L +IK L  F +           +
Sbjct: 77  TEKTASEWRQIYKALQLLEYLIKHGSERFIDDVRSSLSLIKMLESFHYIDSQGRDQGINV 136

Query: 123 RVKAKELTNLLMDDERLRMER 143
           R KA+ LT LL DDE++R ER
Sbjct: 137 RNKAQSLTALLKDDEQIRAER 157

>Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125C
           (ENT3) - Ent3p [contig 219] FULL
          Length = 382

 Score = 94.0 bits (232), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 79/141 (56%), Gaps = 1/141 (0%)

Query: 4   QFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRL 63
           ++ R A+N +  YT  +  VR+AT NE  G S  +++++A  +Y+  E  EI+ MI +R 
Sbjct: 17  KYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQIAQGTYNYREREEILGMIFRRF 76

Query: 64  NDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXXII 122
            +K    WR + K+L +LDYL+R G+E  +   R NL +IK L  F +           +
Sbjct: 77  TEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGINV 136

Query: 123 RVKAKELTNLLMDDERLRMER 143
           R +A EL  LL DD ++R ER
Sbjct: 137 RNRAHELALLLDDDAKVRAER 157

>Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 94.0 bits (232), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 49/141 (34%), Positives = 79/141 (56%), Gaps = 1/141 (0%)

Query: 4   QFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRL 63
           ++ R A+N +  YT  +  VR+AT NE  G S  ++D+++  +Y+  E  EI+ MI +R 
Sbjct: 17  KYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFRRF 76

Query: 64  NDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXXII 122
            +K G  WR + K+L +LDYL++ GSE  +   R ++ +IK L  F +           +
Sbjct: 77  TEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILETFHYIDSQGRDQGINV 136

Query: 123 RVKAKELTNLLMDDERLRMER 143
           R + K L  LL DD ++R ER
Sbjct: 137 RTRVKTLIELLSDDNKIRAER 157

>Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {ON}
           YJR125C (REAL)
          Length = 409

 Score = 93.6 bits (231), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 80/141 (56%), Gaps = 1/141 (0%)

Query: 4   QFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRL 63
           ++ R A+N +  YT  +  VR+AT NE  G S  ++D+++  +Y+  E  EI+ MI +R 
Sbjct: 17  KYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFRRF 76

Query: 64  NDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXXII 122
            +K G  WR + K+L +LDYL++ GSE  +   R ++ +I+ L  F +           +
Sbjct: 77  TEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGINV 136

Query: 123 RVKAKELTNLLMDDERLRMER 143
           R + K L +LL DD ++R ER
Sbjct: 137 RTRVKALIDLLSDDNKIRAER 157

>KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 401

 Score = 93.2 bits (230), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 79/141 (56%), Gaps = 1/141 (0%)

Query: 4   QFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRL 63
           ++ R A+N +  YT  +  VR+AT NE  G S  ++++++  +Y+  E  EI+ MI +R 
Sbjct: 17  KYFRKAQNMVFNYTEMEAKVREATNNEPWGASSTLMEQISQGTYNYREREEILGMIFRRF 76

Query: 64  NDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXXII 122
            +K    WR + K+L +LDYL+R G+E  +   R NL +IK L  F +           +
Sbjct: 77  TEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGINV 136

Query: 123 RVKAKELTNLLMDDERLRMER 143
           R +A EL  LL DD ++R ER
Sbjct: 137 RNRAHELVLLLDDDGKIRTER 157

>TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.346
           YJR125C
          Length = 375

 Score = 92.8 bits (229), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 79/141 (56%), Gaps = 1/141 (0%)

Query: 4   QFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRL 63
           ++ R A+N +  YT  +  VR+AT NE  G S  ++++++  +Y+  E  EI+ MI +RL
Sbjct: 17  KYFRRAQNVVFNYTDMEAKVREATNNEPWGASTTLMEQISQGTYNMREREEILGMIFRRL 76

Query: 64  NDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXXII 122
            +K    WR + K+L +LDYL+R  SE  +   R ++ +IK L  F +           +
Sbjct: 77  TEKRANEWRQIYKALQLLDYLIRHASERFIDDTRSSISLIKMLESFHYIDSQGRDQGINV 136

Query: 123 RVKAKELTNLLMDDERLRMER 143
           R +AK L  LL DDE +R ER
Sbjct: 137 RNRAKALAELLSDDETIRAER 157

>NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {ON}
           Anc_4.346
          Length = 435

 Score = 93.6 bits (231), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 80/141 (56%), Gaps = 1/141 (0%)

Query: 4   QFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRL 63
           ++ R A+N +  YT  +  VR+AT NE  G S  +++++A  +Y+  E +EI+ MI +R 
Sbjct: 17  KYFRKAQNVVFNYTEMESKVREATNNEPWGASSTLMEQIAQGTYNVRERYEIVGMIFRRF 76

Query: 64  NDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXXII 122
            +K G  WR + K+L +LDYL++ GSE  +   R +L +I+ L  F +           +
Sbjct: 77  TEKAGSEWRQIYKALQLLDYLIKHGSEPFIDDVRSSLKLIQMLETFHYIDSEGRDQGINV 136

Query: 123 RVKAKELTNLLMDDERLRMER 143
           R +AK L  LL DD  +R ER
Sbjct: 137 RNRAKLLVELLQDDSNIRQER 157

>YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON}
           ENT3Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p
          Length = 408

 Score = 93.2 bits (230), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 79/141 (56%), Gaps = 1/141 (0%)

Query: 4   QFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRL 63
           ++ R A+N +  YT  +  VR+AT NE  G S  ++D+++  +Y+  E  EI+ MI +R 
Sbjct: 17  KYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFRRF 76

Query: 64  NDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXXII 122
            +K G  WR + K+L +LDYL++ GSE  +   R ++ +I+ L  F +           +
Sbjct: 77  TEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGINV 136

Query: 123 RVKAKELTNLLMDDERLRMER 143
           R + K L  LL DD ++R ER
Sbjct: 137 RTRVKALIELLSDDNKIRAER 157

>SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 415

 Score = 92.8 bits (229), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 81/141 (57%), Gaps = 1/141 (0%)

Query: 4   QFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRL 63
           ++ R A+N +  YT  +  VR+AT NE  G S  ++++++  +Y+  E  EI+ MI +R 
Sbjct: 17  KYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQISAGTYNYREREEILGMIFRRF 76

Query: 64  NDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXXII 122
            +K    WR + K+L +L+YL++ GSE  +   R NL +IK L  F +           +
Sbjct: 77  TEKTASEWRQIYKALQLLEYLIKHGSERFIDDSRANLTLIKMLESFHYTDSQGRDQGINV 136

Query: 123 RVKAKELTNLLMDDERLRMER 143
           R +A+EL  LL +D+++R ER
Sbjct: 137 RNRAQELVKLLNNDDQIRAER 157

>KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125C ENT3
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p
          Length = 400

 Score = 91.7 bits (226), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 49/141 (34%), Positives = 78/141 (55%), Gaps = 1/141 (0%)

Query: 4   QFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRL 63
           ++ R A+N +  YT  +  VR+AT NE  G S  +++ +A  +Y+  E  EI+ MI +R 
Sbjct: 17  KYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEHIAQGTYNYREREEILGMIFRRF 76

Query: 64  NDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXXII 122
            +K    WR + K+L +L+YLV+ GSE  +   R NL ++K L  F +           +
Sbjct: 77  TEKTASEWRQIYKALQLLEYLVKHGSERFIDDVRTNLNLVKMLESFHYIDSQGRDQGINV 136

Query: 123 RVKAKELTNLLMDDERLRMER 143
           R +A +L  LL  DE++R ER
Sbjct: 137 RNRASQLVKLLESDEQIRQER 157

>KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON}
           Anc_4.346 YJR125C
          Length = 399

 Score = 90.9 bits (224), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 80/141 (56%), Gaps = 1/141 (0%)

Query: 4   QFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRL 63
           ++ R A+N +  YT  +  VR+AT NE  G S  +++++A  +Y+  E  EI+ MI +R 
Sbjct: 17  KYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNLREREEILGMIFRRF 76

Query: 64  NDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXXII 122
            +K G  WR + KSL +LDYL+R GSE  +   R ++ +I+ L  F +           +
Sbjct: 77  TEKAGSEWRQIYKSLQLLDYLIRRGSERFIDDVRSSIRLIELLETFHYIDSQGRDQGINV 136

Query: 123 RVKAKELTNLLMDDERLRMER 143
           R +AK L  LL DD ++R ER
Sbjct: 137 RNRAKALGELLSDDTKIRQER 157

>AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR125C
           (ENT3)
          Length = 364

 Score = 89.4 bits (220), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 77/141 (54%), Gaps = 1/141 (0%)

Query: 4   QFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRL 63
           ++ R A+N +  YT  +  VR+AT NE  G S  ++ ++A  +Y+  E  EI+ MI +R 
Sbjct: 17  KYFRKAQNVMLNYTGMEAKVREATNNEPWGASSTLMTQIAQGTYNFREREEILAMILRRF 76

Query: 64  NDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXXII 122
            +K    WR + KS+ +L+YLV+ GSE  +   R NL +I+ L  F +           +
Sbjct: 77  LEKSANEWRQIYKSMQLLEYLVKHGSERFIDDVRSNLNLIRMLETFHYIDSQGRDQGINV 136

Query: 123 RVKAKELTNLLMDDERLRMER 143
           R + K L  LL DDE +R ER
Sbjct: 137 RNRTKALVKLLEDDELIRAER 157

>NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa]
           {ON} Anc_4.346
          Length = 423

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 78/141 (55%), Gaps = 1/141 (0%)

Query: 4   QFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRL 63
           ++ R A+N +  YT  +  VR+AT NE  G S  +++++A  +Y+  E  EI+ MI +R 
Sbjct: 17  KYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNIREREEILSMIFRRF 76

Query: 64  NDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXXII 122
            +K G  WR + K+L +LDYL++ GSE  +   R ++ ++K L+ F +           +
Sbjct: 77  TEKTGSEWRQIYKALQLLDYLIKHGSEKFIDDVRSSVAVLKLLQTFHYIDAEGRDQGINV 136

Query: 123 RVKAKELTNLLMDDERLRMER 143
           R +   L  LL DD  +R ER
Sbjct: 137 RNRVTTLIELLRDDNSIRQER 157

>ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 424

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 79/141 (56%), Gaps = 1/141 (0%)

Query: 4   QFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRL 63
           ++ R A+N +  YT  +  VR+AT NE  G S  +++ +A  +Y+  E  EI+ MI +R 
Sbjct: 52  KYFRKAQNVVFNYTEMEAKVREATNNEPWGTSSTLMEYIAQGTYNLREREEILGMIFRRF 111

Query: 64  NDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXXII 122
            +K    WR + K+L +L+YL++ GSE  +   R ++ ++K L  F +           +
Sbjct: 112 TEKTANEWRQIYKALQLLEYLIKHGSERFIDDTRCSISLLKMLESFHYVDSQGRDQGINV 171

Query: 123 RVKAKELTNLLMDDERLRMER 143
           R +AK LT LL DD ++R ER
Sbjct: 172 RTRAKALTELLGDDNKIRAER 192

>KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.346
           YJR125C
          Length = 403

 Score = 88.2 bits (217), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 78/141 (55%), Gaps = 1/141 (0%)

Query: 4   QFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRL 63
           ++ R A+N +  +T  +  VR+AT NE  G S  +++++A  +Y+  E  E+M M+ +R 
Sbjct: 17  KYFRKAQNVVFNFTEMESKVREATNNEPWGASSTLMEQIAQGTYNYKEREEVMMMLMRRF 76

Query: 64  NDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXXII 122
            +K G  WR + K+L +LDYL+R GSE  +   R  L I++ L  F +           +
Sbjct: 77  TEKAGSEWRQIYKALQLLDYLIRRGSEKFIDDVRAALRIVRLLESFHYIDSQGRDQGVNV 136

Query: 123 RVKAKELTNLLMDDERLRMER 143
           R +AK++  LL DD  +R  R
Sbjct: 137 RNRAKQIVELLQDDAAVRDAR 157

>TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa]
           {ON} Anc_4.346 YJR125C
          Length = 426

 Score = 88.6 bits (218), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 79/141 (56%), Gaps = 1/141 (0%)

Query: 4   QFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRL 63
           ++ R A+N +  YT  +  VR+AT NE  G S  +++++A  +Y+  E  EI+ MI +R 
Sbjct: 17  KYFRKAQNVVFNYTDMEAKVREATNNEPWGASSTLMEQIAQGTYNPREREEILSMILRRF 76

Query: 64  NDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXXII 122
            +K G  WR + K+L +L+YL+  G+E  +   R +L +I+ L  F +           +
Sbjct: 77  TEKSGNLWRQIYKALQLLEYLITHGAERFIDEARSSLGLIRMLESFHYVDSEGRDQGANV 136

Query: 123 RVKAKELTNLLMDDERLRMER 143
           R +A+ +T+LL  D+ +R  R
Sbjct: 137 RSRAQAMTSLLSSDDAIRSAR 157

>TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346
           YJR125C
          Length = 399

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 76/141 (53%), Gaps = 1/141 (0%)

Query: 4   QFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRL 63
           ++ R A+N +  YT  +  VR+AT NE  G S  ++ ++A  +Y+  E  EI+ M+ +R 
Sbjct: 17  KYFRKAQNVMFNYTDMEAKVREATNNEPWGASSTLMKQIAQGTYNIREREEILGMVFRRY 76

Query: 64  NDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXXII 122
            +K    WR + KSL + DYL++ GSE  +   R ++ +IK L  F +           +
Sbjct: 77  TEKTASEWRQIYKSLQLTDYLIKHGSERFIDDVRTSISLIKMLESFHYIDSQGRDQGINV 136

Query: 123 RVKAKELTNLLMDDERLRMER 143
           R KA+ L   L DD+ +R ER
Sbjct: 137 RNKAQSLVAFLKDDDLIRAER 157

>Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar to
           Ashbya gossypii AER155C
          Length = 392

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 76/141 (53%), Gaps = 1/141 (0%)

Query: 4   QFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRL 63
           ++ R A+N +  YT  +  VR+AT NE  G    ++ ++A  +Y+  E  EI+ MI +R 
Sbjct: 17  KYFRKAQNVVFNYTGMEAKVREATNNESWGAPSSLMAQIAQGTYNYRERKEILGMIFRRF 76

Query: 64  NDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXXII 122
            +K    WR + KS+ +L+YL+  GSE  +   R  L +IK L  F +           +
Sbjct: 77  VEKTASEWRQIYKSVQLLEYLIYHGSEGFIDDVRSGLNLIKMLESFHYIDSQGRDQGINV 136

Query: 123 RVKAKELTNLLMDDERLRMER 143
           R + + L  LL +DE++R+ER
Sbjct: 137 RNRTQALVQLLNNDEQIRIER 157

>CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125c ENT3
           cytoskeletal adaptor
          Length = 412

 Score = 82.0 bits (201), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 49/141 (34%), Positives = 79/141 (56%), Gaps = 1/141 (0%)

Query: 4   QFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRL 63
           ++ R A+N +  YT  +  VR+AT NE  G S  +++++A  +Y+  E  EI+ MI +R 
Sbjct: 17  KYFRKAQNVVYNYTDMESKVREATNNEPWGASSTLMEQIAQGTYNIREREEILGMIFRRF 76

Query: 64  NDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXXII 122
            +K G  WR + K+L +L+YL++ GSE  +   R ++ I+K L  F +           +
Sbjct: 77  TEKSGSEWRQIYKALQLLEYLIKHGSERFIDDTRNSISIVKLLESFHYIDSQGRDQGVNV 136

Query: 123 RVKAKELTNLLMDDERLRMER 143
           R +A  LT LL DD  +R ER
Sbjct: 137 RNRAAALTALLADDSSIRAER 157

>SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some
           similarities with uniprot|Q07872 Saccharomyces
           cerevisiae YLL038C ENT4 Protein of unknown function
           contains an N-terminal epsin-like domain
          Length = 262

 Score = 71.2 bits (173), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 80/149 (53%), Gaps = 12/149 (8%)

Query: 5   FVRSAKNALKGYTSAQVLVRDATAN-EVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRL 63
           F+RS +N   G ++ +V V+ AT + E  G +  +++E++  +Y +    EI  +I +RL
Sbjct: 3   FIRSVRNM--GQSTTEVKVKKATDDDEYSGATGALMNEISVLTYSAKTLREITQVIHRRL 60

Query: 64  NDKGKYWR-------HVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXX 116
           +  G Y +       H+ K+LT++ YL+  GS + V W R+  Y++ TLREF        
Sbjct: 61  S--GNYRKSSHRNAVHILKTLTLISYLINNGSNDFVSWIRQYAYLVDTLREFNVSADKDR 118

Query: 117 XXXXIIRVKAKELTNLLMDDERLRMERGE 145
                +R+ + +L+ LL DD  L+  R E
Sbjct: 119 KMAEQVRMLSIKLSKLLKDDLMLQERRRE 147

>Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {ON}
           YLL038C (ENT4) - Ent4p [contig 144] FULL
          Length = 254

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 75/147 (51%), Gaps = 8/147 (5%)

Query: 5   FVRSAKNALKGYTSAQVLVRDATAN-EVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRL 63
            +++ +N   G +S +V  R+AT + E  G +  +++EL+  +Y      EI  +I KRL
Sbjct: 3   LLKTVRNI--GQSSTEVKTRNATNDDEHNGATGSLMNELSVLTYSPRTLREITQVIRKRL 60

Query: 64  N-----DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXX 118
           +        K   H+ K+LT++ YL+  GS+  V+W R  LY+I TL+EF          
Sbjct: 61  SGNSRMSSHKNAVHLLKTLTLIAYLINNGSDEFVVWIRSYLYLIDTLKEFNGGSRTKERM 120

Query: 119 XXIIRVKAKELTNLLMDDERLRMERGE 145
              IR  A  L  +L D+E LR  R +
Sbjct: 121 ASQIRNLASSLAAILRDEELLRQRRSD 147

>Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON}
           complement(17825..18631) [807 nt, 269 aa]
          Length = 268

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 71/142 (50%), Gaps = 8/142 (5%)

Query: 8   SAKNALKGYTSAQVLVRDATA-NEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLNDK 66
           S +N ++  T A+V  ++AT  NE  G +  +++E++  +Y      EI+ ++ KRL   
Sbjct: 6   SVRNFVQSATEAKV--KEATDDNETSGATGTLMNEISVLTYSPKTLKEIIQVLKKRLTGS 63

Query: 67  GKY-----WRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXXI 121
            K        H+ K++T++ YL+  GS + + W R N+ I + L++F             
Sbjct: 64  SKKSSHRNCVHILKTMTLISYLINNGSNDFIAWARSNIMIFEVLKDFEVIHEDDEKMAEQ 123

Query: 122 IRVKAKELTNLLMDDERLRMER 143
           IR  A +L  L+ DDE L   R
Sbjct: 124 IRYIAGDLCILINDDELLEARR 145

>KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 255

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 69/137 (50%), Gaps = 6/137 (4%)

Query: 15  GYTSAQVLVRDATAN-EVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRL---NDKGKYW 70
           G +  ++  ++AT + E  G +  +++E++  +Y S    EI  ++ KRL   N K  + 
Sbjct: 11  GQSQTEIKTKNATNDDEYSGATGSLMNEISVLTYSSRTLREITAVVRKRLSGNNRKSSHK 70

Query: 71  R--HVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXXIIRVKAKE 128
              H+ K+LT+  YL+  GS   V W R  +Y+I +L+EF             IR  A  
Sbjct: 71  NAVHILKTLTLTAYLINNGSNEFVAWIRSYVYLIDSLKEFTIGSRGQERMAVQIRSLAST 130

Query: 129 LTNLLMDDERLRMERGE 145
           L+ +L DDE LR  R +
Sbjct: 131 LSVILRDDELLRQRRSD 147

>TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17
           YLL038C
          Length = 257

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 69/135 (51%), Gaps = 6/135 (4%)

Query: 17  TSAQVLVRDAT-ANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLNDKG-----KYW 70
           ++ ++ V+ AT  NE  G +  +++E++  +Y      EI+ ++ KRL   G     K  
Sbjct: 13  STTELKVKQATDENESSGATGTLMNEISVLTYSPKTLKEIVQVVRKRLMGHGRRNSHKIC 72

Query: 71  RHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXXIIRVKAKELT 130
            H+ K+LT++ YL+  GS + + W R N+ ++  L+EF             IR  +++L 
Sbjct: 73  IHLVKTLTLVTYLMNNGSNDFIAWVRGNMALVDCLKEFNVQDRNDEKIGQQIRAMSQDLC 132

Query: 131 NLLMDDERLRMERGE 145
            L+ DD+ L   R E
Sbjct: 133 TLIKDDDLLENRRAE 147

>TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON}
           Anc_4.346 YJR125C
          Length = 339

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 71/147 (48%), Gaps = 1/147 (0%)

Query: 4   QFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRL 63
           +F R A+N L   T  +  VR+AT N+  G SV ++ ++   +++  +  +I++M+  R 
Sbjct: 17  KFFRMAENFLFNLTDMESKVREATNNDPWGTSVILMAQINAGTFEINQRADIINMLLNRF 76

Query: 64  NDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXXII 122
            +K G  WR + KS+ +L YL+  GS   V   + NL +IK L  F             I
Sbjct: 77  LEKNGSQWRQIYKSVLLLQYLLINGSTEFVSEVKLNLTLIKNLMLFEFIDDQGYNQSSKI 136

Query: 123 RVKAKELTNLLMDDERLRMERGEDKGA 149
               + L  L+ DD  L   R + K +
Sbjct: 137 SKATERLIELMTDDHLLNDLREKSKNS 163

>TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON}
           Anc_4.17 YLL038C
          Length = 280

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 71/144 (49%), Gaps = 8/144 (5%)

Query: 8   SAKNALKGYTSAQVLVRDATAN-EVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLN-- 64
           S +N ++  T ++V  R AT + E  G +  +++E++  +Y      EI+ ++ KRL   
Sbjct: 6   SVRNFVQSPTESKV--RQATDDDETSGATGTLMNEISVLTYSPKTLKEIVQILKKRLTGY 63

Query: 65  ---DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXXI 121
              +  K   H+ K+LT++ YL+  GS + + W R N+ + + L+ F             
Sbjct: 64  SKKNSHKNCVHILKTLTLITYLINNGSNDFIAWTRSNIMLFEYLKNFEVQNLEDEKMGQQ 123

Query: 122 IRVKAKELTNLLMDDERLRMERGE 145
           I     ++ N++ DD+ L  +R +
Sbjct: 124 IVFICNDICNIINDDDMLEQKRKD 147

>KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038C ENT4
           Protein of unknown function contains an N- terminal
           epsin- like domain
          Length = 225

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 72/137 (52%), Gaps = 8/137 (5%)

Query: 15  GYTSAQVLVRDAT-ANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLNDKGKYWRH- 72
           G ++ Q+ V+ AT +NE  G +  +++EL+  +Y      EI ++I KRL +     ++ 
Sbjct: 11  GQSTTQLKVKQATDSNESYGATGTLMNELSVLTYSEKSANEIYEVIRKRLMNGSSRLKNS 70

Query: 73  ------VAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXXIIRVKA 126
                 V K+LT+++YL+  GSE  VLW R +L  I+ L+++             I+  +
Sbjct: 71  HDSVVQVLKTLTLIEYLLYNGSEEFVLWMRRHLAYIEALKDYHCSNDKDKSKVKQIKSLS 130

Query: 127 KELTNLLMDDERLRMER 143
           ++++  L +D+ L   R
Sbjct: 131 EDISKNLKEDDFLEKRR 147

>ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 259

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 67/137 (48%), Gaps = 6/137 (4%)

Query: 15  GYTSAQVLVRDAT-ANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLNDKGKYWRH- 72
           G +S ++ VR AT  +E  G +  +++E++  +Y      EI  ++ +RL+  G+   H 
Sbjct: 11  GPSSTELKVRKATNEDEKTGATGTLMNEISVLTYSPKTVREITQVLKRRLSSYGRRTSHK 70

Query: 73  ----VAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXXIIRVKAKE 128
               + K+LT++ YL+  GSE  V W R NL   + L+               IR  + +
Sbjct: 71  NSIHIVKALTLILYLINNGSEEFVAWVRGNLIYFECLKSCEVSQKRDEPLAKQIRSMSNQ 130

Query: 129 LTNLLMDDERLRMERGE 145
           + + + DDE L  ++ E
Sbjct: 131 ICDCVKDDELLENKKKE 147

>Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ACL061C
          Length = 254

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 75/153 (49%), Gaps = 14/153 (9%)

Query: 1   MPTQFVRSAKNALKGYTSAQVLVRDATAN-EVEGPSVDMLDELAHRSYDSVEFFEIMDMI 59
           MP  F+ S ++   G +S  V V+ AT + E  G    +++E+A  +Y      EI  ++
Sbjct: 1   MP--FLSSVRHL--GSSSTTVKVKKATDDSEHNGAYGSLMNEIAILTYSPNTLREITQVL 56

Query: 60  DKRLNDKGKYWR-------HVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXX 112
            KRL   G Y +       ++ K+LT++ +LV  GSE C+ W R +L +I++ ++F    
Sbjct: 57  KKRL--VGNYKKTPSKRAVNLLKTLTLIRFLVINGSEECIAWLRRHLVLIRSFQDFTLRD 114

Query: 113 XXXXXXXXIIRVKAKELTNLLMDDERLRMERGE 145
                    I++ + +L  LL D   L   R E
Sbjct: 115 GEKKQMVNQIQLLSCKLCQLLTDSNLLEDMRKE 147

>Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 65/130 (50%), Gaps = 7/130 (5%)

Query: 23  VRDATA-NEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRL------NDKGKYWRHVAK 75
           V+ AT+ +E  G +  +++E++  +Y      EI+ ++ KRL       +  +    V K
Sbjct: 19  VKQATSEDETSGATGTLMNEISILTYSPKTVREIIQIVRKRLLLGQNRRNSHRSCIQVMK 78

Query: 76  SLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXXIIRVKAKELTNLLMD 135
           +LT++ YL+  GS   + W + N+ +I+ L +F+            IR  ++ L  LL D
Sbjct: 79  TLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQAQDARDDRNGEEIRKLSRNLHELLQD 138

Query: 136 DERLRMERGE 145
           DE L  +R +
Sbjct: 139 DELLERQRKD 148

>CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038c ENT4
          Length = 260

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 60/109 (55%), Gaps = 8/109 (7%)

Query: 8   SAKNALKGY--TSAQVLVRDATA-NEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLN 64
           S  +  KG+  +  ++ VR AT  NE+ G +  +++E++  +Y      +++ +I KRL+
Sbjct: 2   SLMHTFKGFLLSPTELKVRQATDDNELAGATGTLMNEISVLTYSKKTLKDVIQVIRKRLS 61

Query: 65  -----DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREF 108
                +  +   HV K+LT++ YL+  GS + + W + + Y+I+ L  F
Sbjct: 62  GVNKRNSHRTCLHVLKTLTLVSYLLNNGSNDFIAWLKSSKYVIEYLSSF 110

>TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.17
           YLL038C
          Length = 423

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 65/134 (48%), Gaps = 7/134 (5%)

Query: 19  AQVLVRDATA-NEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLNDKGKY-----WRH 72
            ++ VR AT  NE  G +  +++E++  +Y +    EI+ ++ KRL   GK        H
Sbjct: 15  TELKVRTATDDNENSGATGTLMNEISVLTYSTKTNKEIVTVLKKRLTGYGKKSSHRNCIH 74

Query: 73  VAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXXI-IRVKAKELTN 131
           + K+LT++ YL+  GS   + W  EN  + + ++ F            I IR  ++ +  
Sbjct: 75  IIKTLTLIAYLMNNGSLEFIRWINENQLLFEVMKNFEVSDTIHDEKFAIQIRDLSERILE 134

Query: 132 LLMDDERLRMERGE 145
           L+ + E L  +R E
Sbjct: 135 LINNRELLEQKRNE 148

>Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 62/130 (47%), Gaps = 7/130 (5%)

Query: 23  VRDATA-NEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRL------NDKGKYWRHVAK 75
           V+ AT+ +E  G +  +++E++  +Y      EI+ +I KRL       +  +    V K
Sbjct: 19  VKQATSEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRNCIQVMK 78

Query: 76  SLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXXIIRVKAKELTNLLMD 135
           +LT++ YL+  GS   + W + N+ +I+ L  F             IR  ++ L  LL D
Sbjct: 79  TLTLVSYLMNNGSNEFIKWLKGNMILIEILENFHIQDVRDERKREEIRKLSRNLLELLQD 138

Query: 136 DERLRMERGE 145
           D  L  +R +
Sbjct: 139 DGLLEKQRKD 148

>ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL038C
           (ENT4)
          Length = 234

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 48/92 (52%), Gaps = 6/92 (6%)

Query: 23  VRDATA-NEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLNDKG-----KYWRHVAKS 76
           VR AT  NE  G S  ++ E+   +Y      ++  ++ KRL+        K   H+ K+
Sbjct: 19  VRKATDDNEFVGASSALISEITILTYSCKTLLDVTRVLKKRLSGNANKSSHKNAVHILKA 78

Query: 77  LTVLDYLVRFGSENCVLWCRENLYIIKTLREF 108
           LT+ +YL+  GSE+ V W +    +++ L++F
Sbjct: 79  LTLTNYLIANGSEDFVQWLQGCAVLLRRLKDF 110

>NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON}
           Anc_4.17 YLL038C
          Length = 310

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 70/137 (51%), Gaps = 14/137 (10%)

Query: 23  VRDATA-NEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLND---KGKYWRH-----V 73
           V+ AT  NE  G +  +++E++  +Y      +I+ +I KRL+      K   H     +
Sbjct: 19  VKQATDDNETTGATGTLMNEISVLTYSPKTLKDIIQVIKKRLSSATSSNKKLSHKTSVYI 78

Query: 74  AKSLTVLDYLVRFGSENCVLWCRENLYIIKTLRE---FR-HXXXXXXXXXXIIRVKAKEL 129
            K+LT++ YL+  GS   + W R N Y+++ + +   F+             I+V A+++
Sbjct: 79  IKTLTLISYLINNGSNEFIEWLRLNFYLVENITKKCNFQLQDNSADSKMIGQIKVIAEDM 138

Query: 130 TNLLMDDERLRMERGED 146
           TNL+ ++E L  +R +D
Sbjct: 139 TNLI-NNENLLEQRRKD 154

>SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly
           similar to uniprot|P53309 Saccharomyces cerevisiae
           YGR241C YAP1802 Yeast Assembly Polypeptide, member of
           AP180 protein family, binds Pan1p and clathrin; member
           of clathrin assembly polypeptide AP180 family and weakly
           similar to uniprot|P38856 Saccharomyces cerevisiae
           YHR161C YAP1801 Yeast Assembly Polypeptide member of
           AP180 protein family binds Pan1p and clathrin clathrin
           assembly protein
          Length = 669

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 43/89 (48%), Gaps = 2/89 (2%)

Query: 22  LVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLNDKGKYWRHVAKSLTVLD 81
           LV+ AT  ++  P    +D +   + DS EF EIM  ++ R+ND    W  V KSL V+ 
Sbjct: 7   LVKGATKIKMAPPKQKYIDPILLGTSDSSEFMEIMKALESRINDTA--WTIVYKSLIVIH 64

Query: 82  YLVRFGSENCVLWCRENLYIIKTLREFRH 110
            ++R G  +  +    +      LR+  H
Sbjct: 65  LMMRDGDRDVTIKYLSHHLEFFQLRDVFH 93

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 8/66 (12%)

Query: 353 QQPVSTGSNNPFALNGMPLQSNSK----PQAASDLAGLNNWGNNSTGQLEMP--KYQPRP 406
           QQP+ TGSNNPF+L+ +     ++    P + ++  G    GN    QL  P  + QP+ 
Sbjct: 467 QQPMKTGSNNPFSLDNITKHKETRELVNPFSQTNFNG--EGGNPQHQQLGAPFGQQQPQL 524

Query: 407 QQPQHN 412
           Q+P  N
Sbjct: 525 QKPSSN 530

>NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4.17
           YLL038C
          Length = 267

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 62/130 (47%), Gaps = 7/130 (5%)

Query: 23  VRDAT-ANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLNDKGKYWRH-----VAKS 76
           V+ AT  +E  G +  +++E++  +Y      EI+ ++ KRL+   +   H     + K+
Sbjct: 19  VKQATNEDETMGATGTLMNEISVLTYSPKTLKEIVQVLKKRLSGYSRKTSHKNCIFIIKT 78

Query: 77  LTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXXXXXXXXXXIIRVKAKELTNLLMDD 136
           LT++ YL+  GS   V W R N  +I  L   +            I+  A +L  L+ DD
Sbjct: 79  LTLMAYLINNGSNEFVAWIRNNSSLISNLISEKVEYPKDDKMGPEIKSIAADLMELIQDD 138

Query: 137 ERLRMERGED 146
           + L  ER +D
Sbjct: 139 DLLE-ERRKD 147

>YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}
           ENT4Protein of unknown function, contains an N-terminal
           epsin-like domain; proposed to be involved in the
           trafficking of Arn1p in the absence of ferrichrome
          Length = 247

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 49/93 (52%), Gaps = 7/93 (7%)

Query: 23  VRDAT-ANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRL------NDKGKYWRHVAK 75
           V+ AT  +E  G +  +++E++  +Y      EI+ +I KRL       +  +    V K
Sbjct: 19  VKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRNCIQVMK 78

Query: 76  SLTVLDYLVRFGSENCVLWCRENLYIIKTLREF 108
           +LT++ YL+  GS   + W + N+ +I+ L +F
Sbjct: 79  TLTLVSYLMNNGSNEFIKWLKGNMILIEILEDF 111

>Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 49/93 (52%), Gaps = 7/93 (7%)

Query: 23  VRDAT-ANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRL------NDKGKYWRHVAK 75
           V+ AT  +E  G +  +++E++  +Y      EI+ ++ KRL       +  +    V K
Sbjct: 19  VKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVVRKRLLLGQNRRNSHRNCIQVMK 78

Query: 76  SLTVLDYLVRFGSENCVLWCRENLYIIKTLREF 108
           +LT++ YL+  GS   + W + N+ +++ L +F
Sbjct: 79  TLTLVSYLMNNGSNEFIKWLKSNMILVEILEDF 111

>YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}
          YAP1801Protein involved in clathrin cage assembly;
          binds Pan1p and clathrin; homologous to Yap1802p,
          member of the AP180 protein family
          Length = 637

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 2/72 (2%)

Query: 22 LVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLNDKGKYWRHVAKSLTVLD 81
          LV+ AT  +   P    LD +   + +  +F+EI+  +D R+ND    W  V KSL V+ 
Sbjct: 7  LVKGATKIKSAPPKQKYLDPILLGTSNEEDFYEIVKGLDSRINDTA--WTIVYKSLLVVH 64

Query: 82 YLVRFGSENCVL 93
           ++R GS++  L
Sbjct: 65 LMIREGSKDVAL 76

>Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON}
           YHR161C (REAL)
          Length = 621

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 45/88 (51%), Gaps = 5/88 (5%)

Query: 22  LVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLNDKGKYWRHVAKSLTVLD 81
           LV+ AT  +   P    LD +   +    +F+EI+  +D R+ND    W  V K+L V+ 
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLATGSEEDFYEIVKALDSRVNDTA--WTIVYKTLLVVH 64

Query: 82  YLVRFGSENCVL-WCRENL--YIIKTLR 106
            ++R G ++  L +   NL  + I+ +R
Sbjct: 65  LMMREGKKDVALRYYSRNLEFFSIENIR 92

>KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17
           YLL038C
          Length = 275

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 76/157 (48%), Gaps = 17/157 (10%)

Query: 5   FVRSAKNALKGYTSAQVLVRDAT-ANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRL 63
           F  S +N +  Y+  ++ VR AT  NE+   +  +++E++  +Y +    EI+ ++ K+L
Sbjct: 3   FFNSVRNLV--YSQTELKVRQATDENEIIRSTGTLMNEISVLTYSAKTLKEIIGILKKKL 60

Query: 64  -------NDKG----KYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHXX 112
                  N  G    K    V K+ T++ YL+  GS + + W + N  +++ L +     
Sbjct: 61  SLLYGLKNGNGIISHKVCVQVLKTFTLISYLLNNGSNDFINWLKLNNGVLQILAKVDSNN 120

Query: 113 XXXXXXXXIIRVKAKELTN---LLMDDERLRMERGED 146
                    I  +A+++T    LL++D +L  +R +D
Sbjct: 121 HITDDEDLHILNQAQKITKDIILLINDNKLLEKRRKD 157

>TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.335
           YDR153C
          Length = 491

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 43/98 (43%), Gaps = 20/98 (20%)

Query: 6   VRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLND 65
            R A+N +  Y   Q+ +R AT  +  GP+   LD++     + V   +I+D I KRL D
Sbjct: 20  ARYAQNMIIAYEPYQIDIRQATNTDSWGPTKKHLDQIL-LDRNKVPLRKIVDYIMKRLMD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLV 84
                               G  WR V KSL VL +L+
Sbjct: 79  HINTRPRNLYDRARKDYVNYGTEWRVVFKSLIVLKFLL 116

>TBLA0B05770 Chr2 complement(1364772..1366814) [2043 bp, 680 aa]
          {ON} Anc_5.84 YGR241C
          Length = 680

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 39/79 (49%), Gaps = 3/79 (3%)

Query: 22 LVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLNDKGKYWRHVAKSLTVLD 81
          LV+ AT  ++  P    +D +   S D  +F EI+  +  R++D    W  V KSL V  
Sbjct: 7  LVKGATKIKMAPPKQKYIDPILMGSTDPRDFHEIIRALYSRISDSA--WTVVYKSLIVTH 64

Query: 82 YLVRFGSENCVL-WCRENL 99
           L+R G ++  L +   NL
Sbjct: 65 LLIREGEKDITLDYLSNNL 83

>NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {ON}
           Anc_8.335 YDR153C
          Length = 416

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 47/113 (41%), Gaps = 24/113 (21%)

Query: 6   VRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLND 65
            R A+N +  Y   QV +R AT  +  GP+   L ++    Y  V  + +++   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRNRY-QVPLYLMVEYTLKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLVRFGSE----NCVLWC 95
                               G  WR V K L V+D+L+   SE    N VL C
Sbjct: 79  HIASRPKNFYEKARKEYVNYGAEWRVVLKCLVVIDFLILNVSEGDELNQVLSC 131

>Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON}
          YHR161C (REAL)
          Length = 627

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 2/72 (2%)

Query: 22 LVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLNDKGKYWRHVAKSLTVLD 81
          LV+ AT  +   P    LD +   +    +F+EI+  ++ R+ND    W  V KSL V+ 
Sbjct: 7  LVKGATKIKSAPPKQKYLDPILLGTSSEEDFYEIVKGLNFRINDTA--WTIVYKSLLVVH 64

Query: 82 YLVRFGSENCVL 93
           ++R G+++  L
Sbjct: 65 LMIREGAKDVAL 76

>Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON}
           complement(20765..21919) [1155 nt, 385 aa]
          Length = 384

 Score = 38.5 bits (88), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 70/170 (41%), Gaps = 31/170 (18%)

Query: 7   RSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLNDK 66
           R  +N +  Y   Q+ +R AT  +  GP+   L ++    Y SV  + + + + KR+ D 
Sbjct: 21  RFMQNMIVQYEPYQIDIRRATNTDAWGPTTKHLQKVIRNKY-SVPLYLMTEYVLKRIVDH 79

Query: 67  -------------------GKYWRHVAKSLTVLDYLVRFGSE----NCVLWCRENLY--- 100
                              G  WR + K L V++YL+   SE    N V  C EN     
Sbjct: 80  LAKRPKNLYEKARKEYVNYGSEWRIILKCLIVIEYLLLNVSEPEELNQVKSCLENHKQIF 139

Query: 101 ---IIKTLREFRHXXXXXXXXXXIIRVKAKELTNLLMDDERLRMERGEDK 147
              I+    EF +          I + K + + NL+ D E LR ER ++K
Sbjct: 140 NSNILNYKIEFCNDGKMEVHERGIQK-KCEVIINLVDDPEFLREERSKNK 188

>KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa]
           {ON} Anc_8.335 YDR153C
          Length = 382

 Score = 38.1 bits (87), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 43/97 (44%), Gaps = 20/97 (20%)

Query: 7   RSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLNDK 66
           R A+N +  Y   Q+ VR AT  +  GP+   L+++    +  V  + + + I KRL D 
Sbjct: 21  RFAQNVIVQYEPYQIDVRRATNTDAWGPTTKHLEKVMRNRF-QVPMYLVTEYILKRLIDH 79

Query: 67  -------------------GKYWRHVAKSLTVLDYLV 84
                              G  WR V K LTV++YL+
Sbjct: 80  IATKPKNLYEKARKEYVNYGSEWRVVLKCLTVIEYLL 116

>NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8.335
           YDR153C
          Length = 418

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 48/113 (42%), Gaps = 24/113 (21%)

Query: 6   VRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLND 65
            R A+N +  Y   QV +R AT  +  GP+   L ++    Y  V  + +++   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLQKVLRNRY-QVPLYLMVEYTLKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYL---VRFGSE-NCVLWC 95
                               G  WR V K LTV++YL   V  G E N V+ C
Sbjct: 79  HIAVKPKNFYERARKEYVNYGAEWRVVLKCLTVVEYLMLNVDDGDELNQVVRC 131

>CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} similar
           to uniprot|Q03769 Saccharomyces cerevisiae YDR153c ENT5
          Length = 412

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 41/97 (42%), Gaps = 20/97 (20%)

Query: 7   RSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLNDK 66
           R A+N +  Y   QV VR AT  +  GP+   L ++    Y  V  + I + I KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDVRRATNTDSWGPTPKHLAKVLRNRY-QVPLYLITEYILKRLIDH 79

Query: 67  -------------------GKYWRHVAKSLTVLDYLV 84
                              G  WR V K L V++YL+
Sbjct: 80  IAQRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEYLL 116

>KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.335
           YDR153C
          Length = 421

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 42/98 (42%), Gaps = 20/98 (20%)

Query: 6   VRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLND 65
            R A+N +  Y   QV +R AT  +  GP+   L ++    Y  V  + + + I KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRHRY-QVPMYLMTEYILKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLV 84
                               G  WR V K LTV+++L+
Sbjct: 79  HIATRPKNLYEKARKDYVNYGAEWRVVLKCLTVIEFLM 116

>AGR046C Chr7 complement(800910..802073) [1164 bp, 387 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR153C
           (ENT5)
          Length = 387

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 43/99 (43%), Gaps = 22/99 (22%)

Query: 6   VRSAKNALKGYTSAQVLVRDATANEVEGPS-VDMLDELAHRSYDSVEFFEIMDMIDKRLN 64
            R A+N +  Y   QV VR AT  +  GP+   ML  + H+++  V  + I +   KRL 
Sbjct: 20  ARFAQNVIIQYEPYQVDVRRATNTDSWGPTPKQMLKVMRHKNH--VPMYLITEYTMKRLV 77

Query: 65  DK-------------------GKYWRHVAKSLTVLDYLV 84
           D                    G  WR V K L VL++L+
Sbjct: 78  DHMAKRPKNLYEKARKQYVNYGHEWRVVLKCLVVLEFLI 116

>ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q6Q5U2 Saccharomyces
           cerevisiae YDR153C ENT5 Protein containing an N-terminal
           epsin-like domain involved in clathrin recruitment and
           traffic between the Golgi and endosomes associates with
           the clathrin adaptor Gga2p clathrin adaptor complex AP-1
           and clathrin
          Length = 407

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 42/98 (42%), Gaps = 20/98 (20%)

Query: 6   VRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLND 65
            R A+N +  Y   QV VR AT  +  GP+   L+++    Y  V  + I +   KRL D
Sbjct: 20  ARFAQNMIVQYEPYQVDVRRATNTDSWGPTPKHLEKVLRNRY-QVPMYLITEYTLKRLID 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLV 84
                               G  WR V K LTV++YL+
Sbjct: 79  HIATRPKNFYEKARKEYVNYGSEWRVVLKCLTVVEYLL 116

>KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]
           {ON} similar to uniprot|Q6Q5U2 Saccharomyces cerevisiae
           YDR153C ENT5 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p clathrin adaptor complex AP-1 and
           clathrin
          Length = 399

 Score = 35.0 bits (79), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 64/168 (38%), Gaps = 29/168 (17%)

Query: 6   VRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLND 65
            R A+N +  Y   Q+ +R AT  +  GP+   L ++    Y+ V  F + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQIDIRRATNTDSWGPTPKHLAKVMRHRYE-VSMFLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLV----RFGSENCVLWCRENLYII 102
                               G  WR V K L +L+YL+    R    + VL C +    I
Sbjct: 79  HMAKRPKNMYEKARKQYVNYGNEWRVVLKCLVLLEYLLMRSDRGKETDQVLSCLQAHKHI 138

Query: 103 KTLREFRHXXX-----XXXXXXXIIRVKAKELTNLLMDDERLRMERGE 145
            T    ++                I+ K + +  L+ D   L+ ER +
Sbjct: 139 LTKETMQYRVDFSSDGKMELHERGIKKKCEHIIQLIEDTSYLKRERSK 186

>TBLA0A04040 Chr1 complement(1004703..1005950) [1248 bp, 415 aa]
           {ON} Anc_8.335 YDR153C
          Length = 415

 Score = 35.0 bits (79), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 46/112 (41%), Gaps = 24/112 (21%)

Query: 7   RSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLNDK 66
           R A+N +  Y   Q+ +R AT  +  GP+   L ++    Y  V  + + + I KR+ D 
Sbjct: 21  RFAQNVIVQYEPYQIDIRRATNTDAWGPTSKHLAKVLRNRY-QVPLYLMTEYILKRIVDH 79

Query: 67  -------------------GKYWRHVAKSLTVLDYL---VRFGSE-NCVLWC 95
                              G  WR V K L V+D+L   V  G E N V  C
Sbjct: 80  IAVRPKNFYEKARKDYVNYGAEWRVVLKCLVVIDFLFLNVEEGEELNQVKSC 131

>NDAI0A02830 Chr1 (636619..638040) [1422 bp, 473 aa] {ON} Anc_5.84
          YGR241C
          Length = 473

 Score = 35.0 bits (79), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 40/77 (51%), Gaps = 1/77 (1%)

Query: 17 TSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLNDKGKYWRHVAKS 76
          TS + LV+ AT  ++  P    +D +   + +++EF +I+  +  R+N+    W  + K+
Sbjct: 2  TSYKKLVKGATKIKMAPPKQKYVDPILLGTSNNIEFQQIVSELTSRINN-CNIWSVIYKT 60

Query: 77 LTVLDYLVRFGSENCVL 93
          L V+  ++  G  N  L
Sbjct: 61 LIVVHLMISIGEPNVTL 77

>KNAG0E00610 Chr5 complement(102826..104640) [1815 bp, 604 aa]
          {ON} Anc_5.84 YGR241C
          Length = 604

 Score = 34.3 bits (77), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 33/72 (45%), Gaps = 2/72 (2%)

Query: 22 LVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLNDKGKYWRHVAKSLTVLD 81
          LV+ AT  ++  P    +D +   +    +F EI+  +  R+ D    W  V KSL V  
Sbjct: 7  LVKGATKIKMAPPKAKYVDPILLGTAQRDDFREIVGALRTRVGDSA--WTVVYKSLLVCH 64

Query: 82 YLVRFGSENCVL 93
           + R G E  VL
Sbjct: 65 LMFREGDEQIVL 76

>NCAS0E03820 Chr5 (750631..751917) [1287 bp, 428 aa] {ON} Anc_5.84
          YGR241C
          Length = 428

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 17 TSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLNDKGKYWRHVAKS 76
          TS   LV+ AT  ++  P    +D +   + + +EF +I+  +  R+N+    W  V K+
Sbjct: 2  TSYNKLVKGATKVKMAPPKQKYVDPILLGTANPMEFEQIVSQLTARINN-CNIWSVVYKT 60

Query: 77 LTVLDYLVRFGSENCVL 93
          L V+  ++  G +   L
Sbjct: 61 LIVVHLMISIGEQGVTL 77

>Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)
           [1215 bp, 404 aa] {ON} ANNOTATED BY YGOB -
          Length = 404

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 65/168 (38%), Gaps = 29/168 (17%)

Query: 6   VRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLND 65
            R A+N +  Y   QV +R AT  +  GP+   L ++    Y  V    + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKY-QVPLHLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYL---VRFGSE-NCVLWC--RENLY 100
                               G  WR V K L VL+YL   V  GSE + V+ C       
Sbjct: 79  HIASRPKNLYEKARKQYVNYGNEWRVVLKCLVVLEYLLLNVDSGSEVDQVIGCLTTHKRI 138

Query: 101 IIKTLREFR---HXXXXXXXXXXIIRVKAKELTNLLMDDERLRMERGE 145
           + + + +FR               I+ K +++   L D   L+ ER +
Sbjct: 139 LSRDVMQFRVDFSADGKMEVHERGIKKKCEQILQYLEDPSYLKRERAK 186

>TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.335
           YDR153C
          Length = 385

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 40/97 (41%), Gaps = 20/97 (20%)

Query: 7   RSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLNDK 66
           R  +N +  Y   Q+ VR A+  +  GP+   L ++    Y SV  + I +   KRL D 
Sbjct: 21  RFMQNMIVQYEPYQIDVRRASNTDAWGPTSKHLQKVLRHKY-SVPLYLITEYTLKRLIDH 79

Query: 67  -------------------GKYWRHVAKSLTVLDYLV 84
                              G  WR V K L +LD+L+
Sbjct: 80  IATNSKNVYEKARKEYVNFGSEWRVVFKCLVILDFLL 116

>Skud_4.412 Chr4 complement(736255..737475) [1221 bp, 406 aa] {ON}
           YDR153C (REAL)
          Length = 406

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 69/172 (40%), Gaps = 33/172 (19%)

Query: 6   VRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLND 65
            R A+N +  Y   QV +R AT  +  GP+   L ++    Y  V  + + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLAKVLRNRY-QVPLYLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYL---VRFGSE-----NCVLWCREN 98
                               G  WR V K L V+++L   V  G E     +C+L  +  
Sbjct: 79  HIASRPKNLYEKARKDYVNYGSEWRVVLKCLVVVEFLLMNVDVGDELNQIRSCLLTHKH- 137

Query: 99  LYIIKTLREFR---HXXXXXXXXXXIIRVKAKELTNLLMDDERLRMERGEDK 147
             + + + +F+               IR K + +   L + + L+ ERG++K
Sbjct: 138 -ILTREIAQFKVKFSNDGKMEIHERGIRKKGELILQYLENPQFLKKERGKNK 188

>TDEL0F04590 Chr6 complement(864567..865652) [1086 bp, 361 aa] {ON}
           Anc_8.335 YDR153C
          Length = 361

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 41/97 (42%), Gaps = 20/97 (20%)

Query: 7   RSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMIDKRLNDK 66
           R A+N +  Y   Q+ +R AT  +  GP+   L+++    Y  V  + + +   KRL D 
Sbjct: 21  RFAQNMIVQYEPYQIDIRRATNTDAWGPTPKHLEKVLRNRY-QVPLYLLTEYTLKRLVDH 79

Query: 67  -------------------GKYWRHVAKSLTVLDYLV 84
                              G  WR V K L V+++L+
Sbjct: 80  VATRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEFLL 116

>CAGL0F08063g Chr6 complement(796793..798397) [1605 bp, 534 aa] {ON}
           similar to uniprot|P53309 Saccharomyces cerevisiae
           YGR241c YAP1802 adaptor protein andsimilar to
           uniprot|P38856 Saccharomyces cerevisiae YHR161c
          Length = 534

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 14/17 (82%)

Query: 353 QQPVSTGSNNPFALNGM 369
           QQP+ TGSNNPFAL  M
Sbjct: 466 QQPLRTGSNNPFALENM 482

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,091,316
Number of extensions: 1679528
Number of successful extensions: 5799
Number of sequences better than 10.0: 157
Number of HSP's gapped: 5865
Number of HSP's successfully gapped: 191
Length of query: 538
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 424
Effective length of database: 40,409,475
Effective search space: 17133617400
Effective search space used: 17133617400
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)